F407926

General Info

Members Datasets Scaffolds Average Seq Length
325 147 650 124

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0232843|Ga0395899_0232843_589_984
Length 131
Sequence LGFEGGHVTEDESAIRELVDTWMAASRAGDIAAVLDLMTDDVLFMTPGREPFGKEQFRAASESMRDVKMDGRAEIREIEVLGDCAWIRNHIDLTVTPAAGGPARRSGYTLTILRKSADGKWRLFRDANLVG

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
103 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
104 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.54
Rhizosphere 94.46
Stem 0
Stem Tuber 0
Unclassified 10.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0232843 3300037312 Bacteria 1271
2 JGI24741J21665_1030200 3300001915 Unclassified 813
3 JGI24739J22299_10169850 3300001989 Unclassified 642
4 JGI24737J22298_10130530 3300001990 Unclassified 742
5 JGI24743J22301_10061531 3300001991 Bacteria 774
6 JGI24735J21928_10020979 3300002067 Bacteria 1997
7 JGI24735J21928_10027806 3300002067 Unclassified 1693
8 JGI24738J21930_10087157 3300002075 Bacteria 657
9 Ga0070658_10025302 3300005327 Bacteria 4759
10 Ga0070658_10032382 3300005327 Bacteria 4203
11 Ga0070658_10039993 3300005327 Bacteria 3783
12 Ga0070683_100063339 3300005329 Bacteria 3439
13 Ga0070683_100294567 3300005329 Bacteria 1543
14 Ga0070683_100559984 3300005329 Bacteria 1093
15 Ga0070670_100274790 3300005331 Bacteria 1471
16 Ga0070670_100455196 3300005331 Bacteria 1135
17 Ga0068869_100062527 3300005334 Bacteria 2733
18 Ga0070666_10055760 3300005335 Bacteria 2668
19 Ga0070680_100148494 3300005336 Bacteria 1967
20 Ga0070680_100616644 3300005336 Bacteria 931
21 Ga0068868_100042566 3300005338 Bacteria 3545
22 Ga0068868_101003741 3300005338 Bacteria 764
23 Ga0070660_100115290 3300005339 Bacteria 2141
24 Ga0070660_100135449 3300005339 Bacteria 1973
25 Ga0070660_100727071 3300005339 Bacteria 833
26 Ga0070660_101218964 3300005339 Bacteria 638
27 Ga0070691_10006085 3300005341 Bacteria 5508
28 Ga0070661_100045216 3300005344 Bacteria 3218
29 Ga0070661_100048139 3300005344 Bacteria 3120
30 Ga0070661_100052912 3300005344 Bacteria 2971
31 Ga0070661_100138132 3300005344 Unclassified 1835
32 Ga0070661_100299968 3300005344 Bacteria 1250
33 Ga0070661_100801158 3300005344 Unclassified 773
34 Ga0070692_10117330 3300005345 Bacteria 1480
35 Ga0070675_100150823 3300005354 Bacteria 1993
36 Ga0070671_100001360 3300005355 Bacteria 18332
37 Ga0070671_100005510 3300005355 Bacteria 10093
38 Ga0070671_100008743 3300005355 Bacteria 8124
39 Ga0070671_100143299 3300005355 Bacteria 2017
40 Ga0070674_100197464 3300005356 Bacteria 1551
41 Ga0070673_100042616 3300005364 Bacteria 3500
42 Ga0070673_100635032 3300005364 Unclassified 976
43 Ga0070659_100230543 3300005366 Bacteria 1530
44 Ga0070659_100384092 3300005366 Bacteria 1183
45 Ga0070659_100478376 3300005366 Bacteria 1059
46 Ga0070659_100798963 3300005366 Bacteria 820
47 Ga0070667_100093106 3300005367 Bacteria 2595
48 Ga0070667_102288197 3300005367 Unclassified 509
49 Ga0070714_100359532 3300005435 Unclassified 1369
50 Ga0070713_100155409 3300005436 Bacteria 2038
51 Ga0070663_100193642 3300005455 Bacteria 1583
52 Ga0070663_100856209 3300005455 Bacteria 783
53 Ga0070678_100005026 3300005456 Bacteria 7584
54 Ga0070662_100260086 3300005457 Bacteria 1398
55 Ga0070662_100274973 3300005457 Bacteria 1361
56 Ga0070662_100329723 3300005457 Bacteria 1247
57 Ga0070662_101026096 3300005457 Bacteria 707
58 Ga0070681_10119651 3300005458 Bacteria 2569
