F407866

General Info

Members Datasets Scaffolds Average Seq Length
325 185 650 395

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10095494|Ga0207657_100954942
Length 464
Sequence VKILWVKSDFLHPTTKGGQIRTLEMLRRLRLRHKVHYVAFVGSDSDEALRRSSEYCEQTYPIAHRIPSHRSLRFAWQLVQGLISKLPVAVARYRSAAMRRMLDELLKTEQFDIVVCDFPIPAVNLRQPQTYILFQHNVETIIWRRHAETAKSPLRRAYFQQQARKMLAYEQSVCRTAQHVIAVSELDARLMREMFGLPEVSYVDTGVDIAHFAPQPSPPKADLVFVGSMDWLPNIDGVQYFVRSVLPFIRQTRPDCSLTVVGRDPSPEILALAAADARIKVTGTVPDVRPYLWGSAVSIVPLRIGGGTRLKIYESMAARTAVVSTTTGAEGLIIDPPHNIRIADSPEDFAAQCIELLQNEDARQQQVESAWQMVALRFSWDVIARQFEEILERHSDPRSSALHAGTTPATFTYTYGVKLVASSQLSAYQIVRTPRYAGWSVTTPASDASRTASCTTALVVEWSL

Samples

Sample ID Description Type Environment
1 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
174 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 0.92
Rhizosphere 93.85
Stem 0
Stem Tuber 0
Unclassified 16.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207657_10095494 3300025919 Bacteria 2474
2 JGI25406J46586_10015100 3300003203 Bacteria 3265
3 Ga0070683_100001557 3300005329 Bacteria 17731
4 Ga0070683_100003270 3300005329 Bacteria 13104
5 Ga0070683_100009993 3300005329 Bacteria 8137
6 Ga0070690_100002732 3300005330 Bacteria 9525
7 Ga0070670_100001843 3300005331 Bacteria 17271
8 Ga0068869_100000555 3300005334 Bacteria 20907
9 Ga0070666_10003986 3300005335 Bacteria 8959
10 Ga0070666_10011368 3300005335 Bacteria 5584
11 Ga0070680_100001274 3300005336 Bacteria 18220
12 Ga0070680_100008631 3300005336 Bacteria 7811
13 Ga0070680_100117085 3300005336 Unclassified 2222
14 Ga0070680_100234826 3300005336 Unclassified 1549
15 Ga0070682_100003851 3300005337 Bacteria 8328
16 Ga0070660_100003635 3300005339 Bacteria 10651
17 Ga0070660_100018919 3300005339 Bacteria 5042
18 Ga0070660_100120093 3300005339 Unclassified 2097
19 Ga0070689_100009112 3300005340 Bacteria 7026
20 Ga0070689_100222007 3300005340 Bacteria 1550
21 Ga0070661_100001356 3300005344 Bacteria 17110
22 Ga0070661_100179741 3300005344 Unclassified 1609
23 Ga0070668_100101235 3300005347 Bacteria 2283
24 Ga0070675_100000601 3300005354 Bacteria 24734
25 Ga0070671_100067583 3300005355 Bacteria 2980
26 Ga0070674_100147131 3300005356 Bacteria 1774
27 Ga0070688_100069105 3300005365 Bacteria 2254
28 Ga0070659_100001951 3300005366 Bacteria 14732
29 Ga0070659_100044880 3300005366 Unclassified 3462
30 Ga0070659_100105299 3300005366 Unclassified 2273
31 Ga0070659_100183401 3300005366 Unclassified 1718
32 Ga0070667_100011458 3300005367 Bacteria 7332
33 Ga0070714_100002732 3300005435 Bacteria 13002
34 Ga0070714_100084955 3300005435 Bacteria 2763
35 Ga0070714_100089442 3300005435 Unclassified 2696
36 Ga0070713_100000620 3300005436 Bacteria 22654
37 Ga0070713_100003855 3300005436 Bacteria 9930
38 Ga0070713_100064901 3300005436 Bacteria 3065
39 Ga0070711_100006094 3300005439 Bacteria 7248
40 Ga0070705_100070586 3300005440 Bacteria 2110
41 Ga0070694_100003234 3300005444 Bacteria 9726
42 Ga0070694_100078619 3300005444 Bacteria 2288
43 Ga0070663_100151364 3300005455 Bacteria 1779
44 Ga0070678_100157051 3300005456 Bacteria 1838
45 Ga0070662_100005042 3300005457 Bacteria 8404
46 Ga0070681_10006677 3300005458 Bacteria 11226
47 Ga0070681_10014475 3300005458 Bacteria 7849
48 Ga0070681_10065760 3300005458 Unclassified 3595
49 Ga0070681_10105353 3300005458 Bacteria 2762
50 Ga0068867_100034022 3300005459 Bacteria 3693
51 Ga0068867_100132724 3300005459 Unclassified 1937
52 Ga0070679_100000828 3300005530 Bacteria 26863
