F407920

General Info

Members Datasets Scaffolds Average Seq Length
325 195 650 251

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0029399|Ga0373937_0029399_313_1002
Length 223
Sequence MDAKITAPFDTAHSRGALDRDERQVKDSILRMASLVEGQIRLSMRSLVERDQLLAAEVIENDARVNEAQRAVGDRVAMTIATQAPVARDLRFLLALNHVASELERIGDHATSVAKDEPPMPGLSRVGQMGTIAADLVRGILDALIDVDESKARAVAARDDEIDHLYREVFTSTLAAMHADPPSVERGTRVILAAHWIERIGDRVTNIAEDVVYLASGVVEDLN

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 17.23
Rhizosphere 81.23
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0029399 3300036401 Bacteria 4977
2 rootL2_10227939 3300003322 Bacteria 1141
3 rootH1_10181931 3300003323 Bacteria 2024
4 Ga0070683_100078926 3300005329 Bacteria 3080
5 Ga0070683_100088657 3300005329 Bacteria 2903
6 Ga0070683_100584982 3300005329 Bacteria 1068
7 Ga0070690_100014925 3300005330 Bacteria 4621
8 Ga0070670_100038292 3300005331 Bacteria 4124
9 Ga0070682_100025040 3300005337 Bacteria 3559
10 Ga0068868_100570411 3300005338 Bacteria 999
11 Ga0070660_100018960 3300005339 Bacteria 5037
12 Ga0070687_100006357 3300005343 Bacteria 4838
13 Ga0070661_100101997 3300005344 Bacteria 2135
14 Ga0070668_100108200 3300005347 Bacteria 2211
15 Ga0070675_100017044 3300005354 Bacteria 5774
16 Ga0070675_100117644 3300005354 Bacteria 2256
17 Ga0070688_100014004 3300005365 Bacteria 4536
18 Ga0070659_100116575 3300005366 Bacteria 2159
19 Ga0070659_100549114 3300005366 Bacteria 989
20 Ga0070703_10023518 3300005406 Bacteria 1815
21 Ga0070710_10139121 3300005437 Bacteria 1487
22 Ga0070701_10154331 3300005438 Bacteria 1325
23 Ga0070705_100017393 3300005440 Bacteria 3753
24 Ga0070705_100021300 3300005440 Bacteria 3446
25 Ga0070705_100040323 3300005440 Bacteria 2655
26 Ga0070705_100143671 3300005440 Bacteria 1574
27 Ga0070694_100203265 3300005444 Bacteria 1478
28 Ga0070694_100321755 3300005444 Bacteria 1191
29 Ga0070708_100006608 3300005445 Bacteria 9231
30 Ga0070708_100013886 3300005445 Bacteria 6613
31 Ga0070708_100046252 3300005445 Bacteria 3840
32 Ga0070708_100313063 3300005445 Bacteria 1479
33 Ga0070663_100362846 3300005455 Bacteria 1175
34 Ga0070678_100159120 3300005456 Bacteria 1828
35 Ga0070678_100374729 3300005456 Bacteria 1230
36 Ga0070678_100476035 3300005456 Bacteria 1098
37 Ga0070662_100103256 3300005457 Bacteria 2161
38 Ga0070681_10104368 3300005458 Bacteria 2777
39 Ga0070681_10182167 3300005458 Bacteria 2022
40 Ga0068867_100169999 3300005459 Bacteria 1725
41 Ga0070706_100014595 3300005467 Bacteria 7260
42 Ga0070706_100021681 3300005467 Bacteria 5917
43 Ga0070706_100111432 3300005467 Bacteria 2546
44 Ga0070707_100000943 3300005468 Bacteria 28883
45 Ga0070698_100156350 3300005471 Bacteria 2226
46 Ga0070698_100229391 3300005471 Bacteria 1790
47 Ga0070698_100313050 3300005471 Bacteria 1501
48 Ga0070679_100127736 3300005530 Bacteria 2524
49 Ga0070684_100059550 3300005535 Bacteria 3339
50 Ga0070684_100250608 3300005535 Bacteria 1618
51 Ga0070684_100351393 3300005535 Bacteria 1356
52 Ga0070697_100165402 3300005536 Bacteria 1870
53 Ga0068853_100082674 3300005539 Bacteria 2813
54 Ga0070672_100210226 3300005543 Bacteria 1629
55 Ga0070686_100088431 3300005544 Bacteria 2067
56 Ga0070686_100115112 3300005544 Bacteria 1838
57 Ga0070686_100133238 3300005544 Bacteria 1721
58 Ga0070686_100232746 3300005544 Bacteria 1337
59 Ga0070695_100004749 3300005545 Bacteria 7997
