F407267

General Info

Members Datasets Scaffolds Average Seq Length
324 190 648 502

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100007207|Ga0070706_1000072074
Length 511
Sequence MSASQSEATGPDLTLGLSTDALADGKMLVGHVGEEAVLLTRRGNEFFAIGATCTHYSGPLAEGLMVQDTVRCPWHHACFSLRTGEAVRAPALSPVACWLTEVRDGSVFVREKATPTPSSRVSPTPGWPQKIVVIGXXXAGFAATEMLRRQRFQGDIVMLSDDNAPPVDRPNLSKDYLAGNAPEEWVPLREDSFYTEQGIDLRLKTTVTNIDVRAREVVLDDGSKVAYDRLLLATGAEPVRLPLPGMDLPHVHTLRTLDDCRAIIARAATTRRAVVMGASFIGLEVAASLRARSIEVHVVAPEKRPMERVLGPEMGDFVRRLHEEHGVIFHLEDTATAIDARQVTLKSGGTIDADLVVAGVGVRPRLALAEKAGVAIDRGVTVNEYLETSAPGIFAAGDIARWPDPYSGAAIRVEHWVVAGRQGQTAALNMLGGREKFDAVPFFWSQHYDVPINYVGHAETWDELAIDGEIATRDCVLRYKRNGRVLAVASIYRDADSLMAEAAMEYGAMQK