53 Ga0070684_100002143 3300005535 Bacteria 14565
54 Ga0070684_100002524 3300005535 Bacteria 13501
55 Ga0070684_100002687 3300005535 Bacteria 13131
56 Ga0070697_100146608 3300005536 Unclassified 1987
57 Ga0068853_100021719 3300005539 Bacteria 5355
58 Ga0070672_100142313 3300005543 Bacteria 1979
59 Ga0070695_100054850 3300005545 Bacteria 2567
60 Ga0070693_100000139 3300005547 Bacteria 32966
61 Ga0070693_100093526 3300005547 Bacteria 1817
62 Ga0070665_100062085 3300005548 Bacteria 3747
63 Ga0070665_100263993 3300005548 Bacteria 1723
64 Ga0068855_100001389 3300005563 Bacteria 29989
65 Ga0068855_100022208 3300005563 Bacteria 7605
66 Ga0068855_100023385 3300005563 Bacteria 7401
67 Ga0068855_100045460 3300005563 Bacteria 5194
68 Ga0070664_100014152 3300005564 Bacteria 6507
69 Ga0070664_100023626 3300005564 Bacteria 5078
70 Ga0070664_100031906 3300005564 Bacteria 4405
71 Ga0068857_100002961 3300005577 Bacteria 13985
72 Ga0068857_100024602 3300005577 Bacteria 5302
73 Ga0068857_100125516 3300005577 Bacteria 2312
74 Ga0068857_100138424 3300005577 Unclassified 2199
75 Ga0068856_100004994 3300005614 Bacteria 13135
76 Ga0068856_100019284 3300005614 Bacteria 6621
77 Ga0070702_100000159 3300005615 Bacteria 21359
78 Ga0068852_100003501 3300005616 Bacteria 10979
79 Ga0068852_100012459 3300005616 Bacteria 6458
80 Ga0068859_100003744 3300005617 Bacteria 15503
81 Ga0068859_100007776 3300005617 Bacteria 10885
82 Ga0068859_100014140 3300005617 Bacteria 8005
83 Ga0068864_100005924 3300005618 Bacteria 10020
84 Ga0068861_100060225 3300005719 Bacteria 2909
85 Ga0068870_10004946 3300005840 Bacteria 5775
86 Ga0068863_100001014 3300005841 Bacteria 28119
87 Ga0068858_100007135 3300005842 Bacteria 10853
88 Ga0068860_100002177 3300005843 Bacteria 20607
89 Ga0068860_100032623 3300005843 Bacteria 5002
90 Ga0068860_100066744 3300005843 Bacteria 3418
91 Ga0081455_10012239 3300005937 Bacteria 8566
92 Ga0081539_10000582 3300005985 Bacteria 75018
93 Ga0070717_10007093 3300006028 Bacteria 8301
94 Ga0070717_10163374 3300006028 Bacteria 1933
95 Ga0097621_100003673 3300006237 Bacteria 10609
96 Ga0068871_100001446 3300006358 Bacteria 15886
97 Ga0068871_100082479 3300006358 Unclassified 2666
98 Ga0075430_100001170 3300006846 Bacteria 21003
99 Ga0075431_100023858 3300006847 Bacteria 6261
100 Ga0075433_10155158 3300006852 Bacteria 2037
101 Ga0068865_100000915 3300006881 Bacteria 16733
102 Ga0068865_100025031 3300006881 Bacteria 3922
103 Ga0097620_100003744 3300006931 Bacteria 15503
104 Ga0097620_100007775 3300006931 Bacteria 10885
105 Ga0097620_100014140 3300006931 Bacteria 8005
106 Ga0105240_10000057 3300009093 Bacteria 222664
107 Ga0105240_10028286 3300009093 Bacteria 7323
108 Ga0105240_10205290 3300009093 Unclassified 2307
109 Ga0105240_10427828 3300009093 Bacteria 1486
110 Ga0105245_10002834 3300009098 Bacteria 15582
111 Ga0105245_10004924 3300009098 Bacteria 11747
112 Ga0105245_10042920 3300009098 Unclassified 4034
113 Ga0105245_10318627 3300009098 Unclassified 1531
114 Ga0105247_10039271 3300009101 Bacteria 2892
115 Ga0114129_10014537 3300009147 Bacteria 11217
116 Ga0105241_10000629 3300009174 Bacteria 26542
117 Ga0105241_10005309 3300009174 Bacteria 9515
118 Ga0105241_10201299 3300009174 Unclassified 1663
119 Ga0105242_10001806 3300009176 Bacteria 16868
120 Ga0105242_10036523 3300009176 Bacteria 3943
121 Ga0105242_10115344 3300009176 Unclassified 2296
122 Ga0105248_10000606 3300009177 Bacteria 40835
123 Ga0105248_10000891 3300009177 Bacteria 33401