60 Ga0070695_100012093 3300005545 Bacteria 5174
61 Ga0070695_100027538 3300005545 Bacteria 3521
62 Ga0070695_100046571 3300005545 Bacteria 2767
63 Ga0070696_100007870 3300005546 Bacteria 7117
64 Ga0070696_100040961 3300005546 Bacteria 3199
65 Ga0070693_100016639 3300005547 Bacteria 3810
66 Ga0070693_100125971 3300005547 Bacteria 1595
67 Ga0070704_100054343 3300005549 Bacteria 2834
68 Ga0070704_100073443 3300005549 Bacteria 2492
69 Ga0070704_100591942 3300005549 Bacteria 974
70 Ga0070664_100275828 3300005564 Bacteria 1515
71 Ga0068854_100095670 3300005578 Bacteria 2218
72 Ga0068856_100175386 3300005614 Bacteria 2156
73 Ga0068856_100489396 3300005614 Bacteria 1251
74 Ga0068852_100030449 3300005616 Bacteria 4442
75 Ga0068859_100077820 3300005617 Bacteria 3358
76 Ga0068864_100010897 3300005618 Bacteria 7515
77 Ga0068864_100040429 3300005618 Bacteria 3990
78 Ga0068870_10101831 3300005840 Bacteria 1625
79 Ga0068863_100198607 3300005841 Bacteria 1928
80 Ga0068863_100255887 3300005841 Bacteria 1692
81 Ga0068858_100344884 3300005842 Bacteria 1426
82 Ga0068858_100378122 3300005842 Bacteria 1359
83 Ga0068860_100363315 3300005843 Bacteria 1427
84 Ga0097621_100241242 3300006237 Bacteria 1580
85 Ga0075433_10046127 3300006852 Bacteria 3789
86 Ga0097620_100077822 3300006931 Bacteria 3358
87 Ga0111539_10022476 3300009094 Bacteria 7748
88 Ga0105245_10595937 3300009098 Bacteria 1131
89 Ga0105247_10326565 3300009101 Bacteria 1072
90 Ga0114129_10278248 3300009147 Bacteria 2237
91 Ga0105238_10065507 3300009551 Bacteria 3634
92 Ga0105249_10018579 3300009553 Bacteria 6188
93 Ga0105249_10044647 3300009553 Bacteria 4029
94 Ga0105239_10305772 3300010375 Bacteria 1791
95 Ga0105239_10978195 3300010375 Bacteria 973
96 Ga0105246_10245922 3300011119 Bacteria 1417
97 Ga0105246_10318777 3300011119 Bacteria 1262
98 Ga0157373_10221880 3300013100 Bacteria 1334
99 Ga0157371_10224597 3300013102 Bacteria 1349
100 Ga0157378_10009909 3300013297 Bacteria 8305
101 Ga0163162_10109630 3300013306 Bacteria 2857
102 Ga0163162_10829971 3300013306 Bacteria 1040
103 Ga0157375_10162308 3300013308 Bacteria 2377
104 Ga0157375_10169137 3300013308 Bacteria 2332
105 Ga0163163_10007948 3300014325 Bacteria 9381
106 Ga0163163_10014718 3300014325 Bacteria 7196
107 Ga0163163_10016761 3300014325 Bacteria 6817
108 Ga0163163_10184335 3300014325 Bacteria 2135
109 Ga0163163_10345111 3300014325 Bacteria 1544
110 Ga0157380_10003141 3300014326 Bacteria 11271
111 Ga0157377_10143543 3300014745 Bacteria 1469
112 Ga0157379_10037687 3300014968 Bacteria 4312
113 Ga0157379_10097096 3300014968 Bacteria 2645
114 Ga0157379_10273167 3300014968 Bacteria 1537
115 Ga0157379_10387152 3300014968 Bacteria 1283
116 Ga0157376_10309845 3300014969 Bacteria 1497
117 Ga0157376_10503226 3300014969 Bacteria 1191
118 Ga0163161_10014379 3300017792 Bacteria 5510
119 Ga0207653_10036167 3300025885 Bacteria 1608
120 Ga0207642_10009058 3300025899 Bacteria 3446
121 Ga0207688_10108476 3300025901 Bacteria 1610
122 Ga0207680_10326296 3300025903 Bacteria 1074
123 Ga0207647_10099401 3300025904 Bacteria 1728
124 Ga0207645_10036759 3300025907 Bacteria 3145
125 Ga0207643_10101913 3300025908 Bacteria 1684
126 Ga0207684_10004612 3300025910 Bacteria 12939
127 Ga0207684_10010271 3300025910 Bacteria 8239
128 Ga0207684_10139640 3300025910 Bacteria 2082
129 Ga0207660_10000001 3300025917 Bacteria 1034169