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
138 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
139 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
188 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
189 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
190 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 1.23
Rhizoplane 4.32
Rhizosphere 94.14
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100007207 3300005467 Bacteria 10449
2 Ga0070658_10001394 3300005327 Bacteria 20621
3 Ga0070658_10007498 3300005327 Bacteria 8803
4 Ga0070683_100003092 3300005329 Bacteria 13400
5 Ga0070683_100005401 3300005329 Bacteria 10667
6 Ga0070683_100056454 3300005329 Bacteria 3647
7 Ga0070690_100002506 3300005330 Bacteria 9875
8 Ga0070670_100054872 3300005331 Bacteria 3421
9 Ga0068869_100001579 3300005334 Bacteria 13546
10 Ga0068869_100008898 3300005334 Bacteria 6496
11 Ga0068869_100087375 3300005334 Bacteria 2339
12 Ga0070666_10002818 3300005335 Bacteria 10500
13 Ga0070680_100001621 3300005336 Bacteria 16449
14 Ga0070682_100003986 3300005337 Bacteria 8202
15 Ga0070682_100037352 3300005337 Bacteria 2973
16 Ga0068868_100070999 3300005338 Bacteria 2777
17 Ga0070660_100001586 3300005339 Bacteria 15633
18 Ga0070660_100005470 3300005339 Bacteria 8795
19 Ga0070689_100024664 3300005340 Bacteria 4511
20 Ga0070689_100040378 3300005340 Bacteria 3577
21 Ga0070687_100064072 3300005343 Bacteria 1951
22 Ga0070692_10013479 3300005345 Bacteria 3812
23 Ga0070669_100011350 3300005353 Bacteria 6323
24 Ga0070675_100006910 3300005354 Bacteria 8713
25 Ga0070675_100011066 3300005354 Bacteria 7062
26 Ga0070671_100016605 3300005355 Bacteria 5950
27 Ga0070671_100024835 3300005355 Bacteria 4910
28 Ga0070671_100075777 3300005355 Bacteria 2811
29 Ga0070688_100000263 3300005365 Bacteria 27426
30 Ga0070659_100002866 3300005366 Bacteria 12279
31 Ga0070659_100004711 3300005366 Bacteria 9735
32 Ga0070659_100007662 3300005366 Bacteria 7852
33 Ga0070659_100012410 3300005366 Bacteria 6318
34 Ga0070714_100004186 3300005435 Bacteria 10861
35 Ga0070714_100009775 3300005435 Bacteria 7559
36 Ga0070714_100165386 3300005435 Bacteria 2004
37 Ga0070710_10004660 3300005437 Bacteria 6485
38 Ga0070708_100004681 3300005445 Bacteria 10783
39 Ga0070678_100043913 3300005456 Bacteria 3188
40 Ga0070678_100079195 3300005456 Bacteria 2484
41 Ga0070662_100000362 3300005457 Bacteria 27141
42 Ga0070681_10014764 3300005458 Bacteria 7766
43 Ga0070681_10017637 3300005458 Bacteria 7134
44 Ga0070685_10010602 3300005466 Bacteria 4793
45 Ga0070707_100028779 3300005468 Bacteria 5288
46 Ga0070707_100105189 3300005468 Bacteria 2737
47 Ga0070699_100113740 3300005518 Bacteria 2377
48 Ga0070679_100009468 3300005530 Bacteria 9213
49 Ga0070679_100074174 3300005530 Bacteria 3393
50 Ga0070679_100127726 3300005530 Bacteria 2524
51 Ga0070684_100008235 3300005535 Bacteria 8146
52 Ga0070684_100012646 3300005535 Bacteria 6770
53 Ga0070684_100074776 3300005535 Bacteria 2987
54 Ga0068853_100023590 3300005539 Bacteria 5152
55 Ga0070672_100004186 3300005543 Bacteria 9419
56 Ga0070672_100010524 3300005543 Bacteria 6419
57 Ga0070672_100024687 3300005543 Bacteria 4447
58 Ga0070695_100014246 3300005545 Bacteria 4792
59 Ga0070665_100003480 3300005548 Bacteria 16773
60 Ga0070665_100190244 3300005548 Bacteria 2053
61 Ga0070704_100021310 3300005549 Bacteria 4200
62 Ga0068855_100001593 3300005563 Bacteria 28505
63 Ga0068855_100043328 3300005563 Bacteria 5332
64 Ga0068855_100063195 3300005563 Bacteria 4321
65 Ga0068855_100063324 3300005563 Bacteria 4315
