F407983

General Info

Members Datasets Scaffolds Average Seq Length
325 168 316 145

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0095232|Ga0495610_0095232_501_1028
Length 175
Sequence MYHREHRQEFRMTDPFLPLPAMRLSTVRRLTRRLLAILLLTLPAWPPAFAAEAGPHDPVIVVSPRNPLSALRYEQVAAIFMAQTDRFPGGAEAVALDLPPGSALRDAFYRRVADRSPALMKAYWSKMVFTGRGQPPRELHNSAAVRRMVADNPAMIGYIDRAALDASVKVLELRP

Samples

Sample ID Description Type Environment
1 2643221684 Massilia sp. Root133 Isolate Unclassified
2 2738541297 Duganella sp. GV083 Isolate Unclassified
3 2738541357 Duganella sp. GV053 Isolate Unclassified
4 2738543003 Duganella sp. GV066 Isolate Unclassified
5 2738543026 Duganella sp. GV089 Isolate Unclassified
6 2738543029 Duganella sp. GV039 Isolate Unclassified
7 2842711865 Duganella sp. R-73148 Isolate Unclassified
8 2857558681 Duganella sp. R-74565 Isolate Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
39 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
40 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
64 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
73 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
74 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
77 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 0
Isolates 2.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8
Nodule 0.62
Rhizoplane 3.69
Rhizosphere 80.92
Stem 0
Stem Tuber 0
Unclassified 6.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10057617 3300003322 Bacteria 8818
2 rootL2_10143604 3300003322 Bacteria 2942
3 Ga0055529_1000917 3300003763 Bacteria 16049
4 Ga0055526_1000120 3300003771 Bacteria 68989
5 Ga0055537_1000179 3300003773 Bacteria 47132
6 Ga0055524_1007957 3300003775 Bacteria 4450
7 Ga0055534_1000495 3300003784 Bacteria 21714
8 Ga0055528_1000119 3300003790 Bacteria 62428
9 Ga0065165_1000039 3300005262 Bacteria 208372
10 Ga0070658_10050913 3300005327 Bacteria 3357
11 Ga0070658_10142064 3300005327 Bacteria 2006
12 Ga0070658_10344577 3300005327 Bacteria 1275
13 Ga0070676_10994954 3300005328 Bacteria 629
14 Ga0068869_101350409 3300005334 Bacteria 630
15 Ga0070660_100040609 3300005339 Bacteria 3542
16 Ga0070660_100076227 3300005339 Bacteria 2626
17 Ga0070692_11199343 3300005345 Bacteria 540
18 Ga0070659_100013628 3300005366 Bacteria 6057
19 Ga0070659_100105305 3300005366 Bacteria 2273
20 Ga0070679_100706266 3300005530 Bacteria 951
21 Ga0068855_100037644 3300005563 Bacteria 5751
22 Ga0068855_101013773 3300005563 Bacteria 872
23 Ga0070664_100322123 3300005564 Bacteria 1401
24 Ga0068852_100052606 3300005616 Bacteria 3500
25 Ga0070717_10153109 3300006028 Bacteria 1996
26 Ga0075362_10015726 3300006177 Bacteria 3083
27 Ga0099826_10000001 3300006948 Bacteria 1155201
28 Ga0105244_10010503 3300009036 Bacteria 5612
29 Ga0105243_10071091 3300009148 Bacteria 2812
30 Ga0105242_10012260 3300009176 Bacteria 6598
31 Ga0105239_10135143 3300010375 Bacteria 2745
32 Ga0157371_10000018 3300013102 Bacteria 310522
33 Ga0182006_1027566 3300015261 Bacteria 2316
34 Ga0182007_10044073 3300015262 Bacteria 1481
35 Ga0182007_10066299 3300015262 Bacteria 1183
36 Ga0163161_10133639 3300017792 Bacteria 1873
37 Ga0209437_107172 3300025233 Bacteria 1825
38 Ga0207425_1000198 3300025245 Bacteria 48223
39 Ga0209565_1000003 3300025263 Bacteria 1099648
40 Ga0209565_1003750 3300025263 Bacteria 4810
41 Ga0209455_1000026 3300025272 Bacteria 653778
42 Ga0209673_1000003 3300025273 Bacteria 980859
43 Ga0209130_1000084 3300025284 Bacteria 160070
44 Ga0209675_1000003 3300025291 Bacteria 1003982
45 Ga0209025_1008142 3300025294 Bacteria 7609
46 Ga0209564_1000002 3300025295 Bacteria 1636803
47 Ga0209564_1000012 3300025295 Bacteria 792078
48 Ga0209564_1012821 3300025295 Bacteria 3618
49 Ga0209758_1001300 3300025297 Bacteria 30598
50 Ga0209256_1000005 3300025299 Bacteria 1315082
51 Ga0209256_1000295 3300025299 Bacteria 87239
52 Ga0207426_1006899 3300025302 Bacteria 4837
53 Ga0207655_1039115 3300025728 Bacteria 2064
54 Ga0207705_10001157 3300025909 Bacteria 21460
55 Ga0207705_10093901 3300025909 Bacteria 2199
56 Ga0207654_10149685 3300025911 Bacteria 1497
57 Ga0207671_10161527 3300025914 Bacteria 1735
58 Ga0207657_10031740 3300025919 Bacteria 4780
59 Ga0207657_10417258 3300025919 Bacteria 1055
60 Ga0207649_10061978 3300025920 Bacteria 2356
61 Ga0207706_10135685 3300025933 Bacteria 2165
62 Ga0207686_10012247 3300025934 Bacteria 4712
63 Ga0207709_10492472 3300025935 Bacteria 955
64 Ga0207704_10099755 3300025938 Bacteria 1932
65 Ga0207667_10015776 3300025949 Bacteria 8566
66 Ga0207667_10548544 3300025949 Bacteria 1169
67 Ga0207702_11545835 3300026078 Bacteria 657
68 Ga0207698_11624845 3300026142 Bacteria 662
69 Ga0209282_1000001 3300027666 Bacteria 2450367
70 Ga0316181_1077985 3300030744 Bacteria 2242
71 Ga0307406_11279507 3300031901 Bacteria 639
72 Ga0395899_0012541 3300037312 Bacteria 6497