130 Ga0207662_10010657 3300025918 Bacteria 5083
131 Ga0207662_10170301 3300025918 Bacteria 1396
132 Ga0207657_10037372 3300025919 Bacteria 4336
133 Ga0207652_10172693 3300025921 Bacteria 1940
134 Ga0207646_10001453 3300025922 Bacteria 29351
135 Ga0207646_10004018 3300025922 Bacteria 16275
136 Ga0207681_10085488 3300025923 Bacteria 2239
137 Ga0207659_10552421 3300025926 Bacteria 979
138 Ga0207659_10671237 3300025926 Bacteria 886
139 Ga0207687_10465326 3300025927 Bacteria 1051
140 Ga0207690_10007218 3300025932 Bacteria 6600
141 Ga0207690_10279161 3300025932 Bacteria 1300
142 Ga0207706_10008390 3300025933 Bacteria 9533
143 Ga0207686_10308951 3300025934 Bacteria 1177
144 Ga0207709_10035615 3300025935 Bacteria 2944
145 Ga0207704_10265024 3300025938 Bacteria 1297
146 Ga0207689_10018832 3300025942 Bacteria 5822
147 Ga0207689_10063426 3300025942 Bacteria 3040
148 Ga0207661_10055110 3300025944 Bacteria 3188
149 Ga0207712_10235031 3300025961 Bacteria 1473
150 Ga0207668_10016833 3300025972 Bacteria 4572
151 Ga0207640_10073783 3300025981 Bacteria 2307
152 Ga0207703_10630678 3300026035 Bacteria 1015
153 Ga0207639_10168593 3300026041 Bacteria 1852
154 Ga0207678_10100232 3300026067 Bacteria 2474
155 Ga0207678_10183107 3300026067 Bacteria 1789
156 Ga0207708_10042374 3300026075 Bacteria 3470
157 Ga0207702_10202348 3300026078 Bacteria 1842
158 Ga0207702_10231652 3300026078 Bacteria 1727
159 Ga0207641_10298438 3300026088 Bacteria 1521
160 Ga0207648_10061440 3300026089 Bacteria 3276
161 Ga0207648_10383744 3300026089 Bacteria 1271
162 Ga0207676_10011172 3300026095 Bacteria 6411
163 Ga0207674_10133080 3300026116 Bacteria 2449
164 Ga0207683_10166653 3300026121 Bacteria 1994
165 Ga0207683_10397208 3300026121 Bacteria 1268
166 Ga0210000_1011549 3300027462 Bacteria 1309
167 Ga0210002_1009926 3300027617 Bacteria 1456
168 Ga0209971_1012276 3300027682 Bacteria 2027
169 Ga0209998_10006467 3300027717 Bacteria 2435
170 Ga0207428_10067892 3300027907 Bacteria 2806
171 Ga0268264_10324578 3300028381 Bacteria 1457
172 Ga0265334_10066796 3300028573 Bacteria 1345
173 Ga0265334_10085204 3300028573 Bacteria 1160
174 Ga0265318_10024730 3300028577 Bacteria 2380
175 Ga0265322_10032924 3300028654 Bacteria 1478
176 Ga0265330_10009485 3300031235 Bacteria 4624
177 Ga0265330_10050267 3300031235 Bacteria 1829
178 Ga0265329_10020039 3300031242 Bacteria 2264
179 Ga0265339_10025554 3300031249 Bacteria 3389
180 Ga0265316_10004616 3300031344 Bacteria 13663
181 Ga0265316_10036524 3300031344 Bacteria 3972
182 Ga0265316_10496825 3300031344 Bacteria 872
183 Ga0265342_10025806 3300031712 Bacteria 3688
184 Ga0316578_10017932 3300031728 Bacteria 3866
185 Ga0307405_10598237 3300031731 Unclassified 899
186 Ga0307412_10279525 3300031911 Bacteria 1310
187 Ga0307409_100213425 3300031995 Bacteria 1736
188 Ga0307415_100265781 3300032126 Bacteria 1402
189 Ga0373939_0053546 3300035114 Bacteria 1261
190 Ga0373960_0068707 3300035121 Bacteria 1091
191 Ga0373943_0112698 3300035170 Bacteria 1436
192 Ga0316574_0137944 3300035398 Bacteria 1570
193 Ga0373937_0054504 3300036401 Bacteria 3670
194 Ga0316582_0049890 3300036647 Bacteria 2649
195 Ga0451853_0849906 3300041512 Bacteria 2411
196 Ga0451853_3329351 3300041512 Bacteria 938
197 Ga0450917_004814 3300042120 Bacteria 994
198 Ga0453684_0452321 3300044712 Bacteria 1429
199 Ga0495592_0058771 3300046454 Bacteria 2835
200 Ga0495641_0057561 3300046461 Bacteria 1761