66 Ga0070664_100009977 3300005564 Bacteria 7697
67 Ga0070664_100013818 3300005564 Bacteria 6581
68 Ga0070664_100022239 3300005564 Bacteria 5229
69 Ga0070664_100161451 3300005564 Bacteria 1983
70 Ga0068857_100028685 3300005577 Bacteria 4911
71 Ga0068857_100115820 3300005577 Bacteria 2411
72 Ga0068854_100005373 3300005578 Bacteria 8084
73 Ga0068856_100001140 3300005614 Bacteria 27921
74 Ga0068856_100009721 3300005614 Bacteria 9344
75 Ga0068856_100019648 3300005614 Bacteria 6557
76 Ga0068856_100029882 3300005614 Bacteria 5325
77 Ga0068856_100082901 3300005614 Bacteria 3183
78 Ga0070702_100000179 3300005615 Bacteria 20290
79 Ga0068852_100003164 3300005616 Bacteria 11486
80 Ga0068852_100141223 3300005616 Bacteria 2229
81 Ga0068859_100017922 3300005617 Bacteria 7117
82 Ga0068864_100006826 3300005618 Bacteria 9351
83 Ga0068864_100020833 3300005618 Bacteria 5486
84 Ga0068866_10065902 3300005718 Bacteria 1896
85 Ga0068851_10003387 3300005834 Bacteria 7093
86 Ga0068870_10013455 3300005840 Bacteria 3845
87 Ga0068863_100007787 3300005841 Bacteria 10475
88 Ga0068863_100052864 3300005841 Bacteria 3849
89 Ga0068858_100066116 3300005842 Bacteria 3347
90 Ga0068860_100018981 3300005843 Bacteria 6679
91 Ga0068860_100034204 3300005843 Bacteria 4873
92 Ga0068862_100067353 3300005844 Bacteria 3087
93 Ga0081455_10000835 3300005937 Bacteria 39661
94 Ga0081539_10051585 3300005985 Bacteria 2317
95 Ga0070716_100004376 3300006173 Bacteria 6747
96 Ga0070712_100087410 3300006175 Bacteria 2274
97 Ga0075366_10012705 3300006195 Bacteria 4783
98 Ga0097621_100007870 3300006237 Bacteria 7644
99 Ga0097621_100116081 3300006237 Bacteria 2266
100 Ga0068871_100008105 3300006358 Bacteria 7542
101 Ga0068871_100017866 3300006358 Bacteria 5377
102 Ga0068871_100100086 3300006358 Bacteria 2427
103 Ga0075428_100050851 3300006844 Bacteria 4544
104 Ga0075429_100160448 3300006880 Bacteria 1969
105 Ga0068865_100115402 3300006881 Bacteria 1987
106 Ga0075436_100011862 3300006914 Bacteria 5980
107 Ga0097620_100017921 3300006931 Bacteria 7117
108 Ga0075435_100109146 3300007076 Bacteria 2300
109 Ga0105240_10013756 3300009093 Bacteria 11089
110 Ga0105240_10021712 3300009093 Bacteria 8533
111 Ga0105240_10067713 3300009093 Bacteria 4425
112 Ga0105240_10092193 3300009093 Bacteria 3700
113 Ga0105240_10154399 3300009093 Unclassified 2731
114 Ga0105245_10000764 3300009098 Bacteria 29093
115 Ga0105245_10011047 3300009098 Bacteria 7862
116 Ga0105245_10061812 3300009098 Bacteria 3377
117 Ga0105247_10066234 3300009101 Bacteria 2249
118 Ga0105243_10065218 3300009148 Bacteria 2924
119 Ga0105243_10161661 3300009148 Bacteria 1931
120 Ga0105241_10001597 3300009174 Bacteria 17323
121 Ga0105241_10015512 3300009174 Bacteria 5585
122 Ga0105242_10017735 3300009176 Bacteria 5553
123 Ga0105242_10022854 3300009176 Bacteria 4924
124 Ga0105242_10083268 3300009176 Bacteria 2678
125 Ga0105248_10008423 3300009177 Bacteria 11317
126 Ga0105248_10010178 3300009177 Bacteria 10359
127 Ga0105248_10023990 3300009177 Bacteria 6780
128 Ga0105248_10070655 3300009177 Bacteria 3920
129 Ga0105248_10082546 3300009177 Bacteria 3614
130 Ga0105237_10047593 3300009545 Bacteria 4311
131 Ga0105238_10044563 3300009551 Bacteria 4484
132 Ga0105239_10009684 3300010375 Bacteria 10835
133 Ga0105246_10005825 3300011119 Bacteria 7514
134 Ga0105246_10035699 3300011119 Bacteria 3325
135 Ga0157373_10002754 3300013100 Bacteria 13304
136 Ga0157373_10003047 3300013100 Bacteria 12642
137 Ga0157373_10006386 3300013100 Bacteria 8808
138 Ga0157373_10058871 3300013100 Bacteria 2723
139 Ga0157371_10002716 3300013102 Bacteria 16700