73 Ga0395899_0036371 3300037312 Bacteria 3693
74 Ga0395900_0004864 3300037418 Bacteria 14154
75 Ga0395900_0017833 3300037418 Bacteria 7245
76 Ga0395900_0508884 3300037418 Bacteria 1153
77 Ga0395898_0067597 3300037466 Bacteria 3459
78 Ga0395898_0104716 3300037466 Bacteria 2713
79 Ga0395898_0471762 3300037466 Bacteria 1194
80 Ga0395898_0525131 3300037466 Bacteria 1125
81 Ga0395905_0035041 3300037471 Bacteria 4712
82 Ga0395905_0148743 3300037471 Bacteria 2203
83 Ga0395901_0002619 3300038443 Bacteria 18198
84 Ga0395901_0174997 3300038443 Bacteria 2251
85 Ga0395901_0525606 3300038443 Bacteria 1201
86 Ga0436363_0453409 3300039450 Bacteria 538
87 Ga0439448_0028890 3300042005 Bacteria 1753
88 Ga0439448_0041562 3300042005 Bacteria 1488
89 Ga0439450_002201 3300042008 Bacteria 3026
90 Ga0439458_0032241 3300042157 Bacteria 1252
91 Ga0466972_0195037 3300044658 Bacteria 949
92 Ga0466982_0023689 3300044672 Bacteria 3550
93 Ga0466965_0066674 3300044683 Bacteria 1805
94 Ga0466966_0105916 3300044684 Bacteria 1735
95 Ga0466966_0108493 3300044684 Bacteria 1712
96 Ga0466966_0178881 3300044684 Bacteria 1287
97 Ga0466961_0061094 3300044693 Bacteria 2395
98 Ga0466961_0128302 3300044693 Bacteria 1590
99 Ga0466971_0054788 3300044719 Bacteria 1797
100 Ga0466971_0113969 3300044719 Bacteria 1249
101 Ga0466971_0182417 3300044719 Bacteria 987
102 Ga0466971_0429667 3300044719 Bacteria 646
103 Ga0466970_0020288 3300044765 Bacteria 3452
104 Ga0466970_0069498 3300044765 Bacteria 1893
105 Ga0466970_0106466 3300044765 Bacteria 1530
106 Ga0466970_0116526 3300044765 Bacteria 1461
107 Ga0466957_0029308 3300044842 Bacteria 3281
108 Ga0466957_0124424 3300044842 Bacteria 1646
109 Ga0466957_0807865 3300044842 Bacteria 666
110 Ga0466960_0286293 3300044901 Bacteria 925
111 Ga0466959_0120217 3300045049 Bacteria 1868
112 Ga0466959_0147514 3300045049 Bacteria 1659
113 Ga0466959_0633094 3300045049 Bacteria 718
114 Ga0466967_0013183 3300045976 Bacteria 6373
115 Ga0466967_0303710 3300045976 Bacteria 1536
116 Ga0495617_001350 3300046452 Bacteria 10873
117 Ga0495627_000228 3300046453 Bacteria 59535
118 Ga0495603_0036400 3300046455 Bacteria 2955
119 Ga0495590_0020337 3300046457 Bacteria 2360
120 Ga0495638_0000157 3300046460 Bacteria 107187
121 Ga0495638_0122219 3300046460 Bacteria 1537
122 Ga0495650_0000159 3300046471 Bacteria 152501
123 Ga0495650_0000410 3300046471 Bacteria 70515
124 Ga0495605_0000046 3300046474 Bacteria 175985
125 Ga0495605_0000183 3300046474 Bacteria 77763
126 Ga0495639_0031954 3300046475 Bacteria 2346
127 Ga0495584_0000597 3300046491 Bacteria 24296
128 Ga0495584_0051607 3300046491 Bacteria 2070
129 Ga0495584_0060990 3300046491 Bacteria 1896
130 Ga0495585_0000010 3300046492 Bacteria 229958
131 Ga0495585_0001850 3300046492 Bacteria 16006
132 Ga0495585_0001938 3300046492 Bacteria 15469
133 Ga0495585_0036013 3300046492 Bacteria 2795
134 Ga0495585_0370120 3300046492 Bacteria 693
135 Ga0495596_0000893 3300046500 Bacteria 17914
136 Ga0495596_0001921 3300046500 Bacteria 11512
137 Ga0495596_0019097 3300046500 Bacteria 2820
138 Ga0495607_0001028 3300046501 Bacteria 25612
139 Ga0495607_0001319 3300046501 Bacteria 22110
140 Ga0495607_0001945 3300046501 Bacteria 17457
141 Ga0495607_0003485 3300046501 Bacteria 12045
142 Ga0495607_0003486 3300046501 Bacteria 12045
143 Ga0495607_0016650 3300046501 Bacteria 4740
144 Ga0495607_0232494 3300046501 Bacteria 896
145 Ga0495583_0000006 3300046506 Bacteria 436893
146 Ga0495583_0001816 3300046506 Bacteria 20059
147 Ga0495606_0000088 3300046507 Bacteria 155985
148 Ga0495606_0000103 3300046507 Bacteria 145893
149 Ga0495606_0002016 3300046507 Bacteria 24929
150 Ga0495610_0000008 3300046512 Bacteria 622732
151 Ga0495610_0003032 3300046512 Bacteria 13450
152 Ga0495610_0094166 3300046512 Bacteria 1352
153 Ga0495610_0095232 3300046512 Bacteria 1342
154 Ga0495616_0000335 3300046513 Bacteria 37189
155 Ga0495616_0001486 3300046513 Bacteria 16254
156 Ga0495616_0002365 3300046513 Bacteria 12564
157 Ga0495616_0004047 3300046513 Bacteria 9315
158 Ga0495616_0008930 3300046513 Bacteria 5889
159 Ga0495616_0016579 3300046513 Bacteria 4075
160 Ga0495616_0065532 3300046513 Bacteria 1769
161 Ga0495616_0189259 3300046513 Bacteria 910
162 Ga0495631_0004873 3300046518 Bacteria 7064
163 Ga0495631_0064427 3300046518 Bacteria 1586
164 Ga0495632_0000291 3300046519 Bacteria 48631
165 Ga0495637_0004454 3300046520 Bacteria 7257
166 Ga0495643_0000117 3300046522 Bacteria 129698
167 Ga0495643_0000386 3300046522 Bacteria 58386
168 Ga0495643_0003893 3300046522 Bacteria 10713
169 Ga0495643_0019384 3300046522 Bacteria 3936
170 Ga0495643_0020617 3300046522 Bacteria 3797
171 Ga0495644_0016898 3300046523 Bacteria 2792
172 Ga0495644_0075927 3300046523 Bacteria 1265
173 Ga0495648_0000003 3300046524 Bacteria 386817
174 Ga0495648_0000648 3300046524 Bacteria 37132