201 Ga0495582_0055315 3300046473 Bacteria 2188
202 Ga0495662_0140214 3300046476 Bacteria 1190
203 Ga0495608_0049769 3300046511 Bacteria 2782
204 Ga0495618_0209294 3300046514 Bacteria 1233
205 Ga0495618_0254910 3300046514 Bacteria 1100
206 Ga0495628_0029669 3300046516 Bacteria 4433
207 Ga0495652_0101608 3300046529 Bacteria 2331
208 Ga0495652_0449561 3300046529 Bacteria 902
209 Ga0495645_0102340 3300046543 Bacteria 2036
210 Ga0495667_0071051 3300046559 Bacteria 2271
211 Ga0495656_0215030 3300046615 Bacteria 959
212 Ga0495656_0262327 3300046615 Unclassified 876
213 Ga0495634_0194921 3300046642 Bacteria 1261
214 Ga0495658_0172498 3300046683 Bacteria 1339
215 Ga0495658_0212221 3300046683 Bacteria 1210
216 Ga0495613_0291323 3300046689 Bacteria 1132
217 Ga0495624_0163966 3300046690 Bacteria 1357
218 Ga0495674_0011648 3300047319 Bacteria 8293
219 Ga0495674_0026816 3300047319 Bacteria 5270
220 Ga0495680_0038124 3300047322 Bacteria 3844
221 Ga0495684_0073234 3300047471 Bacteria 2602
222 Ga0495602_0200101 3300048088 Bacteria 1525
223 Ga0496100_0075827 3300048903 Bacteria 2256
224 Ga0496100_0251371 3300048903 Bacteria 1308
225 Ga0496101_0057254 3300048904 Bacteria 2819
226 Ga0496102_0022291 3300048905 Bacteria 5611
227 Ga0496102_0190390 3300048905 Bacteria 1933
228 Ga0496102_0248401 3300048905 Bacteria 1677
229 Ga0496102_0317439 3300048905 Bacteria 1468
230 Ga0496102_0640777 3300048905 Bacteria 986
231 Ga0496104_0070652 3300048907 Bacteria 3319
232 Ga0496104_0130147 3300048907 Bacteria 2417
233 Ga0496104_0300044 3300048907 Bacteria 1519
234 Ga0496104_0308282 3300048907 Bacteria 1496
235 Ga0496105_0022956 3300048908 Bacteria 5058
236 Ga0496105_0102266 3300048908 Bacteria 2366
237 Ga0496105_0161021 3300048908 Bacteria 1842
238 Ga0496105_0171793 3300048908 Bacteria 1777
239 Ga0496106_0049452 3300048909 Bacteria 3167
240 Ga0496106_0374012 3300048909 Bacteria 1145
241 Ga0496107_0062456 3300048910 Bacteria 2699
242 Ga0496107_0080815 3300048910 Bacteria 2371
243 Ga0496107_0251106 3300048910 Bacteria 1316
244 Ga0496108_0016317 3300048911 Bacteria 6058
245 Ga0496108_0049421 3300048911 Bacteria 3518
246 Ga0496108_0063759 3300048911 Bacteria 3103
247 Ga0496108_0321608 3300048911 Bacteria 1349
248 Ga0496108_0399999 3300048911 Bacteria 1199
249 Ga0496109_0002952 3300048912 Bacteria 14230
250 Ga0496109_0022457 3300048912 Bacteria 5588
251 Ga0496109_0072890 3300048912 Bacteria 3155
252 Ga0496109_0088058 3300048912 Bacteria 2869
253 Ga0496109_0299727 3300048912 Bacteria 1515
254 Ga0496109_0458591 3300048912 Bacteria 1204
255 Ga0496110_0002809 3300048913 Bacteria 13142
256 Ga0496110_0093284 3300048913 Bacteria 2695
257 Ga0496110_0453775 3300048913 Unclassified 1168
258 Ga0496110_0583837 3300048913 Bacteria 1014
259 Ga0496111_0018518 3300048914 Bacteria 4825
260 Ga0496111_0086481 3300048914 Bacteria 2294
261 Ga0496111_0105673 3300048914 Bacteria 2072
262 Ga0496111_0543076 3300048914 Bacteria 854
263 Ga0496112_0055891 3300048915 Bacteria 3883
264 Ga0496112_0105925 3300048915 Bacteria 2782
265 Ga0496112_0124956 3300048915 Bacteria 2543
266 Ga0496112_0169251 3300048915 Bacteria 2151
267 Ga0496112_0281584 3300048915 Bacteria 1610
268 Ga0496112_0455866 3300048915 Bacteria 1216
269 Ga0496112_0507247 3300048915 Bacteria 1141
270 Ga0496113_0037193 3300048916 Bacteria 3570
271 Ga0496113_0053887 3300048916 Bacteria 3008