140 Ga0157371_10005647 3300013102 Bacteria 10501
141 Ga0157371_10019989 3300013102 Bacteria 4930
142 Ga0157370_10013447 3300013104 Bacteria 8431
143 Ga0157369_10013860 3300013105 Bacteria 9108
144 Ga0157369_10021847 3300013105 Bacteria 7154
145 Ga0157369_10047618 3300013105 Unclassified 4653
146 Ga0157374_10035620 3300013296 Bacteria 4554
147 Ga0163162_10023597 3300013306 Bacteria 6073
148 Ga0157372_10001413 3300013307 Bacteria 25883
149 Ga0157372_10001449 3300013307 Bacteria 25677
150 Ga0157372_10005783 3300013307 Bacteria 13173
151 Ga0157372_10017549 3300013307 Bacteria 7678
152 Ga0157372_10018668 3300013307 Bacteria 7461
153 Ga0157372_10019908 3300013307 Bacteria 7233
154 Ga0157372_10050461 3300013307 Bacteria 4628
155 Ga0157372_10072622 3300013307 Bacteria 3878
156 Ga0157372_10083943 3300013307 Bacteria 3608
157 Ga0157375_10076070 3300013308 Bacteria 3383
158 Ga0157375_10099905 3300013308 Bacteria 2981
159 Ga0163163_10004363 3300014325 Bacteria 12052
160 Ga0163163_10032445 3300014325 Bacteria 5044
161 Ga0163163_10156742 3300014325 Bacteria 2321
162 Ga0163163_10157695 3300014325 Bacteria 2314
163 Ga0157377_10001121 3300014745 Bacteria 11343
164 Ga0157379_10010041 3300014968 Bacteria 8249
165 Ga0157376_10012909 3300014969 Bacteria 6216
166 Ga0157376_10058812 3300014969 Bacteria 3221
167 Ga0163161_10119130 3300017792 Bacteria 1982
168 Ga0207680_10000772 3300025903 Bacteria 15112
169 Ga0207645_10025654 3300025907 Bacteria 3813
170 Ga0207643_10004658 3300025908 Bacteria 7361
171 Ga0207705_10002831 3300025909 Bacteria 13270
172 Ga0207705_10015419 3300025909 Bacteria 5484
173 Ga0207705_10023976 3300025909 Bacteria 4354
174 Ga0207654_10011631 3300025911 Bacteria 4491
175 Ga0207707_10006805 3300025912 Bacteria 9974
176 Ga0207707_10015595 3300025912 Bacteria 6619
177 Ga0207695_10013888 3300025913 Bacteria 9574
178 Ga0207695_10086766 3300025913 Bacteria 3155
179 Ga0207693_10099999 3300025915 Bacteria 2274
180 Ga0207660_10002698 3300025917 Bacteria 11651
181 Ga0207660_10009911 3300025917 Bacteria 6173
182 Ga0207660_10033260 3300025917 Bacteria 3565
183 Ga0207662_10005758 3300025918 Bacteria 6633
184 Ga0207657_10000354 3300025919 Bacteria 48891
185 Ga0207657_10000860 3300025919 Bacteria 32022
186 Ga0207657_10014019 3300025919 Bacteria 7843
187 Ga0207657_10025614 3300025919 Bacteria 5435
188 Ga0207657_10041040 3300025919 Bacteria 4094
189 Ga0207649_10003609 3300025920 Bacteria 8454
190 Ga0207652_10006058 3300025921 Bacteria 9787
191 Ga0207652_10029275 3300025921 Bacteria 4603
192 Ga0207646_10009647 3300025922 Bacteria 9520
193 Ga0207646_10023145 3300025922 Bacteria 5709
194 Ga0207681_10097817 3300025923 Bacteria 2110
195 Ga0207694_10021232 3300025924 Bacteria 4918
196 Ga0207650_10008934 3300025925 Bacteria 6847
197 Ga0207659_10013922 3300025926 Bacteria 5173
198 Ga0207659_10015602 3300025926 Bacteria 4927
199 Ga0207659_10148144 3300025926 Bacteria 1830
200 Ga0207687_10000197 3300025927 Bacteria 40700
201 Ga0207687_10053969 3300025927 Bacteria 2810
202 Ga0207664_10016004 3300025929 Bacteria 5462
203 Ga0207664_10053470 3300025929 Bacteria 3197
204 Ga0207664_10073216 3300025929 Bacteria 2764
205 Ga0207644_10032358 3300025931 Bacteria 3648
206 Ga0207690_10003306 3300025932 Bacteria 9644
207 Ga0207690_10030627 3300025932 Bacteria 3434
208 Ga0207690_10041648 3300025932 Bacteria 3011
209 Ga0207706_10000002 3300025933 Bacteria 360309
210 Ga0207686_10019552 3300025934 Bacteria 3855
211 Ga0207686_10025206 3300025934 Bacteria 3456
212 Ga0207686_10043927 3300025934 Bacteria 2741
213 Ga0207670_10030045 3300025936 Bacteria 3469