124 Ga0105248_10011241 3300009177 Bacteria 9872
125 Ga0105237_10004021 3300009545 Bacteria 17181
126 Ga0105237_10017789 3300009545 Bacteria 7370
127 Ga0105238_10002311 3300009551 Bacteria 19189
128 Ga0105238_10039656 3300009551 Bacteria 4776
129 Ga0105249_10003850 3300009553 Bacteria 12954
130 Ga0105249_10035029 3300009553 Bacteria 4550
131 Ga0105239_10003950 3300010375 Bacteria 17964
132 Ga0105239_10004907 3300010375 Bacteria 15825
133 Ga0105239_10041581 3300010375 Bacteria 5037
134 Ga0105239_10043235 3300010375 Unclassified 4937
135 Ga0105239_10086040 3300010375 Unclassified 3465
136 Ga0105246_10000953 3300011119 Bacteria 16546
137 Ga0157373_10173675 3300013100 Bacteria 1516
138 Ga0157371_10002503 3300013102 Bacteria 17459
139 Ga0157370_10000680 3300013104 Bacteria 42288
140 Ga0157370_10100220 3300013104 Archaea 2714
141 Ga0157369_10008243 3300013105 Bacteria 11946
142 Ga0157369_10032888 3300013105 Bacteria 5700
143 Ga0157369_10047980 3300013105 Bacteria 4635
144 Ga0157369_10059752 3300013105 Bacteria 4111
145 Ga0157369_10092079 3300013105 Bacteria 3235
146 Ga0157369_10150908 3300013105 Unclassified 2456
147 Ga0157369_10180837 3300013105 Bacteria 2219
148 Ga0157374_10020962 3300013296 Bacteria 5807
149 Ga0157374_10049483 3300013296 Bacteria 3904
150 Ga0157374_10063561 3300013296 Bacteria 3462
151 Ga0157374_10171421 3300013296 Unclassified 2117
152 Ga0163162_10016079 3300013306 Bacteria 7314
153 Ga0163162_10034218 3300013306 Bacteria 5055
154 Ga0157372_10006973 3300013307 Bacteria 12031
155 Ga0157372_10012519 3300013307 Bacteria 9036
156 Ga0157372_10098260 3300013307 Bacteria 3340
157 Ga0157372_10143647 3300013307 Bacteria 2752
158 Ga0163163_10001072 3300014325 Bacteria 23239
159 Ga0163163_10001300 3300014325 Bacteria 21115
160 Ga0163163_10007213 3300014325 Bacteria 9793
161 Ga0163163_10042238 3300014325 Bacteria 4464
162 Ga0163163_10048639 3300014325 Bacteria 4171
163 Ga0157377_10002103 3300014745 Bacteria 8759
164 Ga0157379_10004831 3300014968 Bacteria 11575
165 Ga0157379_10005796 3300014968 Bacteria 10630
166 Ga0157379_10143944 3300014968 Bacteria 2149
167 Ga0157376_10006956 3300014969 Bacteria 8022
168 Ga0157376_10013970 3300014969 Bacteria 6007
169 Ga0213874_10003466 3300021377 Bacteria 3501
170 Ga0213876_10003889 3300021384 Bacteria 8439
171 Ga0213876_10019054 3300021384 Bacteria 3624
172 Ga0213875_10003008 3300021388 Bacteria 9798
173 Ga0213875_10024832 3300021388 Unclassified 2857
174 Ga0207654_10007022 3300025911 Bacteria 5672
175 Ga0207707_10023265 3300025912 Bacteria 5421
176 Ga0207707_10035919 3300025912 Bacteria 4333
177 Ga0207695_10000072 3300025913 Bacteria 312795
178 Ga0207663_10032970 3300025916 Bacteria 3081
179 Ga0207660_10006040 3300025917 Bacteria 7861
180 Ga0207660_10067174 3300025917 Unclassified 2596
181 Ga0207657_10016680 3300025919 Bacteria 7078
182 Ga0207657_10028030 3300025919 Bacteria 5147
183 Ga0207649_10006107 3300025920 Bacteria 6538
184 Ga0207652_10062983 3300025921 Unclassified 3206
185 Ga0207694_10015385 3300025924 Bacteria 5769
186 Ga0207694_10105721 3300025924 Bacteria 2235
187 Ga0207650_10039731 3300025925 Unclassified 3439
188 Ga0207659_10007930 3300025926 Bacteria 6566
189 Ga0207687_10002742 3300025927 Bacteria 11938
190 Ga0207687_10011981 3300025927 Bacteria 5670
191 Ga0207700_10014854 3300025928 Bacteria 5114
192 Ga0207700_10101945 3300025928 Unclassified 2291
193 Ga0207664_10007229 3300025929 Bacteria 7690
194 Ga0207664_10140115 3300025929 Bacteria 2045
195 Ga0207644_10063573 3300025931 Bacteria 2680