272 Ga0496113_0068740 3300048916 Bacteria 2688
273 Ga0496113_0197471 3300048916 Bacteria 1598
274 Ga0496113_0607211 3300048916 Bacteria 876
275 Ga0496114_0000182 3300048917 Bacteria 45024
276 Ga0496114_0148272 3300048917 Bacteria 2035
277 Ga0496114_0210818 3300048917 Bacteria 1704
278 Ga0496114_0460140 3300048917 Bacteria 1126
279 Ga0501031_0057490 3300049568 Bacteria 2535
280 Ga0501036_0109315 3300049572 Bacteria 2336
281 Ga0501038_0265413 3300049574 Unclassified 1355
282 Ga0501039_0233925 3300049575 Bacteria 1445
283 Ga0501041_0089802 3300049577 Bacteria 1897
284 Ga0501046_0271084 3300049580 Bacteria 1245
285 Ga0501048_0119655 3300049582 Bacteria 1861
286 Ga0501048_0176895 3300049582 Unclassified 1512
287 Ga0501071_0239743 3300049587 Bacteria 1367
288 Ga0501071_0375621 3300049587 Unclassified 1083
289 Ga0501072_0121209 3300049588 Bacteria 2083
290 Ga0501072_0244090 3300049588 Bacteria 1431
291 Ga0501072_0470098 3300049588 Bacteria 995
292 Ga0501073_0043781 3300049589 Bacteria 3156
293 Ga0501073_0342072 3300049589 Bacteria 1033
294 Ga0501074_0193247 3300049590 Bacteria 1451
295 Ga0501075_0039288 3300049591 Bacteria 3542
296 Ga0501076_0053376 3300049592 Bacteria 3203
297 Ga0501076_0144448 3300049592 Bacteria 1934
298 Ga0501076_0191599 3300049592 Bacteria 1668
299 Ga0501077_0024623 3300049593 Bacteria 3822
300 Ga0501079_0102336 3300049741 Bacteria 2221
301 Ga0501079_0120972 3300049741 Bacteria 2036
302 Ga0501079_0366771 3300049741 Bacteria 1129
303 Ga0501080_0069425 3300049742 Bacteria 3277
304 Ga0501080_0294226 3300049742 Bacteria 1474
305 Ga0501081_0020211 3300049743 Bacteria 4437
306 Ga0501081_0127929 3300049743 Bacteria 1813
307 Ga0501081_0610183 3300049743 Bacteria 817
308 Ga0501083_0245012 3300049744 Bacteria 1167
309 Ga0501045_0079691 3300049824 Bacteria 2414
310 nmdc:mga0yw44_223974_c1 3300050492 Bacteria 1247
311 nmdc:mga08y16_42469_c1 3300050511 Bacteria 4762
312 nmdc:mga0n895_107127_c1 3300050512 Bacteria 2808
313 nmdc:mga0n895_485748_c1 3300050512 Bacteria 1245
314 nmdc:mga0a205_15749_c1 3300050515 Bacteria 7068
315 nmdc:mga0a205_69373_c1 3300050515 Bacteria 3403
316 Ga0495601_0011316 3300053077 Bacteria 5332
317 Ga0495601_0048502 3300053077 Bacteria 2674
318 Ga0495595_0078310 3300053084 Bacteria 1571
319 Ga0495619_0003249 3300053085 Bacteria 10524
320 Ga0495619_0005728 3300053085 Bacteria 7876
321 Ga0501084_0014627 3300054114 Bacteria 6505
322 Ga0501084_0108299 3300054114 Bacteria 2334
323 Ga0501084_0331051 3300054114 Bacteria 1286
324 Ga0530510_0250552 3300061734 Bacteria 1320
325 Ga0530510_0266424 3300061734 Bacteria 1278
326 Ga0373937_0029399
327 rootL2_10227939
328 rootH1_10181931
329 Ga0070683_100078926
330 Ga0070683_100088657
331 Ga0070683_100584982
332 Ga0070690_100014925
333 Ga0070670_100038292
334 Ga0070682_100025040
335 Ga0068868_100570411
336 Ga0070660_100018960
337 Ga0070687_100006357
338 Ga0070661_100101997
339 Ga0070668_100108200
340 Ga0070675_100017044
341 Ga0070675_100117644
342 Ga0070688_100014004
343 Ga0070659_100116575
344 Ga0070659_100549114
345 Ga0070703_10023518
346 Ga0070710_10139121
347 Ga0070701_10154331
348 Ga0070705_100017393
349 Ga0070705_100021300
350 Ga0070705_100040323
351 Ga0070705_100143671
352 Ga0070694_100203265
353 Ga0070694_100321755
354 Ga0070708_100006608
355 Ga0070708_100013886
356 Ga0070708_100046252
357 Ga0070708_100313063
358 Ga0070663_100362846