59 Ga0070681_10451282 3300005458 Bacteria 1198
60 Ga0070681_10858555 3300005458 Bacteria 825
61 Ga0070679_100047621 3300005530 Bacteria 4272
62 Ga0070679_100425128 3300005530 Bacteria 1274
63 Ga0070679_100436494 3300005530 Bacteria 1254
64 Ga0070679_101264159 3300005530 Bacteria 684
65 Ga0070679_101656098 3300005530 Bacteria 587
66 Ga0070684_100024069 3300005535 Bacteria 5104
67 Ga0068853_100012104 3300005539 Bacteria 7020
68 Ga0068853_100255694 3300005539 Bacteria 1609
69 Ga0068853_100358169 3300005539 Bacteria 1358
70 Ga0068853_100993981 3300005539 Bacteria 807
71 Ga0070672_100250004 3300005543 Bacteria 1493
72 Ga0070672_100646588 3300005543 Bacteria 923
73 Ga0070672_101231929 3300005543 Unclassified 667
74 Ga0070693_101415198 3300005547 Bacteria 541
75 Ga0068855_100224613 3300005563 Bacteria 2105
76 Ga0068855_100754317 3300005563 Bacteria 1037
77 Ga0068855_101576180 3300005563 Bacteria 672
78 Ga0068855_101720932 3300005563 Bacteria 639
79 Ga0068855_101865775 3300005563 Bacteria 609
80 Ga0070664_100001145 3300005564 Bacteria 21000
81 Ga0070664_100059991 3300005564 Bacteria 3238
82 Ga0070664_100074601 3300005564 Bacteria 2911
83 Ga0070664_100136313 3300005564 Bacteria 2159
84 Ga0070664_100214256 3300005564 Unclassified 1721
85 Ga0070664_100325498 3300005564 Bacteria 1393
86 Ga0070664_100441269 3300005564 Bacteria 1194
87 Ga0070664_100500582 3300005564 Bacteria 1120
88 Ga0070664_100645520 3300005564 Bacteria 983
89 Ga0070664_101125799 3300005564 Bacteria 740
90 Ga0068857_100467810 3300005577 Unclassified 1180
91 Ga0068857_100693057 3300005577 Bacteria 967
92 Ga0068854_100002704 3300005578 Bacteria 10991
93 Ga0068854_100231104 3300005578 Bacteria 1468
94 Ga0068854_100601910 3300005578 Bacteria 938
95 Ga0068856_100098032 3300005614 Bacteria 2921
96 Ga0068856_100432742 3300005614 Bacteria 1336
97 Ga0068856_100635126 3300005614 Bacteria 1088
98 Ga0068852_100030002 3300005616 Bacteria 4472
99 Ga0068852_100143693 3300005616 Bacteria 2211
100 Ga0068852_100581207 3300005616 Bacteria 1123
101 Ga0068852_101794013 3300005616 Unclassified 636
102 Ga0068864_100003355 3300005618 Bacteria 13232
103 Ga0068864_100163579 3300005618 Bacteria 2024
104 Ga0068864_100367669 3300005618 Bacteria 1360
105 Ga0068851_10026129 3300005834 Bacteria 2867
106 Ga0068851_10040371 3300005834 Bacteria 2345
107 Ga0068863_100061522 3300005841 Bacteria 3550
108 Ga0068863_100281209 3300005841 Bacteria 1612
109 Ga0068858_100097649 3300005842 Bacteria 2738
110 Ga0068862_100066841 3300005844 Bacteria 3098
111 Ga0070717_10073763 3300006028 Bacteria 2852
112 Ga0097621_101098938 3300006237 Bacteria 746
113 Ga0097621_101776823 3300006237 Unclassified 588
114 Ga0105240_10084772 3300009093 Bacteria 3884
115 Ga0105241_10032300 3300009174 Bacteria 3923
116 Ga0105241_10918413 3300009174 Bacteria 814
117 Ga0105248_10000678 3300009177 Bacteria 38605
118 Ga0105248_10136520 3300009177 Bacteria 2767
119 Ga0105248_11333519 3300009177 Bacteria 812
120 Ga0105248_11863038 3300009177 Bacteria 682
121 Ga0105237_10055929 3300009545 Bacteria 3951
122 Ga0105238_10035056 3300009551 Bacteria 5104
123 Ga0105238_12233677 3300009551 Bacteria 582
124 Ga0157373_10027640 3300013100 Bacteria 4093
125 Ga0157373_10127087 3300013100 Bacteria 1793
126 Ga0157373_10431809 3300013100 Bacteria 946
127 Ga0157373_10792908 3300013100 Bacteria 698
128 Ga0157371_10301000 3300013102 Bacteria 1161