196 Ga0207690_10007923 3300025932 Bacteria 6308
197 Ga0207690_10044570 3300025932 Unclassified 2925
198 Ga0207706_10002643 3300025933 Bacteria 17455
199 Ga0207686_10028889 3300025934 Bacteria 3265
200 Ga0207686_10041073 3300025934 Unclassified 2818
201 Ga0207686_10106174 3300025934 Unclassified 1885
202 Ga0207670_10188398 3300025936 Bacteria 1559
203 Ga0207669_10110809 3300025937 Bacteria 1839
204 Ga0207704_10006985 3300025938 Bacteria 5301
205 Ga0207711_10008064 3300025941 Bacteria 8814
206 Ga0207711_10032240 3300025941 Bacteria 4430
207 Ga0207711_10041348 3300025941 Unclassified 3925
208 Ga0207689_10001564 3300025942 Bacteria 21699
209 Ga0207661_10000537 3300025944 Bacteria 24278
210 Ga0207661_10017439 3300025944 Bacteria 5315
211 Ga0207661_10019354 3300025944 Bacteria 5074
212 Ga0207661_10088801 3300025944 Unclassified 2570
213 Ga0207679_10003916 3300025945 Bacteria 9240
214 Ga0207679_10242264 3300025945 Unclassified 1528
215 Ga0207667_10007775 3300025949 Bacteria 12816
216 Ga0207667_10032213 3300025949 Bacteria 5651
217 Ga0207667_10089834 3300025949 Bacteria 3174
218 Ga0207712_10031328 3300025961 Bacteria 3581
219 Ga0207668_10099646 3300025972 Bacteria 2156
220 Ga0207658_10009024 3300025986 Bacteria 6762
221 Ga0207703_10008910 3300026035 Bacteria 7903
222 Ga0207639_10008260 3300026041 Bacteria 7132
223 Ga0207702_10022481 3300026078 Bacteria 5228
224 Ga0207702_10023109 3300026078 Bacteria 5156
225 Ga0207702_10087930 3300026078 Unclassified 2714
226 Ga0207641_10006414 3300026088 Bacteria 9913
227 Ga0207641_10088066 3300026088 Bacteria 2710
228 Ga0207648_10100837 3300026089 Unclassified 2530
229 Ga0207648_10139810 3300026089 Bacteria 2134
230 Ga0207676_10001040 3300026095 Bacteria 21193
231 Ga0207674_10000372 3300026116 Bacteria 58411
232 Ga0207674_10000451 3300026116 Bacteria 53627
233 Ga0207674_10001088 3300026116 Bacteria 35350
234 Ga0207675_100097992 3300026118 Bacteria 2761
235 Ga0207698_10024053 3300026142 Unclassified 4268
236 Ga0268266_10010057 3300028379 Bacteria 8295
237 Ga0268264_10029093 3300028381 Bacteria 4524
238 Ga0268264_10042788 3300028381 Bacteria 3750
239 Ga0268264_10075818 3300028381 Unclassified 2860
240 Ga0265338_10019615 3300028800 Bacteria 7160
241 Ga0265324_10020065 3300029957 Bacteria 2406
242 Ga0265320_10002829 3300031240 Bacteria 11927
243 Ga0265325_10011800 3300031241 Bacteria 5013
244 Ga0265316_10011590 3300031344 Bacteria 7940
245 Ga0265316_10093506 3300031344 Unclassified 2291
246 Ga0307413_10078586 3300031824 Bacteria 2106
247 Ga0373926_0020317 3300035083 Bacteria 2294
248 Ga0373934_0005267 3300035086 Unclassified 4783
249 Ga0373923_0006206 3300035111 Bacteria 4113
250 Ga0373927_0000717 3300035695 Bacteria 25359
251 Ga0373927_0004908 3300035695 Bacteria 9288
252 Ga0373937_0010171 3300036401 Bacteria 8206
253 Ga0373937_0056557 3300036401 Bacteria 3603
254 Ga0373925_0000027 3300037068 Bacteria 154706
255 Ga0373925_0066439 3300037068 Bacteria 2719
256 Ga0436364_0255232 3300037853 Bacteria 5062
257 Ga0436364_0501071 3300037853 Bacteria 8700
258 Ga0436364_1076717 3300037853 Bacteria 5357
259 Ga0436364_1133227 3300037853 Bacteria 2856
260 Ga0436364_1171999 3300037853 Bacteria 3361
261 Ga0436364_1410943 3300037853 Bacteria 26265
262 Ga0436365_0051493 3300039437 Bacteria 3995
263 Ga0436365_0617743 3300039437 Bacteria 66532
264 Ga0436365_1119105 3300039437 Bacteria 7693
265 Ga0436363_1204565 3300039450 Bacteria 7032
266 Ga0436362_0257618 3300039453 Bacteria 3045