175 Ga0495648_0000815 3300046524 Bacteria 32978
176 Ga0495648_0001741 3300046524 Bacteria 21023
177 Ga0495648_0006405 3300046524 Bacteria 9615
178 Ga0495648_0006573 3300046524 Bacteria 9456
179 Ga0495663_0010441 3300046525 Bacteria 2584
180 Ga0495663_0220642 3300046525 Bacteria 666
181 Ga0495666_0018048 3300046526 Bacteria 3514
182 Ga0495642_0000013 3300046528 Bacteria 123896
183 Ga0495642_0008861 3300046528 Bacteria 3848
184 Ga0495642_0018178 3300046528 Bacteria 2750
185 Ga0495642_0044213 3300046528 Bacteria 1818
186 Ga0495642_0054030 3300046528 Bacteria 1656
187 Ga0495642_0124777 3300046528 Bacteria 1106
188 Ga0495654_0004344 3300046530 Bacteria 8435
189 Ga0495654_0030883 3300046530 Bacteria 2722
190 Ga0495665_0010057 3300046531 Bacteria 5126
191 Ga0495586_0034303 3300046535 Bacteria 2725
192 Ga0495609_0000250 3300046538 Bacteria 50865
193 Ga0495609_0001665 3300046538 Bacteria 14427
194 Ga0495609_0023076 3300046538 Bacteria 2860
195 Ga0495609_0042612 3300046538 Bacteria 2038
196 Ga0495609_0188430 3300046538 Bacteria 866
197 Ga0495597_0000159 3300046542 Bacteria 59699
198 Ga0495597_0000761 3300046542 Bacteria 25457
199 Ga0495597_0068021 3300046542 Bacteria 1540
200 Ga0495597_0069477 3300046542 Bacteria 1520
201 Ga0495622_0000048 3300046557 Bacteria 108955
202 Ga0495633_0004722 3300046558 Bacteria 8562
203 Ga0495633_0005744 3300046558 Bacteria 7499
204 Ga0495633_0012255 3300046558 Bacteria 4570
205 Ga0495633_0013450 3300046558 Bacteria 4313
206 Ga0495633_0066720 3300046558 Bacteria 1680
207 Ga0495656_0037211 3300046615 Bacteria 2008
208 Ga0495656_0112739 3300046615 Bacteria 1274
209 Ga0495668_0000373 3300046616 Bacteria 59298
210 Ga0495668_0000428 3300046616 Bacteria 54563
211 Ga0495668_0001093 3300046616 Bacteria 28137
212 Ga0495668_0136905 3300046616 Bacteria 1340
213 Ga0495611_0046280 3300046648 Bacteria 1950
214 Ga0495625_0000241 3300046660 Bacteria 85835
215 Ga0495625_0003570 3300046660 Bacteria 15339
216 Ga0495625_0005901 3300046660 Bacteria 11022
217 Ga0495659_0001006 3300046664 Bacteria 9846
218 Ga0495661_0003185 3300046665 Bacteria 12269
219 Ga0495661_0009116 3300046665 Bacteria 6822
220 Ga0495661_0009433 3300046665 Bacteria 6699
221 Ga0495661_0023092 3300046665 Bacteria 4041
222 Ga0495661_0023578 3300046665 Bacteria 3993
223 Ga0495661_0029999 3300046665 Bacteria 3465
224 Ga0495661_0062285 3300046665 Bacteria 2210
225 Ga0495661_0321220 3300046665 Bacteria 769
226 Ga0495588_0000078 3300046674 Bacteria 214254
227 Ga0495588_0054961 3300046674 Bacteria 2054
228 Ga0495669_0020968 3300046684 Bacteria 2832
229 Ga0495670_0056295 3300046691 Bacteria 1972
230 Ga0495670_0088154 3300046691 Bacteria 1586
231 Ga0495671_0000002 3300046692 Bacteria 1136189
232 Ga0495671_0000989 3300046692 Bacteria 19828
233 Ga0495671_0003846 3300046692 Bacteria 9123
234 Ga0495671_0014763 3300046692 Bacteria 4197
235 Ga0495649_0010354 3300046694 Bacteria 5508
236 Ga0495649_0232022 3300046694 Bacteria 952
237 Ga0495649_0251133 3300046694 Bacteria 908
238 Ga0495589_0000472 3300046794 Bacteria 29346
239 Ga0495589_0001108 3300046794 Bacteria 16056
240 Ga0495589_0226984 3300046794 Bacteria 876
241 Ga0495660_0000252 3300046810 Bacteria 51417
242 Ga0495660_0012485 3300046810 Bacteria 4931
243 Ga0495660_0028881 3300046810 Bacteria 3131
244 Ga0495660_0107315 3300046810 Bacteria 1429
245 Ga0495581_0062230 3300047315 Bacteria 2156
246 Ga0495636_0014380 3300047318 Bacteria 3146
247 Ga0495672_0000165 3300047320 Bacteria 96215
248 Ga0495672_0000325 3300047320 Bacteria 63353
249 Ga0495672_0001165 3300047320 Bacteria 26623
250 Ga0495672_0001467 3300047320 Bacteria 23143
251 Ga0495672_0085777 3300047320 Bacteria 1744
252 Ga0495676_0155632 3300047321 Bacteria 1622
253 Ga0495676_0330906 3300047321 Bacteria 1021
254 Ga0495683_0002344 3300047323 Bacteria 11503
255 Ga0495683_0004064 3300047323 Bacteria 8387
256 Ga0495683_0007167 3300047323 Bacteria 6049
257 Ga0495683_0150419 3300047323 Bacteria 1084
258 Ga0495687_001288 3300047443 Bacteria 23563
259 Ga0495687_001505 3300047443 Bacteria 21228
260 Ga0495687_001508 3300047443 Bacteria 21220
261 Ga0495687_018683 3300047443 Bacteria 3419
262 Ga0495687_055729 3300047443 Bacteria 1651
263 Ga0495675_0382214 3300047444 Bacteria 823
264 Ga0495677_0000713 3300047445 Bacteria 13427
265 Ga0495677_0001179 3300047445 Bacteria 10470
266 Ga0495677_0003495 3300047445 Bacteria 6096
267 Ga0495677_0012939 3300047445 Bacteria 3038
268 Ga0495677_0039384 3300047445 Bacteria 1728
269 Ga0495677_0065641 3300047445 Bacteria 1349
270 Ga0495677_0304534 3300047445 Bacteria 627
271 Ga0495679_007893 3300047446 Bacteria 4384
272 Ga0495679_082566 3300047446 Bacteria 910
273 Ga0495673_0000005 3300047469 Bacteria 943364
274 Ga0495673_0000064 3300047469 Bacteria 225793
275 Ga0495681_0002833 3300047470 Bacteria 12257