129 Ga0157371_10466245 3300013102 Bacteria 930
130 Ga0157371_11075771 3300013102 Bacteria 616
131 Ga0157371_11660960 3300013102 Bacteria 501
132 Ga0157370_10265330 3300013104 Bacteria 1586
133 Ga0157370_11709773 3300013104 Unclassified 565
134 Ga0157369_10553895 3300013105 Bacteria 1188
135 Ga0157369_12019617 3300013105 Bacteria 585
136 Ga0157369_12333296 3300013105 Unclassified 542
137 Ga0157369_12349894 3300013105 Bacteria 540
138 Ga0157374_11604048 3300013296 Unclassified 675
139 Ga0157372_10064105 3300013307 Bacteria 4122
140 Ga0157372_10744289 3300013307 Unclassified 1140
141 Ga0157379_10699436 3300014968 Bacteria 951
142 Ga0206354_10680440 3300020081 Bacteria 1422
143 Ga0207656_10019822 3300025321 Bacteria 2664
144 Ga0207656_10180393 3300025321 Bacteria 1013
145 Ga0207688_10160503 3300025901 Bacteria 1332
146 Ga0207680_10029091 3300025903 Bacteria 3100
147 Ga0207647_10055018 3300025904 Bacteria 2446
148 Ga0207647_10095325 3300025904 Bacteria 1772
149 Ga0207705_10013781 3300025909 Bacteria 5829
150 Ga0207705_10062173 3300025909 Bacteria 2697
151 Ga0207705_10159141 3300025909 Bacteria 1696
152 Ga0207707_10374197 3300025912 Bacteria 1225
153 Ga0207695_10075409 3300025913 Bacteria 3432
154 Ga0207660_10115498 3300025917 Bacteria 2026
155 Ga0207660_10721699 3300025917 Unclassified 813
156 Ga0207657_10020454 3300025919 Bacteria 6253
157 Ga0207657_10025923 3300025919 Bacteria 5398
158 Ga0207657_10048179 3300025919 Bacteria 3721
159 Ga0207657_10089659 3300025919 Bacteria 2568
160 Ga0207657_10163218 3300025919 Bacteria 1808
161 Ga0207657_10533828 3300025919 Bacteria 918
162 Ga0207649_10043939 3300025920 Bacteria 2734
163 Ga0207649_10101986 3300025920 Bacteria 1901
164 Ga0207649_10784382 3300025920 Unclassified 743
165 Ga0207694_10009158 3300025924 Bacteria 7474
166 Ga0207694_10166521 3300025924 Bacteria 1783
167 Ga0207650_10024359 3300025925 Bacteria 4301
168 Ga0207650_10125271 3300025925 Bacteria 2005
169 Ga0207650_10430222 3300025925 Bacteria 1096
170 Ga0207650_10769151 3300025925 Bacteria 815
171 Ga0207650_10819015 3300025925 Bacteria 789
172 Ga0207659_10876324 3300025926 Bacteria 772
173 Ga0207700_10091734 3300025928 Bacteria 2400
174 Ga0207644_10007113 3300025931 Bacteria 7296
175 Ga0207644_10018382 3300025931 Bacteria 4727
176 Ga0207644_10040204 3300025931 Bacteria 3304
177 Ga0207644_10378328 3300025931 Unclassified 1154
178 Ga0207644_10394881 3300025931 Bacteria 1130
179 Ga0207644_10553656 3300025931 Bacteria 952
180 Ga0207644_10613847 3300025931 Unclassified 904
181 Ga0207690_10005237 3300025932 Bacteria 7650
182 Ga0207690_10625746 3300025932 Bacteria 880
183 Ga0207706_10031084 3300025933 Bacteria 4759
184 Ga0207706_10105303 3300025933 Bacteria 2482
185 Ga0207706_10204331 3300025933 Bacteria 1732
186 Ga0207706_10427561 3300025933 Bacteria 1147
187 Ga0207706_10911098 3300025933 Bacteria 742
188 Ga0207706_11084821 3300025933 Bacteria 670
189 Ga0207669_10126651 3300025937 Bacteria 1746
190 Ga0207665_10084234 3300025939 Bacteria 2194
191 Ga0207691_10218922 3300025940 Bacteria 1652
192 Ga0207691_10311235 3300025940 Bacteria 1351
193 Ga0207711_10000123 3300025941 Bacteria 80861
194 Ga0207711_10155901 3300025941 Bacteria 2064
195 Ga0207711_10457759 3300025941 Bacteria 1188
196 Ga0207689_10063762 3300025942 Bacteria 3032
197 Ga0207661_10345692 3300025944 Bacteria 1341
198 Ga0207679_10030730 3300025945 Bacteria 3753
199 Ga0207679_10050671 3300025945 Bacteria 3035