267 Ga0466966_0096319 3300044684 Bacteria 1833
268 Ga0451576_0106704 3300045051 Unclassified 2914
269 Ga0466958_0126057 3300045836 Unclassified 1606
270 Ga0466958_0177700 3300045836 Bacteria 1350
271 Ga0495651_0101656 3300046462 Bacteria 2139
272 Ga0495580_0002265 3300046472 Bacteria 16811
273 Ga0495580_0002637 3300046472 Bacteria 15580
274 Ga0495580_0131180 3300046472 Bacteria 1738
275 Ga0495580_0145406 3300046472 Unclassified 1643
276 Ga0495662_0047601 3300046476 Bacteria 2070
277 Ga0495630_0192494 3300046517 Bacteria 1556
278 Ga0495586_0065426 3300046535 Unclassified 1982
279 Ga0495613_0025288 3300046689 Unclassified 4424
280 Ga0495613_0041180 3300046689 Unclassified 3421
281 Ga0495624_0065029 3300046690 Bacteria 2279
282 Ga0495674_0033506 3300047319 Unclassified 4652
283 Ga0495674_0108375 3300047319 Bacteria 2357
284 Ga0495674_0247144 3300047319 Unclassified 1469
285 Ga0495684_0019151 3300047471 Bacteria 5270
286 Ga0496104_0106196 3300048907 Unclassified 2691
287 Ga0496112_0075041 3300048915 Unclassified 3344
288 Ga0496113_0009861 3300048916 Bacteria 6289
289 Ga0501031_0034621 3300049568 Bacteria 3296
290 Ga0501034_0006350 3300049571 Bacteria 12735
291 Ga0501036_0002329 3300049572 Bacteria 14854
292 Ga0501037_0005824 3300049573 Bacteria 9000
293 Ga0501038_0000882 3300049574 Bacteria 26573
294 Ga0501039_0016385 3300049575 Bacteria 5678
295 Ga0501043_0001608 3300049579 Bacteria 19658
296 Ga0501046_0004163 3300049580 Bacteria 13171
297 Ga0501046_0050610 3300049580 Bacteria 3281
298 Ga0501047_0014060 3300049581 Bacteria 7606
299 Ga0501047_0188137 3300049581 Unclassified 1929
300 Ga0501048_0006001 3300049582 Bacteria 9250
301 Ga0501069_0002729 3300049585 Bacteria 9010
302 Ga0501072_0002485 3300049588 Bacteria 13810
303 Ga0501073_0007145 3300049589 Bacteria 8316
304 Ga0501073_0042542 3300049589 Bacteria 3206
305 Ga0501075_0096688 3300049591 Unclassified 2241
306 Ga0501076_0048538 3300049592 Bacteria 3355
307 Ga0501077_0012418 3300049593 Bacteria 5333
308 Ga0501243_013226 3300049675 Bacteria 1308
309 Ga0501247_004803 3300049677 Bacteria 1491
310 Ga0501079_0037531 3300049741 Bacteria 3734
311 Ga0501083_0011252 3300049744 Bacteria 6277
312 Ga0501083_0178350 3300049744 Unclassified 1388
313 Ga0501035_0020551 3300049822 Bacteria 6064
314 Ga0501035_0041769 3300049822 Bacteria 4139
315 Ga0501035_0184035 3300049822 Unclassified 1799
316 Ga0501044_0011430 3300049823 Bacteria 9618
317 Ga0501044_0013885 3300049823 Bacteria 8703
318 Ga0501044_0089085 3300049823 Bacteria 3115
319 Ga0501045_0167385 3300049824 Bacteria 1637
320 nmdc:mga05p37_20407_c1 3300050507 Bacteria 8015
321 nmdc:mga0qj67_828_c1 3300050509 Bacteria 21193
322 nmdc:mga06r32_30151_c1 3300050510 Bacteria 5089
323 Ga0500568_0001060 3300053139 Bacteria 18712
324 Ga0500616_0025823 3300053153 Unclassified 3257
325 Ga0501084_0000176 3300054114 Bacteria 50107
326 Ga0207657_10095494
327 JGI25406J46586_10015100
328 Ga0070683_100001557
329 Ga0070683_100003270
330 Ga0070683_100009993
331 Ga0070690_100002732
332 Ga0070670_100001843
333 Ga0068869_100000555
334 Ga0070666_10003986
335 Ga0070666_10011368
336 Ga0070680_100001274
337 Ga0070680_100008631
338 Ga0070680_100117085
339 Ga0070680_100234826
340 Ga0070682_100003851
341 Ga0070660_100003635
342 Ga0070660_100018919
343 Ga0070660_100120093
344 Ga0070689_100009112
345 Ga0070689_100222007
346 Ga0070661_100001356
347 Ga0070661_100179741
348 Ga0070668_100101235
349 Ga0070675_100000601
350 Ga0070671_100067583
351 Ga0070674_100147131