276 Ga0495686_0001699 3300047472 Bacteria 22746
277 Ga0495686_0026781 3300047472 Bacteria 3771
278 Ga0495686_0096937 3300047472 Bacteria 1784
279 Ga0495593_0063795 3300047673 Bacteria 1923
280 Ga0495615_0005511 3300048090 Bacteria 2280
281 Ga0495626_0000003 3300048091 Bacteria 427774
282 Ga0495626_0000028 3300048091 Bacteria 204580
283 Ga0495626_0003690 3300048091 Bacteria 9698
284 Ga0495626_0111519 3300048091 Bacteria 1184
285 Ga0495626_0144861 3300048091 Bacteria 1005
286 Ga0496102_0314286 3300048905 Bacteria 1476
287 Ga0496104_1845413 3300048907 Bacteria 506
288 Ga0496105_0649356 3300048908 Bacteria 814
289 Ga0496105_0957411 3300048908 Bacteria 642
290 Ga0496106_0303500 3300048909 Bacteria 1281
291 Ga0496107_0066187 3300048910 Bacteria 2620
292 Ga0496109_0706530 3300048912 Bacteria 946
293 Ga0496110_0163237 3300048913 Bacteria 2020
294 Ga0496112_0147148 3300048915 Bacteria 2324
295 Ga0496114_0057224 3300048917 Bacteria 3255
296 Ga0496115_0546330 3300048918 Bacteria 926
297 Ga0496115_0808639 3300048918 Bacteria 729
298 Ga0496121_0433836 3300048924 Bacteria 851
299 Ga0496122_0057704 3300048925 Bacteria 2880
300 Ga0496122_0069601 3300048925 Bacteria 2519
301 Ga0496123_0005050 3300048926 Bacteria 13496
302 Ga0496124_0018809 3300048927 Bacteria 6453
303 Ga0496124_0021884 3300048927 Bacteria 5881
304 Ga0496124_0022964 3300048927 Bacteria 5707
305 Ga0496124_0030296 3300048927 Bacteria 4805
306 Ga0496124_0087008 3300048927 Bacteria 2556
307 Ga0496126_0006011 3300048929 Bacteria 13633
308 Ga0495678_000103 3300049459 Bacteria 103891
309 Ga0495678_020401 3300049459 Bacteria 2935
310 Ga0495678_042565 3300049459 Bacteria 1809
311 Ga0495682_0066433 3300049460 Bacteria 1300
312 Ga0501036_0046266 3300049572 Bacteria 3685
313 Ga0501080_0021599 3300049742 Bacteria 5958
314 Ga0501269_000197 3300049766 Bacteria 18175
315 nmdc:mga03683_48322_c1 3300050489 Bacteria 1768
316 Ga0500618_011074 3300053125 Bacteria 2402

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048091 Ga0495626_0111519 Ga0495626_0111519_218_649 117
2 3300005328 Ga0070676_10994954 Ga0070676_109949541 128
3 3300005334 Ga0068869_101350409 Ga0068869_1013504091 128
4 3300005345 Ga0070692_11199343 Ga0070692_111993431 128
5 3300005327 Ga0070658_10142064 Ga0070658_101420641 132
6 3300013102 Ga0157371_10000018 Ga0157371_10000018175 133
7 3300015262 Ga0182007_10044073 Ga0182007_100440732 133
8 3300046522 Ga0495643_0000386 Ga0495643_0000386_33801_34247 133
9 3300049742 Ga0501080_0021599 Ga0501080_0021599_1194_1625 133
10 3300031901 Ga0307406_11279507 Ga0307406_112795071 134
11 3300039450 Ga0436363_0453409 Ga0436363_0453409_55_483 134
12 3300044684 Ga0466966_0178881 Ga0466966_0178881_697_1152 134
13 3300044719 Ga0466971_0429667 Ga0466971_0429667_77_532 134
14 3300045049 Ga0466959_0120217 Ga0466959_0120217_1293_1748 134
15 3300046501 Ga0495607_0001319 Ga0495607_0001319_12302_12748 134
16 3300046519 Ga0495632_0000291 Ga0495632_0000291_21165_21611 134
17 3300046665 Ga0495661_0009433 Ga0495661_0009433_2054_2500 134
18 3300047445 Ga0495677_0000713 Ga0495677_0000713_8661_9107 134
19 iso_pu_bacteria 2643221684 2644472141 134
20 iso_pu_bacteria 8047673197 8047675259 134
21 3300047320 Ga0495672_0000165 Ga0495672_0000165_20964_21392 135
22 3300048091 Ga0495626_0000003 Ga0495626_0000003_249804_250232 135
23 3300048091 Ga0495626_0003690 Ga0495626_0003690_6918_7364 135
24 3300053125 Ga0500618_011074 Ga0500618_011074_639_1067 135
25 3300006028 Ga0070717_10153109 Ga0070717_101531092 136
26 3300044672 Ga0466982_0023689 Ga0466982_0023689_2622_3056 136
27 3300044765 Ga0466970_0020288 Ga0466970_0020288_1811_2245 136
28 3300046491 Ga0495584_0000597 Ga0495584_0000597_18863_19291 136
29 3300046492 Ga0495585_0001850 Ga0495585_0001850_12511_12939 136
30 3300046500 Ga0495596_0001921 Ga0495596_0001921_4155_4583 136
31 3300046513 Ga0495616_0008930 Ga0495616_0008930_4597_5025 136
32 3300046558 Ga0495633_0005744 Ga0495633_0005744_4071_4499 136
33 3300047323 Ga0495683_0002344 Ga0495683_0002344_5039_5467 136
34 3300049460 Ga0495682_0066433 Ga0495682_0066433_702_1130 136
35 3300017792 Ga0163161_10133639 Ga0163161_101336392 137
36 3300046455 Ga0495603_0036400 Ga0495603_0036400_1935_2363 137
37 3300046491 Ga0495584_0060990 Ga0495584_0060990_60_497 137
38 3300046492 Ga0495585_0000010 Ga0495585_0000010_124699_125130 137
39 3300046492 Ga0495585_0036013 Ga0495585_0036013_738_1175 137
40 3300046501 Ga0495607_0232494 Ga0495607_0232494_386_817 137
41 3300046506 Ga0495583_0001816 Ga0495583_0001816_7508_7945 137
42 3300046513 Ga0495616_0000335 Ga0495616_0000335_22806_23237 137
43 3300046513 Ga0495616_0001486 Ga0495616_0001486_3979_4410 137
44 3300046513 Ga0495616_0065532 Ga0495616_0065532_1135_1572 137
45 3300046518 Ga0495631_0064427 Ga0495631_0064427_585_1022 137
46 3300046523 Ga0495644_0016898 Ga0495644_0016898_2165_2602 137