200 Ga0207679_10061153 3300025945 Bacteria 2802
201 Ga0207679_10099905 3300025945 Bacteria 2266
202 Ga0207679_10105914 3300025945 Bacteria 2209
203 Ga0207679_10203469 3300025945 Bacteria 1655
204 Ga0207679_10649219 3300025945 Bacteria 954
205 Ga0207667_10010052 3300025949 Bacteria 11093
206 Ga0207667_10174238 3300025949 Bacteria 2210
207 Ga0207667_10187059 3300025949 Bacteria 2126
208 Ga0207667_10937354 3300025949 Bacteria 856
209 Ga0207651_10360521 3300025960 Unclassified 1227
210 Ga0207668_10908141 3300025972 Bacteria 784
211 Ga0207640_10003053 3300025981 Bacteria 9017
212 Ga0207640_10278224 3300025981 Bacteria 1313
213 Ga0207640_10810498 3300025981 Bacteria 812
214 Ga0207658_10066804 3300025986 Bacteria 2706
215 Ga0207677_10252423 3300026023 Bacteria 1433
216 Ga0207677_10922018 3300026023 Bacteria 788
217 Ga0207677_12222375 3300026023 Unclassified 510
218 Ga0207703_10058499 3300026035 Bacteria 3146
219 Ga0207639_10059443 3300026041 Bacteria 2944
220 Ga0207639_10305203 3300026041 Bacteria 1408
221 Ga0207639_12113799 3300026041 Unclassified 524
222 Ga0207678_10006830 3300026067 Bacteria 10120
223 Ga0207678_10015166 3300026067 Bacteria 6778
224 Ga0207678_10176069 3300026067 Bacteria 1826
225 Ga0207702_10010690 3300026078 Bacteria 7668
226 Ga0207641_10049959 3300026088 Bacteria 3536
227 Ga0207641_10246785 3300026088 Bacteria 1666
228 Ga0207676_10021834 3300026095 Bacteria 4701
229 Ga0207676_12300587 3300026095 Unclassified 536
230 Ga0207674_10003759 3300026116 Bacteria 18521
231 Ga0207674_10013688 3300026116 Bacteria 8986
232 Ga0207674_10028771 3300026116 Bacteria 5860
233 Ga0207674_10102964 3300026116 Bacteria 2834
234 Ga0207674_10170472 3300026116 Bacteria 2130
235 Ga0207674_12036439 3300026116 Bacteria 539
236 Ga0207683_10012558 3300026121 Bacteria 7226
237 Ga0207698_10001156 3300026142 Bacteria 15373
238 Ga0207698_10177662 3300026142 Bacteria 1882
239 Ga0268265_10194222 3300028380 Bacteria 1755
240 Ga0373959_0147643 3300034820 Bacteria 593
241 Ga0373929_0268582 3300035085 Unclassified 500
242 Ga0373960_0152249 3300035121 Bacteria 791
243 Ga0373943_0038445 3300035170 Unclassified 2301
244 Ga0373927_0015521 3300035695 Bacteria 5031
245 Ga0373925_0022989 3300037068 Bacteria 4549
246 Ga0395899_0104135 3300037312 Bacteria 2045
247 Ga0395899_0145882 3300037312 Bacteria 1681
248 Ga0395899_0230280 3300037312 Bacteria 1280
249 Ga0395899_0230491 3300037312 Bacteria 1279
250 Ga0395900_0026895 3300037418 Bacteria 5888
251 Ga0395900_0080417 3300037418 Bacteria 3349
252 Ga0395900_0085950 3300037418 Bacteria 3232
253 Ga0395900_0208785 3300037418 Bacteria 1972
254 Ga0395900_0266316 3300037418 Bacteria 1710
255 Ga0395900_0578743 3300037418 Bacteria 1065
256 Ga0395900_0758530 3300037418 Bacteria 900
257 Ga0395900_1598270 3300037418 Bacteria 563
258 Ga0395898_0032549 3300037466 Bacteria 5205
259 Ga0395898_1880354 3300037466 Bacteria 519
260 Ga0395905_0004414 3300037471 Bacteria 14630
261 Ga0395905_0007208 3300037471 Bacteria 11089
262 Ga0395905_0017753 3300037471 Bacteria 6756
263 Ga0395905_0086552 3300037471 Bacteria 2937
264 Ga0395905_0456506 3300037471 Bacteria 1176
265 Ga0395905_1173349 3300037471 Unclassified 671
266 Ga0395905_1225917 3300037471 Unclassified 654
267 Ga0395905_1243082 3300037471 Bacteria 648
268 Ga0395905_1684714 3300037471 Unclassified 539
269 Ga0395901_0093362 3300038443 Bacteria 3151
270 Ga0395901_0126719 3300038443 Bacteria 2683