352 Ga0070688_100069105
353 Ga0070659_100001951
354 Ga0070659_100044880
355 Ga0070659_100105299
356 Ga0070659_100183401
357 Ga0070667_100011458
358 Ga0070714_100002732
359 Ga0070714_100084955
360 Ga0070714_100089442
361 Ga0070713_100000620
362 Ga0070713_100003855
363 Ga0070713_100064901
364 Ga0070711_100006094
365 Ga0070705_100070586
366 Ga0070694_100003234
367 Ga0070694_100078619
368 Ga0070663_100151364
369 Ga0070678_100157051
370 Ga0070662_100005042
371 Ga0070681_10006677
372 Ga0070681_10014475
373 Ga0070681_10065760
374 Ga0070681_10105353
375 Ga0068867_100034022
376 Ga0068867_100132724
377 Ga0070679_100000828
378 Ga0070684_100002143
379 Ga0070684_100002524
380 Ga0070684_100002687
381 Ga0070697_100146608
382 Ga0068853_100021719
383 Ga0070672_100142313
384 Ga0070695_100054850
385 Ga0070693_100000139
386 Ga0070693_100093526
387 Ga0070665_100062085
388 Ga0070665_100263993
389 Ga0068855_100001389
390 Ga0068855_100022208
391 Ga0068855_100023385
392 Ga0068855_100045460
393 Ga0070664_100014152
394 Ga0070664_100023626
395 Ga0070664_100031906
396 Ga0068857_100002961
397 Ga0068857_100024602
398 Ga0068857_100125516
399 Ga0068857_100138424
400 Ga0068856_100004994
401 Ga0068856_100019284
402 Ga0070702_100000159
403 Ga0068852_100003501
404 Ga0068852_100012459
405 Ga0068859_100003744
406 Ga0068859_100007776
407 Ga0068859_100014140
408 Ga0068864_100005924
409 Ga0068861_100060225
410 Ga0068870_10004946
411 Ga0068863_100001014
412 Ga0068858_100007135
413 Ga0068860_100002177
414 Ga0068860_100032623
415 Ga0068860_100066744
416 Ga0081455_10012239
417 Ga0081539_10000582
418 Ga0070717_10007093
419 Ga0070717_10163374
420 Ga0097621_100003673
421 Ga0068871_100001446
422 Ga0068871_100082479
423 Ga0075430_100001170
424 Ga0075431_100023858
425 Ga0075433_10155158
426 Ga0068865_100000915
427 Ga0068865_100025031
428 Ga0097620_100003744
429 Ga0097620_100007775
430 Ga0097620_100014140
431 Ga0105240_10000057
432 Ga0105240_10028286
433 Ga0105240_10205290
434 Ga0105240_10427828
435 Ga0105245_10002834
436 Ga0105245_10004924
437 Ga0105245_10042920
438 Ga0105245_10318627
439 Ga0105247_10039271
440 Ga0114129_10014537
441 Ga0105241_10000629
442 Ga0105241_10005309
443 Ga0105241_10201299
444 Ga0105242_10001806
445 Ga0105242_10036523
446 Ga0105242_10115344
447 Ga0105248_10000606
448 Ga0105248_10000891
449 Ga0105248_10011241
450 Ga0105237_10004021
451 Ga0105237_10017789
452 Ga0105238_10002311
453 Ga0105238_10039656
454 Ga0105249_10003850
455 Ga0105249_10035029
456 Ga0105239_10003950
457 Ga0105239_10004907
458 Ga0105239_10041581
459 Ga0105239_10043235
460 Ga0105239_10086040
461 Ga0105246_10000953
462 Ga0157373_10173675
463 Ga0157371_10002503
464 Ga0157370_10000680
465 Ga0157370_10100220
466 Ga0157369_10008243
467 Ga0157369_10032888
468 Ga0157369_10047980
469 Ga0157369_10059752
470 Ga0157369_10092079
471 Ga0157369_10150908
472 Ga0157369_10180837
473 Ga0157374_10020962
474 Ga0157374_10049483
475 Ga0157374_10063561
476 Ga0157374_10171421
477 Ga0163162_10016079
478 Ga0163162_10034218
479 Ga0157372_10006973
480 Ga0157372_10012519
481 Ga0157372_10098260
482 Ga0157372_10143647
483 Ga0163163_10001072
484 Ga0163163_10001300
485 Ga0163163_10007213
486 Ga0163163_10042238
487 Ga0163163_10048639
488 Ga0157377_10002103
489 Ga0157379_10004831
490 Ga0157379_10005796
491 Ga0157379_10143944
492 Ga0157376_10006956
493 Ga0157376_10013970
494 Ga0213874_10003466
495 Ga0213876_10003889
496 Ga0213876_10019054
497 Ga0213875_10003008
498 Ga0213875_10024832