214 Ga0207691_10005503 3300025940 Bacteria 12239
215 Ga0207691_10008989 3300025940 Bacteria 9581
216 Ga0207691_10026970 3300025940 Bacteria 5390
217 Ga0207691_10071432 3300025940 Bacteria 3132
218 Ga0207691_10143930 3300025940 Bacteria 2099
219 Ga0207711_10025470 3300025941 Bacteria 4963
220 Ga0207689_10026981 3300025942 Bacteria 4809
221 Ga0207661_10007662 3300025944 Bacteria 7681
222 Ga0207661_10028265 3300025944 Bacteria 4292
223 Ga0207661_10029734 3300025944 Bacteria 4200
224 Ga0207661_10051792 3300025944 Bacteria 3276
225 Ga0207679_10003218 3300025945 Bacteria 10071
226 Ga0207679_10135084 3300025945 Bacteria 1985
227 Ga0207667_10006226 3300025949 Bacteria 14479
228 Ga0207667_10038441 3300025949 Bacteria 5112
229 Ga0207667_10047963 3300025949 Unclassified 4518
230 Ga0207667_10051092 3300025949 Bacteria 4359
231 Ga0207667_10159236 3300025949 Bacteria 2323
232 Ga0207651_10035489 3300025960 Bacteria 3243
233 Ga0207651_10071481 3300025960 Bacteria 2460
234 Ga0207651_10122363 3300025960 Bacteria 1976
235 Ga0207640_10008351 3300025981 Bacteria 5753
236 Ga0207658_10057482 3300025986 Bacteria 2891
237 Ga0207677_10000161 3300026023 Bacteria 53405
238 Ga0207677_10071996 3300026023 Bacteria 2442
239 Ga0207639_10122486 3300026041 Bacteria 2139
240 Ga0207678_10014255 3300026067 Bacteria 6988
241 Ga0207708_10061998 3300026075 Bacteria 2856
242 Ga0207702_10004723 3300026078 Bacteria 12039
243 Ga0207702_10034449 3300026078 Bacteria 4233
244 Ga0207648_10011132 3300026089 Bacteria 8485
245 Ga0207648_10100464 3300026089 Bacteria 2534
246 Ga0207676_10001034 3300026095 Bacteria 21313
247 Ga0207676_10037920 3300026095 Bacteria 3677
248 Ga0207674_10001310 3300026116 Bacteria 32505
249 Ga0207674_10004776 3300026116 Bacteria 16248
250 Ga0207674_10024476 3300026116 Bacteria 6452
251 Ga0207674_10076649 3300026116 Bacteria 3351
252 Ga0207674_10123496 3300026116 Bacteria 2555
253 Ga0207675_100045790 3300026118 Bacteria 4086
254 Ga0207683_10063477 3300026121 Bacteria 3254
255 Ga0207698_10015719 3300026142 Bacteria 5079
256 Ga0207698_10033841 3300026142 Bacteria 3718
257 Ga0207698_10098298 3300026142 Bacteria 2418
258 Ga0268266_10014189 3300028379 Bacteria 6853
259 Ga0268265_10143778 3300028380 Bacteria 2001
260 Ga0268264_10011533 3300028381 Bacteria 7302
261 Ga0316576_10015218 3300031727 Bacteria 5158
262 Ga0316578_10000349 3300031728 Bacteria 14626
263 Ga0316577_10000101 3300031733 Bacteria 23789
264 Ga0307410_10119413 3300031852 Bacteria 1920
265 Ga0307409_100000667 3300031995 Bacteria 15227
266 Ga0307416_100006160 3300032002 Bacteria 7477
267 Ga0307415_100012104 3300032126 Bacteria 4975
268 Ga0373923_0004738 3300035111 Bacteria 4545
269 Ga0373956_0022481 3300035119 Bacteria 2699
270 Ga0373943_0006313 3300035170 Bacteria 5319
271 Ga0373924_0037874 3300035410 Bacteria 1965
272 Ga0373927_0064010 3300035695 Bacteria 2379
273 Ga0373933_0040941 3300035724 Bacteria 2732
274 Ga0373947_0019551 3300035725 Bacteria 3906
275 Ga0373937_0017182 3300036401 Bacteria 6439
276 Ga0373937_0048987 3300036401 Bacteria 3868
277 Ga0316584_0018667 3300036712 Bacteria 5005
278 Ga0373925_0016577 3300037068 Bacteria 5338
279 Ga0395898_0046620 3300037466 Bacteria 4257
280 Ga0395901_0022529 3300038443 Bacteria 6457
281 Ga0451807_2461003 3300041486 Bacteria 3360
282 Ga0466959_0057323 3300045049 Bacteria 2840
283 Ga0495592_0032476 3300046454 Bacteria 3938
284 Ga0495629_0011597 3300046459 Bacteria 6399
285 Ga0495651_0020053 3300046462 Bacteria 5188
286 Ga0495582_0002751 3300046473 Bacteria 9817
287 Ga0495664_0013315 3300046477 Bacteria 4665