271 Ga0395901_0138519 3300038443 Bacteria 2558
272 Ga0395901_0420171 3300038443 Bacteria 1371
273 Ga0395901_0606710 3300038443 Bacteria 1103
274 Ga0395901_0640322 3300038443 Bacteria 1067
275 Ga0395901_0840996 3300038443 Bacteria 904
276 Ga0395901_1363084 3300038443 Bacteria 669
277 Ga0395901_1378943 3300038443 Unclassified 664
278 Ga0466963_0003802 3300044694 Bacteria 8704
279 Ga0466963_0055468 3300044694 Bacteria 2635
280 Ga0466963_0695952 3300044694 Bacteria 717
281 Ga0466971_0313361 3300044719 Bacteria 755
282 Ga0466970_0924522 3300044765 Unclassified 513
283 Ga0466967_0104396 3300045976 Bacteria 2594
284 Ga0466967_0227796 3300045976 Bacteria 1773
285 Ga0466967_0329911 3300045976 Bacteria 1473
286 Ga0466967_0360553 3300045976 Bacteria 1408
287 Ga0495603_0000202 3300046455 Bacteria 31387
288 Ga0495629_0000743 3300046459 Bacteria 26313
289 Ga0495580_0058324 3300046472 Bacteria 2715
290 Ga0495582_0003475 3300046473 Bacteria 8871
291 Ga0495639_0000908 3300046475 Bacteria 13363
292 Ga0495594_0000375 3300046499 Bacteria 22384
293 Ga0495606_0265686 3300046507 Bacteria 945
294 Ga0495666_0115245 3300046526 Bacteria 1261
295 Ga0495665_0051089 3300046531 Bacteria 2190
296 Ga0495622_0015486 3300046557 Bacteria 3544
297 Ga0495634_0009968 3300046642 Bacteria 6978
298 Ga0495635_0893202 3300046663 Bacteria 569
299 Ga0495588_0163117 3300046674 Bacteria 1178
300 Ga0495647_0001845 3300046681 Bacteria 6568
301 Ga0495658_0000908 3300046683 Bacteria 15857
302 Ga0495669_0015111 3300046684 Bacteria 3302
303 Ga0495669_0059787 3300046684 Bacteria 1722
304 Ga0495613_0015553 3300046689 Bacteria 5659
305 Ga0495593_0000383 3300047673 Bacteria 24512
306 Ga0495614_0023996 3300048089 Bacteria 2632
307 Ga0496100_0024069 3300048903 Bacteria 3709
308 Ga0496101_0003148 3300048904 Bacteria 10211
309 Ga0496101_0112947 3300048904 Bacteria 2047
310 Ga0496101_0755942 3300048904 Bacteria 767
311 Ga0496104_0488249 3300048907 Bacteria 1143
312 Ga0496106_0002175 3300048909 Bacteria 14650
313 Ga0496107_0007166 3300048910 Bacteria 7683
314 Ga0496107_0066369 3300048910 Bacteria 2616
315 Ga0496107_0321379 3300048910 Bacteria 1152
316 Ga0496109_0002413 3300048912 Bacteria 15643
317 Ga0496110_0012460 3300048913 Bacteria 6993
318 Ga0496110_0822401 3300048913 Bacteria 834
319 Ga0496111_0005809 3300048914 Bacteria 7958
320 Ga0496112_0021488 3300048915 Bacteria 6138
321 Ga0496112_0201451 3300048915 Bacteria 1950
322 Ga0496113_0036302 3300048916 Bacteria 3610
323 Ga0496114_0196880 3300048917 Unclassified 1764
324 Ga0496115_0001435 3300048918 Bacteria 17063
325 Ga0495595_0315575 3300053084 Bacteria 787
326 Ga0395899_0232843
327 JGI24741J21665_1030200
328 JGI24739J22299_10169850
329 JGI24737J22298_10130530
330 JGI24743J22301_10061531
331 JGI24735J21928_10020979
332 JGI24735J21928_10027806
333 JGI24738J21930_10087157
334 Ga0070658_10025302
335 Ga0070658_10032382
336 Ga0070658_10039993
337 Ga0070683_100063339
338 Ga0070683_100294567
339 Ga0070683_100559984
340 Ga0070670_100274790
341 Ga0070670_100455196
342 Ga0068869_100062527
343 Ga0070666_10055760
344 Ga0070680_100148494
345 Ga0070680_100616644
346 Ga0068868_100042566
347 Ga0068868_101003741
348 Ga0070660_100115290
349 Ga0070660_100135449
350 Ga0070660_100727071
351 Ga0070660_101218964
352 Ga0070691_10006085
353 Ga0070661_100045216
354 Ga0070661_100048139
355 Ga0070661_100052912
356 Ga0070661_100138132
357 Ga0070661_100299968