499 Ga0207654_10007022
500 Ga0207707_10023265
501 Ga0207707_10035919
502 Ga0207695_10000072
503 Ga0207663_10032970
504 Ga0207660_10006040
505 Ga0207660_10067174
506 Ga0207657_10016680
507 Ga0207657_10028030
508 Ga0207649_10006107
509 Ga0207652_10062983
510 Ga0207694_10015385
511 Ga0207694_10105721
512 Ga0207650_10039731
513 Ga0207659_10007930
514 Ga0207687_10002742
515 Ga0207687_10011981
516 Ga0207700_10014854
517 Ga0207700_10101945
518 Ga0207664_10007229
519 Ga0207664_10140115
520 Ga0207644_10063573
521 Ga0207690_10007923
522 Ga0207690_10044570
523 Ga0207706_10002643
524 Ga0207686_10028889
525 Ga0207686_10041073
526 Ga0207686_10106174
527 Ga0207670_10188398
528 Ga0207669_10110809
529 Ga0207704_10006985
530 Ga0207711_10008064
531 Ga0207711_10032240
532 Ga0207711_10041348
533 Ga0207689_10001564
534 Ga0207661_10000537
535 Ga0207661_10017439
536 Ga0207661_10019354
537 Ga0207661_10088801
538 Ga0207679_10003916
539 Ga0207679_10242264
540 Ga0207667_10007775
541 Ga0207667_10032213
542 Ga0207667_10089834
543 Ga0207712_10031328
544 Ga0207668_10099646
545 Ga0207658_10009024
546 Ga0207703_10008910
547 Ga0207639_10008260
548 Ga0207702_10022481
549 Ga0207702_10023109
550 Ga0207702_10087930
551 Ga0207641_10006414
552 Ga0207641_10088066
553 Ga0207648_10100837
554 Ga0207648_10139810
555 Ga0207676_10001040
556 Ga0207674_10000372
557 Ga0207674_10000451
558 Ga0207674_10001088
559 Ga0207675_100097992
560 Ga0207698_10024053
561 Ga0268266_10010057
562 Ga0268264_10029093
563 Ga0268264_10042788
564 Ga0268264_10075818
565 Ga0265338_10019615
566 Ga0265324_10020065
567 Ga0265320_10002829
568 Ga0265325_10011800
569 Ga0265316_10011590
570 Ga0265316_10093506
571 Ga0307413_10078586
572 Ga0373926_0020317
573 Ga0373934_0005267
574 Ga0373923_0006206
575 Ga0373927_0000717
576 Ga0373927_0004908
577 Ga0373937_0010171
578 Ga0373937_0056557
579 Ga0373925_0000027
580 Ga0373925_0066439
581 Ga0436364_0255232
582 Ga0436364_0501071
583 Ga0436364_1076717
584 Ga0436364_1133227
585 Ga0436364_1171999
586 Ga0436364_1410943
587 Ga0436365_0051493
588 Ga0436365_0617743
589 Ga0436365_1119105
590 Ga0436363_1204565
591 Ga0436362_0257618
592 Ga0466966_0096319
593 Ga0451576_0106704
594 Ga0466958_0126057
595 Ga0466958_0177700
596 Ga0495651_0101656
597 Ga0495580_0002265
598 Ga0495580_0002637
599 Ga0495580_0131180
600 Ga0495580_0145406
601 Ga0495662_0047601
602 Ga0495630_0192494
603 Ga0495586_0065426
604 Ga0495613_0025288
605 Ga0495613_0041180
606 Ga0495624_0065029
607 Ga0495674_0033506
608 Ga0495674_0108375
609 Ga0495674_0247144
610 Ga0495684_0019151
611 Ga0496104_0106196
612 Ga0496112_0075041
613 Ga0496113_0009861
614 Ga0501031_0034621
615 Ga0501034_0006350
616 Ga0501036_0002329
617 Ga0501037_0005824
618 Ga0501038_0000882
619 Ga0501039_0016385
620 Ga0501043_0001608
621 Ga0501046_0004163
622 Ga0501046_0050610
623 Ga0501047_0014060
624 Ga0501047_0188137
625 Ga0501048_0006001
626 Ga0501069_0002729
627 Ga0501072_0002485
628 Ga0501073_0007145
629 Ga0501073_0042542
630 Ga0501075_0096688
631 Ga0501076_0048538
632 Ga0501077_0012418
633 Ga0501243_013226
634 Ga0501247_004803
635 Ga0501079_0037531
636 Ga0501083_0011252
637 Ga0501083_0178350
638 Ga0501035_0020551
639 Ga0501035_0041769
640 Ga0501035_0184035
641 Ga0501044_0011430
642 Ga0501044_0013885
643 Ga0501044_0089085
644 Ga0501045_0167385
645 nmdc:mga05p37_20407_c1
646 nmdc:mga0qj67_828_c1
647 nmdc:mga06r32_30151_c1
648 Ga0500568_0001060
649 Ga0500616_0025823
650 Ga0501084_0000176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