47 3300046524 Ga0495648_0000003 Ga0495648_0000003_104829_105260 137
48 3300046524 Ga0495648_0006405 Ga0495648_0006405_4948_5379 137
49 3300046525 Ga0495663_0010441 Ga0495663_0010441_1523_1960 137
50 3300046526 Ga0495666_0018048 Ga0495666_0018048_3062_3490 137
51 3300046528 Ga0495642_0018178 Ga0495642_0018178_239_676 137
52 3300046528 Ga0495642_0124777 Ga0495642_0124777_491_922 137
53 3300046531 Ga0495665_0010057 Ga0495665_0010057_3062_3490 137
54 3300046535 Ga0495586_0034303 Ga0495586_0034303_1200_1628 137
55 3300046542 Ga0495597_0069477 Ga0495597_0069477_247_681 137
56 3300046558 Ga0495633_0012255 Ga0495633_0012255_564_1001 137
57 3300046558 Ga0495633_0013450 Ga0495633_0013450_1034_1465 137
58 3300046615 Ga0495656_0112739 Ga0495656_0112739_388_825 137
59 3300046616 Ga0495668_0136905 Ga0495668_0136905_717_1154 137
60 3300046674 Ga0495588_0054961 Ga0495588_0054961_70_498 137
61 3300046691 Ga0495670_0056295 Ga0495670_0056295_443_880 137
62 3300046691 Ga0495670_0088154 Ga0495670_0088154_457_891 137
63 3300046692 Ga0495671_0003846 Ga0495671_0003846_7624_8061 137
64 3300046810 Ga0495660_0107315 Ga0495660_0107315_498_941 137
65 3300047315 Ga0495581_0062230 Ga0495581_0062230_629_1057 137
66 3300047320 Ga0495672_0085777 Ga0495672_0085777_268_702 137
67 3300047321 Ga0495676_0330906 Ga0495676_0330906_92_520 137
68 3300047323 Ga0495683_0007167 Ga0495683_0007167_3061_3492 137
69 3300047444 Ga0495675_0382214 Ga0495675_0382214_303_731 137
70 3300047445 Ga0495677_0039384 Ga0495677_0039384_640_1074 137
71 3300047470 Ga0495681_0002833 Ga0495681_0002833_10404_10841 137
72 3300047673 Ga0495593_0063795 Ga0495593_0063795_1117_1545 137
73 3300048091 Ga0495626_0144861 Ga0495626_0144861_539_970 137
74 3300048915 Ga0496112_0147148 Ga0496112_0147148_384_815 137
75 3300048918 Ga0496115_0546330 Ga0496115_0546330_417_845 137
76 3300003322 rootL2_10143604 rootL2_101436042 138
77 3300003773 Ga0055537_1000179 Ga0055537_100017915 138
78 3300003775 Ga0055524_1007957 Ga0055524_10079572 138
79 3300003784 Ga0055534_1000495 Ga0055534_10004954 138
80 3300003790 Ga0055528_1000119 Ga0055528_100011946 138
81 3300005262 Ga0065165_1000039 Ga0065165_1000039202 138
82 3300005327 Ga0070658_10050913 Ga0070658_100509133 138
83 3300005327 Ga0070658_10344577 Ga0070658_103445772 138
84 3300005339 Ga0070660_100040609 Ga0070660_1000406092 138
85 3300005339 Ga0070660_100076227 Ga0070660_1000762272 138
86 3300005366 Ga0070659_100013628 Ga0070659_1000136287 138
87 3300005366 Ga0070659_100105305 Ga0070659_1001053052 138
88 3300005530 Ga0070679_100706266 Ga0070679_1007062662 138
89 3300005563 Ga0068855_100037644 Ga0068855_1000376442 138
90 3300005563 Ga0068855_101013773 Ga0068855_1010137732 138
91 3300005564 Ga0070664_100322123 Ga0070664_1003221232 138
92 3300005616 Ga0068852_100052606 Ga0068852_1000526065 138
93 3300009148 Ga0105243_10071091 Ga0105243_100710912 138
94 3300009176 Ga0105242_10012260 Ga0105242_100122606 138
95 3300010375 Ga0105239_10135143 Ga0105239_101351432 138
96 3300015261 Ga0182006_1027566 Ga0182006_10275663 138
97 3300015262 Ga0182007_10066299 Ga0182007_100662991 138
98 3300025263 Ga0209565_1000003 Ga0209565_1000003237 138
99 3300025273 Ga0209673_1000003 Ga0209673_1000003123 138
100 3300025284 Ga0209130_1000084 Ga0209130_1000084130 138
101 3300025291 Ga0209675_1000003 Ga0209675_1000003801 138
102 3300025295 Ga0209564_1000012 Ga0209564_1000012610 138
103 3300025299 Ga0209256_1000295 Ga0209256_100029546 138
104 3300025302 Ga0207426_1006899 Ga0207426_10068993 138
105 3300025909 Ga0207705_10001157 Ga0207705_100011576 138
106 3300025909 Ga0207705_10093901 Ga0207705_100939012 138
107 3300025911 Ga0207654_10149685 Ga0207654_101496852 138
108 3300025914 Ga0207671_10161527 Ga0207671_101615272 138
109 3300025919 Ga0207657_10031740 Ga0207657_100317404 138
110 3300025919 Ga0207657_10417258 Ga0207657_104172582 138
111 3300025920 Ga0207649_10061978 Ga0207649_100619782 138
112 3300025933 Ga0207706_10135685 Ga0207706_101356852 138
113 3300025934 Ga0207686_10012247 Ga0207686_100122472 138
114 3300025935 Ga0207709_10492472 Ga0207709_104924722 138
115 3300025938 Ga0207704_10099755 Ga0207704_100997552 138
116 3300025949 Ga0207667_10015776 Ga0207667_100157768 138
117 3300025949 Ga0207667_10548544 Ga0207667_105485442 138
118 3300026078 Ga0207702_11545835 Ga0207702_115458352 138
119 3300026142 Ga0207698_11624845 Ga0207698_116248451 138
120 3300037312 Ga0395899_0012541 Ga0395899_0012541_4380_4820 138
121 3300037312 Ga0395899_0036371 Ga0395899_0036371_2864_3304 138
122 3300037418 Ga0395900_0004864 Ga0395900_0004864_3866_4306 138
123 3300037418 Ga0395900_0017833 Ga0395900_0017833_4296_4736 138
124 3300037418 Ga0395900_0508884 Ga0395900_0508884_542_982 138
125 3300037466 Ga0395898_0067597 Ga0395898_0067597_714_1154 138
126 3300037466 Ga0395898_0104716 Ga0395898_0104716_151_591 138