288 Ga0495594_0001663 3300046499 Bacteria 11556
289 Ga0495594_0016551 3300046499 Bacteria 3886
290 Ga0495652_0001485 3300046529 Bacteria 25889
291 Ga0495587_0001012 3300046536 Bacteria 18474
292 Ga0495645_0004451 3300046543 Bacteria 9562
293 Ga0495667_0049838 3300046559 Bacteria 2764
294 Ga0495599_0029706 3300046678 Bacteria 3427
295 Ga0495623_0025484 3300046679 Bacteria 3809
296 Ga0495604_0003144 3300047317 Bacteria 13193
297 Ga0495604_0126136 3300047317 Bacteria 1845
298 Ga0495684_0009357 3300047471 Bacteria 7564
299 Ga0495602_0022477 3300048088 Bacteria 6171
300 Ga0495602_0049674 3300048088 Bacteria 3755
301 Ga0496101_0071787 3300048904 Bacteria 2539
302 Ga0496102_0006900 3300048905 Bacteria 9685
303 Ga0496104_0002779 3300048907 Bacteria 15078
304 Ga0496105_0101165 3300048908 Bacteria 2380
305 Ga0496105_0141541 3300048908 Bacteria 1980
306 Ga0496106_0001039 3300048909 Bacteria 20405
307 Ga0496109_0099398 3300048912 Bacteria 2698
308 Ga0496109_0133329 3300048912 Bacteria 2320
309 Ga0496112_0002671 3300048915 Bacteria 14418
310 Ga0496112_0011871 3300048915 Bacteria 7978
311 Ga0496112_0020004 3300048915 Bacteria 6337
312 Ga0496115_0000737 3300048918 Bacteria 24216
313 Ga0496115_0088818 3300048918 Bacteria 2524
314 Ga0501046_0013695 3300049580 Bacteria 6857
315 Ga0501047_0022694 3300049581 Bacteria 6024
316 Ga0501070_0030774 3300049586 Bacteria 4495
317 nmdc:mga0n895_295915_c1 3300050512 Bacteria 1641
318 nmdc:mga08x19_59292_c1 3300050514 Bacteria 2477
319 nmdc:mga08x19_86535_c1 3300050514 Bacteria 2064
320 Ga0495612_0007595 3300053078 Bacteria 4431
321 2922363547 2922361189 Bacteria 7436256
322 2979796128 2979793036 Bacteria 6808957
323 3004245146 3004239961 Bacteria 6892290
324 8004696955 8004695233 Bacteria 6731676
325 Ga0070706_100007207
326 Ga0070658_10001394
327 Ga0070658_10007498
328 Ga0070683_100003092
329 Ga0070683_100005401
330 Ga0070683_100056454
331 Ga0070690_100002506
332 Ga0070670_100054872
333 Ga0068869_100001579
334 Ga0068869_100008898
335 Ga0068869_100087375
336 Ga0070666_10002818
337 Ga0070680_100001621
338 Ga0070682_100003986
339 Ga0070682_100037352
340 Ga0068868_100070999
341 Ga0070660_100001586
342 Ga0070660_100005470
343 Ga0070689_100024664
344 Ga0070689_100040378
345 Ga0070687_100064072
346 Ga0070692_10013479
347 Ga0070669_100011350
348 Ga0070675_100006910
349 Ga0070675_100011066
350 Ga0070671_100016605
351 Ga0070671_100024835
352 Ga0070671_100075777
353 Ga0070688_100000263
354 Ga0070659_100002866
355 Ga0070659_100004711
356 Ga0070659_100007662
357 Ga0070659_100012410
358 Ga0070714_100004186
359 Ga0070714_100009775
360 Ga0070714_100165386
361 Ga0070710_10004660
362 Ga0070708_100004681
363 Ga0070678_100043913
364 Ga0070678_100079195
365 Ga0070662_100000362
366 Ga0070681_10014764
367 Ga0070681_10017637
368 Ga0070685_10010602
369 Ga0070707_100028779
370 Ga0070707_100105189
371 Ga0070699_100113740
372 Ga0070679_100009468
373 Ga0070679_100074174
374 Ga0070679_100127726
375 Ga0070684_100008235
376 Ga0070684_100012646
377 Ga0070684_100074776
378 Ga0068853_100023590
379 Ga0070672_100004186
380 Ga0070672_100010524
381 Ga0070672_100024687
382 Ga0070695_100014246
383 Ga0070665_100003480
384 Ga0070665_100190244
385 Ga0070704_100021310
386 Ga0068855_100001593
387 Ga0068855_100043328
388 Ga0068855_100063195
389 Ga0068855_100063324
390 Ga0070664_100009977
391 Ga0070664_100013818
392 Ga0070664_100022239
393 Ga0070664_100161451
394 Ga0068857_100028685
395 Ga0068857_100115820
396 Ga0068854_100005373
397 Ga0068856_100001140
398 Ga0068856_100009721
399 Ga0068856_100019648
400 Ga0068856_100029882
401 Ga0068856_100082901