359 Ga0070678_100159120
360 Ga0070678_100374729
361 Ga0070678_100476035
362 Ga0070662_100103256
363 Ga0070681_10104368
364 Ga0070681_10182167
365 Ga0068867_100169999
366 Ga0070706_100014595
367 Ga0070706_100021681
368 Ga0070706_100111432
369 Ga0070707_100000943
370 Ga0070698_100156350
371 Ga0070698_100229391
372 Ga0070698_100313050
373 Ga0070679_100127736
374 Ga0070684_100059550
375 Ga0070684_100250608
376 Ga0070684_100351393
377 Ga0070697_100165402
378 Ga0068853_100082674
379 Ga0070672_100210226
380 Ga0070686_100088431
381 Ga0070686_100115112
382 Ga0070686_100133238
383 Ga0070686_100232746
384 Ga0070695_100004749
385 Ga0070695_100012093
386 Ga0070695_100027538
387 Ga0070695_100046571
388 Ga0070696_100007870
389 Ga0070696_100040961
390 Ga0070693_100016639
391 Ga0070693_100125971
392 Ga0070704_100054343
393 Ga0070704_100073443
394 Ga0070704_100591942
395 Ga0070664_100275828
396 Ga0068854_100095670
397 Ga0068856_100175386
398 Ga0068856_100489396
399 Ga0068852_100030449
400 Ga0068859_100077820
401 Ga0068864_100010897
402 Ga0068864_100040429
403 Ga0068870_10101831
404 Ga0068863_100198607
405 Ga0068863_100255887
406 Ga0068858_100344884
407 Ga0068858_100378122
408 Ga0068860_100363315
409 Ga0097621_100241242
410 Ga0075433_10046127
411 Ga0097620_100077822
412 Ga0111539_10022476
413 Ga0105245_10595937
414 Ga0105247_10326565
415 Ga0114129_10278248
416 Ga0105238_10065507
417 Ga0105249_10018579
418 Ga0105249_10044647
419 Ga0105239_10305772
420 Ga0105239_10978195
421 Ga0105246_10245922
422 Ga0105246_10318777
423 Ga0157373_10221880
424 Ga0157371_10224597
425 Ga0157378_10009909
426 Ga0163162_10109630
427 Ga0163162_10829971
428 Ga0157375_10162308
429 Ga0157375_10169137
430 Ga0163163_10007948
431 Ga0163163_10014718
432 Ga0163163_10016761
433 Ga0163163_10184335
434 Ga0163163_10345111
435 Ga0157380_10003141
436 Ga0157377_10143543
437 Ga0157379_10037687
438 Ga0157379_10097096
439 Ga0157379_10273167
440 Ga0157379_10387152
441 Ga0157376_10309845
442 Ga0157376_10503226
443 Ga0163161_10014379
444 Ga0207653_10036167
445 Ga0207642_10009058
446 Ga0207688_10108476
447 Ga0207680_10326296
448 Ga0207647_10099401
449 Ga0207645_10036759
450 Ga0207643_10101913
451 Ga0207684_10004612
452 Ga0207684_10010271
453 Ga0207684_10139640
454 Ga0207660_10000001
455 Ga0207662_10010657
456 Ga0207662_10170301
457 Ga0207657_10037372
458 Ga0207652_10172693
459 Ga0207646_10001453
460 Ga0207646_10004018
461 Ga0207681_10085488
462 Ga0207659_10552421
463 Ga0207659_10671237
464 Ga0207687_10465326
465 Ga0207690_10007218
466 Ga0207690_10279161
467 Ga0207706_10008390
468 Ga0207686_10308951
469 Ga0207709_10035615
470 Ga0207704_10265024
471 Ga0207689_10018832
472 Ga0207689_10063426
473 Ga0207661_10055110
474 Ga0207712_10235031
475 Ga0207668_10016833
476 Ga0207640_10073783
477 Ga0207703_10630678
478 Ga0207639_10168593
479 Ga0207678_10100232
480 Ga0207678_10183107
481 Ga0207708_10042374
482 Ga0207702_10202348
483 Ga0207702_10231652
484 Ga0207641_10298438
485 Ga0207648_10061440
486 Ga0207648_10383744
487 Ga0207676_10011172
488 Ga0207674_10133080
489 Ga0207683_10166653
490 Ga0207683_10397208
491 Ga0210000_1011549
492 Ga0210002_1009926
493 Ga0209971_1012276
494 Ga0209998_10006467
495 Ga0207428_10067892
496 Ga0268264_10324578
497 Ga0265334_10066796
498 Ga0265334_10085204
499 Ga0265318_10024730
500 Ga0265322_10032924
501 Ga0265330_10009485
502 Ga0265330_10050267