220

359

0.88

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

15

211

0.81

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

243

389

0.81

PF00534

Glycos_transf_1

Glycosyl transferases group 1

209

373

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.7442 206 380
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.7061 222 380
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.691 222 380
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.6752 206 380
2bfw-assembly1.cif.gz_A structure of the c domain of glycogen synthase from pyrococcus abyssi 0.6708 206 380
ID Description Score Start End Superfamily
af_Q4D163_355_523_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7971 224 376 3.40.50.2000
4x6lA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7586 215 392 3.40.50.2000
af_P96407_190_356_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.746 216 377 3.40.50.2000
4nc9C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7453 208 380 3.40.50.2000
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7391 216 379 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A353CAQ5-F1-model_v4 Glycosyltransferase subfamily 4-like N-terminal domain-containing protein 0.9525 1 161
AF-A0A2W0BPC7-F1-model_v4 Glycosyltransferase subfamily 4-like N-terminal domain-containing protein 0.934 1 197
AF-A0A353CAQ5-F1-model_v4 Glycosyltransferase subfamily 4-like N-terminal domain-containing protein 0.9247 1 161
AF-A0A2W0BPC7-F1-model_v4 Glycosyltransferase subfamily 4-like N-terminal domain-containing protein 0.9205 1 197
AF-A0A2V8VI98-F1-model_v4 Glycosyl transferase family 1 0.9129 230 379 GO:0005737
GO:0016757

Map