358 Ga0070661_100801158
359 Ga0070692_10117330
360 Ga0070675_100150823
361 Ga0070671_100001360
362 Ga0070671_100005510
363 Ga0070671_100008743
364 Ga0070671_100143299
365 Ga0070674_100197464
366 Ga0070673_100042616
367 Ga0070673_100635032
368 Ga0070659_100230543
369 Ga0070659_100384092
370 Ga0070659_100478376
371 Ga0070659_100798963
372 Ga0070667_100093106
373 Ga0070667_102288197
374 Ga0070714_100359532
375 Ga0070713_100155409
376 Ga0070663_100193642
377 Ga0070663_100856209
378 Ga0070678_100005026
379 Ga0070662_100260086
380 Ga0070662_100274973
381 Ga0070662_100329723
382 Ga0070662_101026096
383 Ga0070681_10119651
384 Ga0070681_10451282
385 Ga0070681_10858555
386 Ga0070679_100047621
387 Ga0070679_100425128
388 Ga0070679_100436494
389 Ga0070679_101264159
390 Ga0070679_101656098
391 Ga0070684_100024069
392 Ga0068853_100012104
393 Ga0068853_100255694
394 Ga0068853_100358169
395 Ga0068853_100993981
396 Ga0070672_100250004
397 Ga0070672_100646588
398 Ga0070672_101231929
399 Ga0070693_101415198
400 Ga0068855_100224613
401 Ga0068855_100754317
402 Ga0068855_101576180
403 Ga0068855_101720932
404 Ga0068855_101865775
405 Ga0070664_100001145
406 Ga0070664_100059991
407 Ga0070664_100074601
408 Ga0070664_100136313
409 Ga0070664_100214256
410 Ga0070664_100325498
411 Ga0070664_100441269
412 Ga0070664_100500582
413 Ga0070664_100645520
414 Ga0070664_101125799
415 Ga0068857_100467810
416 Ga0068857_100693057
417 Ga0068854_100002704
418 Ga0068854_100231104
419 Ga0068854_100601910
420 Ga0068856_100098032
421 Ga0068856_100432742
422 Ga0068856_100635126
423 Ga0068852_100030002
424 Ga0068852_100143693
425 Ga0068852_100581207
426 Ga0068852_101794013
427 Ga0068864_100003355
428 Ga0068864_100163579
429 Ga0068864_100367669
430 Ga0068851_10026129
431 Ga0068851_10040371
432 Ga0068863_100061522
433 Ga0068863_100281209
434 Ga0068858_100097649
435 Ga0068862_100066841
436 Ga0070717_10073763
437 Ga0097621_101098938
438 Ga0097621_101776823
439 Ga0105240_10084772
440 Ga0105241_10032300
441 Ga0105241_10918413
442 Ga0105248_10000678
443 Ga0105248_10136520
444 Ga0105248_11333519
445 Ga0105248_11863038
446 Ga0105237_10055929
447 Ga0105238_10035056
448 Ga0105238_12233677
449 Ga0157373_10027640
450 Ga0157373_10127087
451 Ga0157373_10431809
452 Ga0157373_10792908
453 Ga0157371_10301000
454 Ga0157371_10466245
455 Ga0157371_11075771
456 Ga0157371_11660960
457 Ga0157370_10265330
458 Ga0157370_11709773
459 Ga0157369_10553895
460 Ga0157369_12019617
461 Ga0157369_12333296
462 Ga0157369_12349894
463 Ga0157374_11604048
464 Ga0157372_10064105
465 Ga0157372_10744289
466 Ga0157379_10699436
467 Ga0206354_10680440
468 Ga0207656_10019822
469 Ga0207656_10180393
470 Ga0207688_10160503
471 Ga0207680_10029091
472 Ga0207647_10055018
473 Ga0207647_10095325
474 Ga0207705_10013781
475 Ga0207705_10062173
476 Ga0207705_10159141
477 Ga0207707_10374197
478 Ga0207695_10075409
479 Ga0207660_10115498
480 Ga0207660_10721699
481 Ga0207657_10020454
482 Ga0207657_10025923
483 Ga0207657_10048179
484 Ga0207657_10089659
485 Ga0207657_10163218
486 Ga0207657_10533828
487 Ga0207649_10043939
488 Ga0207649_10101986
489 Ga0207649_10784382
490 Ga0207694_10009158
491 Ga0207694_10166521
492 Ga0207650_10024359
493 Ga0207650_10125271
494 Ga0207650_10430222
495 Ga0207650_10769151
496 Ga0207650_10819015
497 Ga0207659_10876324
498 Ga0207700_10091734
499 Ga0207644_10007113
500 Ga0207644_10018382
501 Ga0207644_10040204