503 Ga0265329_10020039
504 Ga0265339_10025554
505 Ga0265316_10004616
506 Ga0265316_10036524
507 Ga0265316_10496825
508 Ga0265342_10025806
509 Ga0316578_10017932
510 Ga0307405_10598237
511 Ga0307412_10279525
512 Ga0307409_100213425
513 Ga0307415_100265781
514 Ga0373939_0053546
515 Ga0373960_0068707
516 Ga0373943_0112698
517 Ga0316574_0137944
518 Ga0373937_0054504
519 Ga0316582_0049890
520 Ga0451853_0849906
521 Ga0451853_3329351
522 Ga0450917_004814
523 Ga0453684_0452321
524 Ga0495592_0058771
525 Ga0495641_0057561
526 Ga0495582_0055315
527 Ga0495662_0140214
528 Ga0495608_0049769
529 Ga0495618_0209294
530 Ga0495618_0254910
531 Ga0495628_0029669
532 Ga0495652_0101608
533 Ga0495652_0449561
534 Ga0495645_0102340
535 Ga0495667_0071051
536 Ga0495656_0215030
537 Ga0495656_0262327
538 Ga0495634_0194921
539 Ga0495658_0172498
540 Ga0495658_0212221
541 Ga0495613_0291323
542 Ga0495624_0163966
543 Ga0495674_0011648
544 Ga0495674_0026816
545 Ga0495680_0038124
546 Ga0495684_0073234
547 Ga0495602_0200101
548 Ga0496100_0075827
549 Ga0496100_0251371
550 Ga0496101_0057254
551 Ga0496102_0022291
552 Ga0496102_0190390
553 Ga0496102_0248401
554 Ga0496102_0317439
555 Ga0496102_0640777
556 Ga0496104_0070652
557 Ga0496104_0130147
558 Ga0496104_0300044
559 Ga0496104_0308282
560 Ga0496105_0022956
561 Ga0496105_0102266
562 Ga0496105_0161021
563 Ga0496105_0171793
564 Ga0496106_0049452
565 Ga0496106_0374012
566 Ga0496107_0062456
567 Ga0496107_0080815
568 Ga0496107_0251106
569 Ga0496108_0016317
570 Ga0496108_0049421
571 Ga0496108_0063759
572 Ga0496108_0321608
573 Ga0496108_0399999
574 Ga0496109_0002952
575 Ga0496109_0022457
576 Ga0496109_0072890
577 Ga0496109_0088058
578 Ga0496109_0299727
579 Ga0496109_0458591
580 Ga0496110_0002809
581 Ga0496110_0093284
582 Ga0496110_0453775
583 Ga0496110_0583837
584 Ga0496111_0018518
585 Ga0496111_0086481
586 Ga0496111_0105673
587 Ga0496111_0543076
588 Ga0496112_0055891
589 Ga0496112_0105925
590 Ga0496112_0124956
591 Ga0496112_0169251
592 Ga0496112_0281584
593 Ga0496112_0455866
594 Ga0496112_0507247
595 Ga0496113_0037193
596 Ga0496113_0053887
597 Ga0496113_0068740
598 Ga0496113_0197471
599 Ga0496113_0607211
600 Ga0496114_0000182
601 Ga0496114_0148272
602 Ga0496114_0210818
603 Ga0496114_0460140
604 Ga0501031_0057490
605 Ga0501036_0109315
606 Ga0501038_0265413
607 Ga0501039_0233925
608 Ga0501041_0089802
609 Ga0501046_0271084
610 Ga0501048_0119655
611 Ga0501048_0176895
612 Ga0501071_0239743
613 Ga0501071_0375621
614 Ga0501072_0121209
615 Ga0501072_0244090
616 Ga0501072_0470098
617 Ga0501073_0043781
618 Ga0501073_0342072
619 Ga0501074_0193247
620 Ga0501075_0039288
621 Ga0501076_0053376
622 Ga0501076_0144448
623 Ga0501076_0191599
624 Ga0501077_0024623
625 Ga0501079_0102336
626 Ga0501079_0120972
627 Ga0501079_0366771
628 Ga0501080_0069425
629 Ga0501080_0294226
630 Ga0501081_0020211
631 Ga0501081_0127929
632 Ga0501081_0610183
633 Ga0501083_0245012
634 Ga0501045_0079691
635 nmdc:mga0yw44_223974_c1
636 nmdc:mga08y16_42469_c1
637 nmdc:mga0n895_107127_c1
638 nmdc:mga0n895_485748_c1
639 nmdc:mga0a205_15749_c1
640 nmdc:mga0a205_69373_c1
641 Ga0495601_0011316
642 Ga0495601_0048502
643 Ga0495595_0078310
644 Ga0495619_0003249
645 Ga0495619_0005728
646 Ga0501084_0014627
647 Ga0501084_0108299
648 Ga0501084_0331051
649 Ga0530510_0250552
650 Ga0530510_0266424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01895