127 3300037466 Ga0395898_0525131 Ga0395898_0525131_560_1000 138
128 3300037471 Ga0395905_0148743 Ga0395905_0148743_951_1391 138
129 3300038443 Ga0395901_0002619 Ga0395901_0002619_13743_14183 138
130 3300038443 Ga0395901_0525606 Ga0395901_0525606_152_592 138
131 3300042005 Ga0439448_0028890 Ga0439448_0028890_395_835 138
132 3300042005 Ga0439448_0041562 Ga0439448_0041562_912_1352 138
133 3300042008 Ga0439450_002201 Ga0439450_002201_1987_2427 138
134 3300042157 Ga0439458_0032241 Ga0439458_0032241_264_704 138
135 3300044658 Ga0466972_0195037 Ga0466972_0195037_10_450 138
136 3300044683 Ga0466965_0066674 Ga0466965_0066674_580_1020 138
137 3300044684 Ga0466966_0108493 Ga0466966_0108493_1197_1637 138
138 3300044693 Ga0466961_0061094 Ga0466961_0061094_1273_1713 138
139 3300044719 Ga0466971_0113969 Ga0466971_0113969_647_1087 138
140 3300044719 Ga0466971_0182417 Ga0466971_0182417_128_568 138
141 3300044765 Ga0466970_0069498 Ga0466970_0069498_109_549 138
142 3300044765 Ga0466970_0106466 Ga0466970_0106466_474_914 138
143 3300044765 Ga0466970_0116526 Ga0466970_0116526_741_1181 138
144 3300044842 Ga0466957_0029308 Ga0466957_0029308_2762_3202 138
145 3300044842 Ga0466957_0124424 Ga0466957_0124424_339_779 138
146 3300044901 Ga0466960_0286293 Ga0466960_0286293_225_665 138
147 3300045049 Ga0466959_0147514 Ga0466959_0147514_599_1039 138
148 3300045049 Ga0466959_0633094 Ga0466959_0633094_49_489 138
149 3300045976 Ga0466967_0013183 Ga0466967_0013183_4208_4648 138
150 3300045976 Ga0466967_0303710 Ga0466967_0303710_169_609 138
151 3300046457 Ga0495590_0020337 Ga0495590_0020337_907_1347 138
152 3300046460 Ga0495638_0122219 Ga0495638_0122219_251_685 138
153 3300046474 Ga0495605_0000183 Ga0495605_0000183_15238_15678 138
154 3300046491 Ga0495584_0051607 Ga0495584_0051607_826_1260 138
155 3300046501 Ga0495607_0001028 Ga0495607_0001028_7513_7947 138
156 3300046501 Ga0495607_0003485 Ga0495607_0003485_9173_9613 138
157 3300046513 Ga0495616_0004047 Ga0495616_0004047_4507_4941 138
158 3300046522 Ga0495643_0003893 Ga0495643_0003893_7806_8246 138
159 3300046525 Ga0495663_0220642 Ga0495663_0220642_23_457 138
160 3300046528 Ga0495642_0044213 Ga0495642_0044213_207_641 138
161 3300046538 Ga0495609_0000250 Ga0495609_0000250_25531_25965 138
162 3300046542 Ga0495597_0068021 Ga0495597_0068021_556_996 138
163 3300046660 Ga0495625_0003570 Ga0495625_0003570_5135_5569 138
164 3300046664 Ga0495659_0001006 Ga0495659_0001006_8824_9258 138
165 3300046665 Ga0495661_0003185 Ga0495661_0003185_971_1411 138
166 3300046665 Ga0495661_0023578 Ga0495661_0023578_2276_2716 138
167 3300046694 Ga0495649_0251133 Ga0495649_0251133_36_470 138
168 3300046794 Ga0495589_0000472 Ga0495589_0000472_8367_8807 138
169 3300046810 Ga0495660_0000252 Ga0495660_0000252_31933_32373 138
170 3300046810 Ga0495660_0028881 Ga0495660_0028881_207_641 138
171 3300047318 Ga0495636_0014380 Ga0495636_0014380_1058_1492 138
172 3300047320 Ga0495672_0001467 Ga0495672_0001467_8834_9274 138
173 3300047443 Ga0495687_001288 Ga0495687_001288_18845_19285 138
174 3300047443 Ga0495687_018683 Ga0495687_018683_397_831 138
175 3300047445 Ga0495677_0003495 Ga0495677_0003495_968_1408 138
176 3300047445 Ga0495677_0012939 Ga0495677_0012939_2262_2696 138
177 3300047446 Ga0495679_007893 Ga0495679_007893_454_888 138
178 3300047472 Ga0495686_0001699 Ga0495686_0001699_8958_9392 138
179 3300048090 Ga0495615_0005511 Ga0495615_0005511_715_1155 138
180 3300048091 Ga0495626_0000028 Ga0495626_0000028_51627_52067 138
181 3300048905 Ga0496102_0314286 Ga0496102_0314286_1022_1462 138
182 3300048907 Ga0496104_1845413 Ga0496104_1845413_56_496 138
183 3300048908 Ga0496105_0649356 Ga0496105_0649356_278_718 138
184 3300048908 Ga0496105_0957411 Ga0496105_0957411_60_500 138
185 3300048909 Ga0496106_0303500 Ga0496106_0303500_166_606 138
186 3300048910 Ga0496107_0066187 Ga0496107_0066187_1143_1583 138
187 3300048912 Ga0496109_0706530 Ga0496109_0706530_392_832 138
188 3300048917 Ga0496114_0057224 Ga0496114_0057224_1438_1878 138
189 3300048927 Ga0496124_0021884 Ga0496124_0021884_3615_4055 138
190 3300048927 Ga0496124_0087008 Ga0496124_0087008_1983_2420 138
191 3300049572 Ga0501036_0046266 Ga0501036_0046266_39_479 138
192 3300006948 Ga0099826_10000001 Ga0099826_10000001438 139
193 3300025263 Ga0209565_1003750 Ga0209565_10037502 139
194 3300025295 Ga0209564_1012821 Ga0209564_10128214 139
195 3300025299 Ga0209256_1000005 Ga0209256_10000051110 139
196 3300027666 Ga0209282_1000001 Ga0209282_10000011576 139
197 3300037466 Ga0395898_0471762 Ga0395898_0471762_406_849 139
198 3300037471 Ga0395905_0035041 Ga0395905_0035041_681_1124 139
199 3300038443 Ga0395901_0174997 Ga0395901_0174997_1358_1801 139
200 3300046501 Ga0495607_0003486 Ga0495607_0003486_9164_9607 139
201 3300046513 Ga0495616_0016579 Ga0495616_0016579_2359_2802 139