402 Ga0070702_100000179
403 Ga0068852_100003164
404 Ga0068852_100141223
405 Ga0068859_100017922
406 Ga0068864_100006826
407 Ga0068864_100020833
408 Ga0068866_10065902
409 Ga0068851_10003387
410 Ga0068870_10013455
411 Ga0068863_100007787
412 Ga0068863_100052864
413 Ga0068858_100066116
414 Ga0068860_100018981
415 Ga0068860_100034204
416 Ga0068862_100067353
417 Ga0081455_10000835
418 Ga0081539_10051585
419 Ga0070716_100004376
420 Ga0070712_100087410
421 Ga0075366_10012705
422 Ga0097621_100007870
423 Ga0097621_100116081
424 Ga0068871_100008105
425 Ga0068871_100017866
426 Ga0068871_100100086
427 Ga0075428_100050851
428 Ga0075429_100160448
429 Ga0068865_100115402
430 Ga0075436_100011862
431 Ga0097620_100017921
432 Ga0075435_100109146
433 Ga0105240_10013756
434 Ga0105240_10021712
435 Ga0105240_10067713
436 Ga0105240_10092193
437 Ga0105240_10154399
438 Ga0105245_10000764
439 Ga0105245_10011047
440 Ga0105245_10061812
441 Ga0105247_10066234
442 Ga0105243_10065218
443 Ga0105243_10161661
444 Ga0105241_10001597
445 Ga0105241_10015512
446 Ga0105242_10017735
447 Ga0105242_10022854
448 Ga0105242_10083268
449 Ga0105248_10008423
450 Ga0105248_10010178
451 Ga0105248_10023990
452 Ga0105248_10070655
453 Ga0105248_10082546
454 Ga0105237_10047593
455 Ga0105238_10044563
456 Ga0105239_10009684
457 Ga0105246_10005825
458 Ga0105246_10035699
459 Ga0157373_10002754
460 Ga0157373_10003047
461 Ga0157373_10006386
462 Ga0157373_10058871
463 Ga0157371_10002716
464 Ga0157371_10005647
465 Ga0157371_10019989
466 Ga0157370_10013447
467 Ga0157369_10013860
468 Ga0157369_10021847
469 Ga0157369_10047618
470 Ga0157374_10035620
471 Ga0163162_10023597
472 Ga0157372_10001413
473 Ga0157372_10001449
474 Ga0157372_10005783
475 Ga0157372_10017549
476 Ga0157372_10018668
477 Ga0157372_10019908
478 Ga0157372_10050461
479 Ga0157372_10072622
480 Ga0157372_10083943
481 Ga0157375_10076070
482 Ga0157375_10099905
483 Ga0163163_10004363
484 Ga0163163_10032445
485 Ga0163163_10156742
486 Ga0163163_10157695
487 Ga0157377_10001121
488 Ga0157379_10010041
489 Ga0157376_10012909
490 Ga0157376_10058812
491 Ga0163161_10119130
492 Ga0207680_10000772
493 Ga0207645_10025654
494 Ga0207643_10004658
495 Ga0207705_10002831
496 Ga0207705_10015419
497 Ga0207705_10023976
498 Ga0207654_10011631
499 Ga0207707_10006805
500 Ga0207707_10015595
501 Ga0207695_10013888
502 Ga0207695_10086766
503 Ga0207693_10099999
504 Ga0207660_10002698
505 Ga0207660_10009911
506 Ga0207660_10033260
507 Ga0207662_10005758
508 Ga0207657_10000354
509 Ga0207657_10000860
510 Ga0207657_10014019
511 Ga0207657_10025614
512 Ga0207657_10041040
513 Ga0207649_10003609
514 Ga0207652_10006058
515 Ga0207652_10029275
516 Ga0207646_10009647
517 Ga0207646_10023145
518 Ga0207681_10097817
519 Ga0207694_10021232
520 Ga0207650_10008934
521 Ga0207659_10013922
522 Ga0207659_10015602
523 Ga0207659_10148144
524 Ga0207687_10000197
525 Ga0207687_10053969
526 Ga0207664_10016004
527 Ga0207664_10053470
528 Ga0207664_10073216
529 Ga0207644_10032358
530 Ga0207690_10003306
531 Ga0207690_10030627
532 Ga0207690_10041648
533 Ga0207706_10000002
534 Ga0207686_10019552
535 Ga0207686_10025206
536 Ga0207686_10043927
537 Ga0207670_10030045
538 Ga0207691_10005503
539 Ga0207691_10008989
540 Ga0207691_10026970
541 Ga0207691_10071432
542 Ga0207691_10143930
543 Ga0207711_10025470
544 Ga0207689_10026981
545 Ga0207661_10007662
546 Ga0207661_10028265
547 Ga0207661_10029734
548 Ga0207661_10051792
549 Ga0207679_10003218
550 Ga0207679_10135084
551 Ga0207667_10006226
552 Ga0207667_10038441
553 Ga0207667_10047963
554 Ga0207667_10051092
555 Ga0207667_10159236