PhoU

PhoU domain

29

116

0.98

PF01895

PhoU

PhoU domain

126

211

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t72-assembly1.cif.gz_A crystal structure of phosphate transport system protein phou from aquifex aeolicus 0.9637 12 226
2i0m-assembly1.cif.gz_A crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae 0.963 20 229
1sum-assembly1.cif.gz_B crystal structure of a hypothetical protein at 2.0 a resolution 0.9613 18 227
4q25-assembly1.cif.gz_B crystal structure of phou from pseudomonas aeruginosa 0.96 21 226
1t72-assembly1.cif.gz_A crystal structure of phosphate transport system protein phou from aquifex aeolicus 0.9593 12 226
ID Description Score Start End Superfamily
af_P0A9K7_1_117_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9883 17 119 1.20.58.220
2i0mA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9743 20 121 1.20.58.220
af_P0A9K7_118_229_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9705 136 227 1.20.58.220
1t8bB01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9664 19 128 1.20.58.220
1t8bA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9663 19 128 1.20.58.220
ID Description Score Start End GO Terms
AF-A0A3D5CM63-F1-model_v4 Phosphate transport system regulatory protein PhoU 0.9931 16 113 GO:0030643
GO:0045936
AF-W7PN02-F1-model_v4 PhoU domain-containing protein 0.9839 17 124 GO:0006817
GO:0030643
GO:0045936
AF-A0A533ZN98-F1-model_v4 Phosphate signaling complex protein PhoU 0.9837 17 122 GO:0030643
GO:0045936
AF-A0A536P5D1-F1-model_v4 Phosphate-specific transport system accessory protein PhoU 0.9829 16 230 GO:0005737
GO:0006817
GO:0030643
GO:0045936
AF-A0A177E7E5-F1-model_v4 PhoU domain-containing protein 0.9816 19 124 GO:0030643
GO:0045936

Map