502 Ga0207644_10378328
503 Ga0207644_10394881
504 Ga0207644_10553656
505 Ga0207644_10613847
506 Ga0207690_10005237
507 Ga0207690_10625746
508 Ga0207706_10031084
509 Ga0207706_10105303
510 Ga0207706_10204331
511 Ga0207706_10427561
512 Ga0207706_10911098
513 Ga0207706_11084821
514 Ga0207669_10126651
515 Ga0207665_10084234
516 Ga0207691_10218922
517 Ga0207691_10311235
518 Ga0207711_10000123
519 Ga0207711_10155901
520 Ga0207711_10457759
521 Ga0207689_10063762
522 Ga0207661_10345692
523 Ga0207679_10030730
524 Ga0207679_10050671
525 Ga0207679_10061153
526 Ga0207679_10099905
527 Ga0207679_10105914
528 Ga0207679_10203469
529 Ga0207679_10649219
530 Ga0207667_10010052
531 Ga0207667_10174238
532 Ga0207667_10187059
533 Ga0207667_10937354
534 Ga0207651_10360521
535 Ga0207668_10908141
536 Ga0207640_10003053
537 Ga0207640_10278224
538 Ga0207640_10810498
539 Ga0207658_10066804
540 Ga0207677_10252423
541 Ga0207677_10922018
542 Ga0207677_12222375
543 Ga0207703_10058499
544 Ga0207639_10059443
545 Ga0207639_10305203
546 Ga0207639_12113799
547 Ga0207678_10006830
548 Ga0207678_10015166
549 Ga0207678_10176069
550 Ga0207702_10010690
551 Ga0207641_10049959
552 Ga0207641_10246785
553 Ga0207676_10021834
554 Ga0207676_12300587
555 Ga0207674_10003759
556 Ga0207674_10013688
557 Ga0207674_10028771
558 Ga0207674_10102964
559 Ga0207674_10170472
560 Ga0207674_12036439
561 Ga0207683_10012558
562 Ga0207698_10001156
563 Ga0207698_10177662
564 Ga0268265_10194222
565 Ga0373959_0147643
566 Ga0373929_0268582
567 Ga0373960_0152249
568 Ga0373943_0038445
569 Ga0373927_0015521
570 Ga0373925_0022989
571 Ga0395899_0104135
572 Ga0395899_0145882
573 Ga0395899_0230280
574 Ga0395899_0230491
575 Ga0395900_0026895
576 Ga0395900_0080417
577 Ga0395900_0085950
578 Ga0395900_0208785
579 Ga0395900_0266316
580 Ga0395900_0578743
581 Ga0395900_0758530
582 Ga0395900_1598270
583 Ga0395898_0032549
584 Ga0395898_1880354
585 Ga0395905_0004414
586 Ga0395905_0007208
587 Ga0395905_0017753
588 Ga0395905_0086552
589 Ga0395905_0456506
590 Ga0395905_1173349
591 Ga0395905_1225917
592 Ga0395905_1243082
593 Ga0395905_1684714
594 Ga0395901_0093362
595 Ga0395901_0126719
596 Ga0395901_0138519
597 Ga0395901_0420171
598 Ga0395901_0606710
599 Ga0395901_0640322
600 Ga0395901_0840996
601 Ga0395901_1363084
602 Ga0395901_1378943
603 Ga0466963_0003802
604 Ga0466963_0055468
605 Ga0466963_0695952
606 Ga0466971_0313361
607 Ga0466970_0924522
608 Ga0466967_0104396
609 Ga0466967_0227796
610 Ga0466967_0329911
611 Ga0466967_0360553
612 Ga0495603_0000202
613 Ga0495629_0000743
614 Ga0495580_0058324
615 Ga0495582_0003475
616 Ga0495639_0000908
617 Ga0495594_0000375
618 Ga0495606_0265686
619 Ga0495666_0115245
620 Ga0495665_0051089
621 Ga0495622_0015486
622 Ga0495634_0009968
623 Ga0495635_0893202
624 Ga0495588_0163117
625 Ga0495647_0001845
626 Ga0495658_0000908
627 Ga0495669_0015111
628 Ga0495669_0059787
629 Ga0495613_0015553
630 Ga0495593_0000383
631 Ga0495614_0023996
632 Ga0496100_0024069
633 Ga0496101_0003148
634 Ga0496101_0112947
635 Ga0496101_0755942
636 Ga0496104_0488249
637 Ga0496106_0002175
638 Ga0496107_0007166
639 Ga0496107_0066369
640 Ga0496107_0321379
641 Ga0496109_0002413
642 Ga0496110_0012460
643 Ga0496110_0822401
644 Ga0496111_0005809
645 Ga0496112_0021488
646 Ga0496112_0201451
647 Ga0496113_0036302
648 Ga0496114_0196880
649 Ga0496115_0001435
650 Ga0495595_0315575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