202 3300046513 Ga0495616_0189259 Ga0495616_0189259_214_657 139
203 3300046522 Ga0495643_0020617 Ga0495643_0020617_2757_3200 139
204 3300046524 Ga0495648_0001741 Ga0495648_0001741_10284_10727 139
205 3300046528 Ga0495642_0054030 Ga0495642_0054030_29_472 139
206 3300046665 Ga0495661_0009116 Ga0495661_0009116_1006_1449 139
207 3300046665 Ga0495661_0029999 Ga0495661_0029999_1379_1822 139
208 3300046674 Ga0495588_0000078 Ga0495588_0000078_176072_176515 139
209 3300046694 Ga0495649_0232022 Ga0495649_0232022_474_899 139
210 3300047443 Ga0495687_055729 Ga0495687_055729_1159_1602 139
211 3300048913 Ga0496110_0163237 Ga0496110_0163237_292_735 139
212 3300048927 Ga0496124_0030296 Ga0496124_0030296_4171_4614 139
213 3300049766 Ga0501269_000197 Ga0501269_000197_17609_18061 139
214 iso_pu_bacteria 2738541297 2738828673 139
215 iso_pu_bacteria 2738541357 2739152469 139
216 iso_pu_bacteria 2738543003 2739194389 139
217 iso_pu_bacteria 2738543026 2739320865 139
218 iso_pu_bacteria 2738543029 2739339106 139
219 iso_pu_bacteria 2842711865 2842714605 139
220 3300003771 Ga0055526_1000120 Ga0055526_100012051 140
221 3300025233 Ga0209437_107172 Ga0209437_1071722 140
222 3300025295 Ga0209564_1000002 Ga0209564_10000021064 140
223 3300044684 Ga0466966_0105916 Ga0466966_0105916_1112_1558 140
224 3300044693 Ga0466961_0128302 Ga0466961_0128302_135_581 140
225 3300044719 Ga0466971_0054788 Ga0466971_0054788_147_593 140
226 3300044842 Ga0466957_0807865 Ga0466957_0807865_50_496 140
227 3300046452 Ga0495617_001350 Ga0495617_001350_2492_2926 140
228 3300046507 Ga0495606_0000088 Ga0495606_0000088_127492_127926 140
229 3300046520 Ga0495637_0004454 Ga0495637_0004454_5839_6273 140
230 3300046522 Ga0495643_0019384 Ga0495643_0019384_873_1322 140
231 3300047323 Ga0495683_0150419 Ga0495683_0150419_438_872 140
232 3300048927 Ga0496124_0018809 Ga0496124_0018809_5872_6318 140
233 iso_pu_bacteria 2857558681 2857562843 140
234 3300046453 Ga0495627_000228 Ga0495627_000228_11973_12419 141
235 3300046474 Ga0495605_0000046 Ga0495605_0000046_128427_128873 141
236 3300046492 Ga0495585_0370120 Ga0495585_0370120_21_467 141
237 3300046500 Ga0495596_0000893 Ga0495596_0000893_2246_2713 141
238 3300046500 Ga0495596_0019097 Ga0495596_0019097_731_1177 141
239 3300046501 Ga0495607_0001945 Ga0495607_0001945_11945_12391 141
240 3300046513 Ga0495616_0002365 Ga0495616_0002365_4274_4720 141
241 3300046518 Ga0495631_0004873 Ga0495631_0004873_1485_1931 141
242 3300046523 Ga0495644_0075927 Ga0495644_0075927_362_808 141
243 3300046524 Ga0495648_0000648 Ga0495648_0000648_24213_24680 141
244 3300046524 Ga0495648_0000815 Ga0495648_0000815_4866_5312 141
245 3300046528 Ga0495642_0000013 Ga0495642_0000013_43719_44165 141
246 3300046530 Ga0495654_0030883 Ga0495654_0030883_1184_1630 141
247 3300046538 Ga0495609_0001665 Ga0495609_0001665_5017_5484 141
248 3300046538 Ga0495609_0023076 Ga0495609_0023076_956_1402 141
249 3300046558 Ga0495633_0066720 Ga0495633_0066720_256_702 141
250 3300046615 Ga0495656_0037211 Ga0495656_0037211_978_1424 141
251 3300046616 Ga0495668_0000373 Ga0495668_0000373_11987_12433 141
252 3300046648 Ga0495611_0046280 Ga0495611_0046280_1310_1756 141
253 3300046665 Ga0495661_0062285 Ga0495661_0062285_1061_1507 141
254 3300046684 Ga0495669_0020968 Ga0495669_0020968_2232_2678 141
255 3300046692 Ga0495671_0000989 Ga0495671_0000989_12403_12849 141
256 3300046694 Ga0495649_0010354 Ga0495649_0010354_3712_4143 141
257 3300046794 Ga0495589_0001108 Ga0495589_0001108_5071_5517 141
258 3300047320 Ga0495672_0001165 Ga0495672_0001165_20997_21464 141
259 3300047321 Ga0495676_0155632 Ga0495676_0155632_141_608 141
260 3300047323 Ga0495683_0004064 Ga0495683_0004064_5284_5751 141
261 3300047445 Ga0495677_0001179 Ga0495677_0001179_719_1165 141
262 3300047445 Ga0495677_0304534 Ga0495677_0304534_41_511 141
263 3300047472 Ga0495686_0026781 Ga0495686_0026781_1274_1720 141
264 3300046501 Ga0495607_0016650 Ga0495607_0016650_3337_3789 142
265 3300046471 Ga0495650_0000159 Ga0495650_0000159_102456_102890 143
266 3300046492 Ga0495585_0001938 Ga0495585_0001938_8982_9416 143
267 3300046507 Ga0495606_0000103 Ga0495606_0000103_45288_45722 143
268 3300046507 Ga0495606_0002016 Ga0495606_0002016_24045_24485 143
269 3300046512 Ga0495610_0000008 Ga0495610_0000008_74842_75276 143
270 3300046512 Ga0495610_0003032 Ga0495610_0003032_6349_6786 143
271 3300046512 Ga0495610_0094166 Ga0495610_0094166_581_1027 143
272 3300046524 Ga0495648_0006573 Ga0495648_0006573_4358_4792 143
273 3300046530 Ga0495654_0004344 Ga0495654_0004344_7806_8240 143
274 3300046538 Ga0495609_0188430 Ga0495609_0188430_363_800 143
275 3300046542 Ga0495597_0000761 Ga0495597_0000761_19952_20389 143
276 3300046558 Ga0495633_0004722 Ga0495633_0004722_280_726 143
277 3300046616 Ga0495668_0000428 Ga0495668_0000428_27954_28388 143
278 3300046660 Ga0495625_0005901 Ga0495625_0005901_5266_5703 143
279 3300046665 Ga0495661_0023092 Ga0495661_0023092_1563_1997 143
280 3300046665 Ga0495661_0321220 Ga0495661_0321220_49_483 143
281 3300046692 Ga0495671_0000002 Ga0495671_0000002_682083_682517 143
282 3300046692 Ga0495671_0014763 Ga0495671_0014763_1313_1747 143
283 3300046794 Ga0495589_0226984 Ga0495589_0226984_382_816 143
284 3300046810 Ga0495660_0012485 Ga0495660_0012485_4475_4909 143
285 3300047320 Ga0495672_0000325 Ga0495672_0000325_36611_37048 143
286 3300047445 Ga0495677_0065641 Ga0495677_0065641_853_1290 143
287 3300047446 Ga0495679_082566 Ga0495679_082566_240_674 143
288 3300047469 Ga0495673_0000005 Ga0495673_0000005_503476_503910 143
289 3300047469 Ga0495673_0000064 Ga0495673_0000064_66592_67026 143
290 3300047472 Ga0495686_0096937 Ga0495686_0096937_767_1201 143
291 3300048918 Ga0496115_0808639 Ga0496115_0808639_49_483 143
292 3300048924 Ga0496121_0433836 Ga0496121_0433836_235_669 143
293 3300048925 Ga0496122_0057704 Ga0496122_0057704_877_1311 143
294 3300048925 Ga0496122_0069601 Ga0496122_0069601_1313_1747 143
295 3300048926 Ga0496123_0005050 Ga0496123_0005050_5832_6266 143
296 3300048927 Ga0496124_0022964 Ga0496124_0022964_1426_1860 143
297 3300048929 Ga0496126_0006011 Ga0496126_0006011_12579_13013 143
298 3300049459 Ga0495678_000103 Ga0495678_000103_32345_32782 143
299 3300025245 Ga0207425_1000198 Ga0207425_100019818 144
300 3300025294 Ga0209025_1008142 Ga0209025_10081423 144
301 3300025297 Ga0209758_1001300 Ga0209758_100130016 144
302 3300030744 Ga0316181_1077985 Ga0316181_10779852 144
303 3300046460 Ga0495638_0000157 Ga0495638_0000157_56992_57444 144
304 3300046471 Ga0495650_0000410 Ga0495650_0000410_33445_33897 144
305 3300046475 Ga0495639_0031954 Ga0495639_0031954_382_834 144
306 3300046506 Ga0495583_0000006 Ga0495583_0000006_157916_158368 144
307 3300046522 Ga0495643_0000117 Ga0495643_0000117_33764_34213 144
308 3300046528 Ga0495642_0008861 Ga0495642_0008861_2184_2636 144
309 3300046538 Ga0495609_0042612 Ga0495609_0042612_592_1044 144
310 3300046542 Ga0495597_0000159 Ga0495597_0000159_18089_18538 144
311 3300046557 Ga0495622_0000048 Ga0495622_0000048_59173_59625 144
312 3300046616 Ga0495668_0001093 Ga0495668_0001093_15606_16058 144
313 3300046660 Ga0495625_0000241 Ga0495625_0000241_41868_42320 144
314 3300047443 Ga0495687_001505 Ga0495687_001505_8911_9360 144
315 3300047443 Ga0495687_001508 Ga0495687_001508_8914_9363 144
316 3300049459 Ga0495678_020401 Ga0495678_020401_916_1368 144
317 3300049459 Ga0495678_042565 Ga0495678_042565_442_894 144
318 3300006177 Ga0075362_10015726 Ga0075362_100157262 146
319 3300009036 Ga0105244_10010503 Ga0105244_100105034 146
320 3300025728 Ga0207655_1039115 Ga0207655_10391152 146
321 3300046512 Ga0495610_0095232 Ga0495610_0095232_501_1028 146
322 3300050489 nmdc:mga03683_48322_c1 nmdc:mga03683_48322_c1_224_736 146
323 3300003322 rootL2_10057617 rootL2_100576172 149
324 3300003763 Ga0055529_1000917 Ga0055529_10009177 149
325 3300025272 Ga0209455_1000026 Ga0209455_1000026518 149

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ecf-assembly1.cif.gz_A crystal structure of an abc-type phosphate transport system, periplasmic component (lvis_0633) from lactobacillus brevis atcc 367 at 1.55 a resolution 0.8491 26 143
1twy-assembly10.cif.gz_B crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.8136 26 143
4exl-assembly3.cif.gz_C crystal structure of phosphate abc transporter, periplasmic phosphate-binding protein psts 1 (pbp1) from streptococcus pneumoniae canada mdr_19a 0.8112 26 143
4gd5-assembly1.cif.gz_A x-ray crystal structure of a putative phosphate abc transporter substrate-binding protein with bound phosphate from clostridium perfringens 0.8012 26 143
1twy-assembly1.cif.gz_A crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.779 26 143
ID Description Score Start End Superfamily
4q8rA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8568 29 143 3.40.190.10
4ecfA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8427 27 143 3.40.190.10
4exlD02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8067 27 143 3.40.190.10
2mh2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7785 80 102 1.10.10.10
1twyH02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7685 29 143 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A3A3FWM2-F1-model_v4 Phosphate ABC transporter substrate-binding protein 0.9878 21 145
AF-A0A4Q3KIP7-F1-model_v4 deleted 0.9859 24 146
AF-A0A3D6EN82-F1-model_v4 Phosphate ABC transporter substrate-binding protein 0.9857 24 145
AF-A0A7Z2W2D7-F1-model_v4 Phosphate ABC transporter substrate-binding protein 0.9838 24 146
AF-A0A242N2V9-F1-model_v4 ABC-type phosphate transport system, periplasmic component 0.9801 27 146

Feature Viewer

pLDDT pTM Quality
89.74 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map