15

123

0.94

PF12680

SnoaL_2

SnoaL-like domain

19

124

0.88

PF13474

SnoaL_3

SnoaL-like domain

15

125

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.9663 4 124
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.9361 4 124
4gb5-assembly1.cif.gz_A crystal structure of kfla4162 protein from kribbella flavida 0.8886 4 124
3hx8-assembly2.cif.gz_C crystal structure of putative ketosteroid isomerase (np_103587.1) from mesorhizobium loti at 1.45 a resolution 0.882 5 120
4leh-assembly1.cif.gz_C crystal structure of a bile-acid 7-alpha dehydratase (closci_03134) from clostridium scindens atcc 35704 at 2.90 a resolution 0.8684 4 119
ID Description Score Start End Superfamily
3robD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9489 4 124 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8804 4 124 3.10.450.50
4gb5A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8783 4 124 3.10.450.50
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8592 6 124 3.10.450.50
5iepA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.857 1 124 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7C2LRC3-F1-model_v4 SgcJ/EcaC family oxidoreductase 0.9925 1 124
AF-A0A117DTG0-F1-model_v4 deleted 0.9902 1 124
AF-A0A3S1GAW5-F1-model_v4 SgcJ/EcaC family oxidoreductase 0.9893 1 124
AF-A0A5C1A480-F1-model_v4 DUF4440 domain-containing protein 0.9893 1 124
AF-A0A238H7K1-F1-model_v4 Ketosteroid isomerase homolog 0.9875 1 124 GO:0016853

Map