556 Ga0207651_10035489
557 Ga0207651_10071481
558 Ga0207651_10122363
559 Ga0207640_10008351
560 Ga0207658_10057482
561 Ga0207677_10000161
562 Ga0207677_10071996
563 Ga0207639_10122486
564 Ga0207678_10014255
565 Ga0207708_10061998
566 Ga0207702_10004723
567 Ga0207702_10034449
568 Ga0207648_10011132
569 Ga0207648_10100464
570 Ga0207676_10001034
571 Ga0207676_10037920
572 Ga0207674_10001310
573 Ga0207674_10004776
574 Ga0207674_10024476
575 Ga0207674_10076649
576 Ga0207674_10123496
577 Ga0207675_100045790
578 Ga0207683_10063477
579 Ga0207698_10015719
580 Ga0207698_10033841
581 Ga0207698_10098298
582 Ga0268266_10014189
583 Ga0268265_10143778
584 Ga0268264_10011533
585 Ga0316576_10015218
586 Ga0316578_10000349
587 Ga0316577_10000101
588 Ga0307410_10119413
589 Ga0307409_100000667
590 Ga0307416_100006160
591 Ga0307415_100012104
592 Ga0373923_0004738
593 Ga0373956_0022481
594 Ga0373943_0006313
595 Ga0373924_0037874
596 Ga0373927_0064010
597 Ga0373933_0040941
598 Ga0373947_0019551
599 Ga0373937_0017182
600 Ga0373937_0048987
601 Ga0316584_0018667
602 Ga0373925_0016577
603 Ga0395898_0046620
604 Ga0395901_0022529
605 Ga0451807_2461003
606 Ga0466959_0057323
607 Ga0495592_0032476
608 Ga0495629_0011597
609 Ga0495651_0020053
610 Ga0495582_0002751
611 Ga0495664_0013315
612 Ga0495594_0001663
613 Ga0495594_0016551
614 Ga0495652_0001485
615 Ga0495587_0001012
616 Ga0495645_0004451
617 Ga0495667_0049838
618 Ga0495599_0029706
619 Ga0495623_0025484
620 Ga0495604_0003144
621 Ga0495604_0126136
622 Ga0495684_0009357
623 Ga0495602_0022477
624 Ga0495602_0049674
625 Ga0496101_0071787
626 Ga0496102_0006900
627 Ga0496104_0002779
628 Ga0496105_0101165
629 Ga0496105_0141541
630 Ga0496106_0001039
631 Ga0496109_0099398
632 Ga0496109_0133329
633 Ga0496112_0002671
634 Ga0496112_0011871
635 Ga0496112_0020004
636 Ga0496115_0000737
637 Ga0496115_0088818
638 Ga0501046_0013695
639 Ga0501047_0022694
640 Ga0501070_0030774
641 nmdc:mga0n895_295915_c1
642 nmdc:mga08x19_59292_c1
643 nmdc:mga08x19_86535_c1
644 Ga0495612_0007595
645 2922363547
646 2979796128
647 3004245146
648 8004696955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

272

349

0.95

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

129

423

0.94

PF14759

Reductase_C

Reductase C-terminal

442

510

0.94

PF00355

Rieske

Rieske [2Fe-2S] domain

15

99

0.93

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

17

110

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.9696 16 110
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.9566 17 115
7bui-assembly1.cif.gz_D complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase 0.9517 18 110
3fg2-assembly1.cif.gz_P crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris 0.9484 133 494
1fqt-assembly1.cif.gz_B crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase 0.948 16 109
ID Description Score Start End Superfamily
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.003 276 305 3.50.50.60
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9696 16 110 2.102.10.10
5jclB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9653 245 363 3.50.50.60
af_E7F3F1_457_541_3.30.390.30 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.961 446 510 3.30.390.30
3fg2P02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9594 243 363 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A528A336-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9834 366 510 GO:0005737
GO:0016651
AF-A0A6G1SSM7-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9791 21 109 GO:0046872
GO:0051537
AF-A0A177R154-F1-model_v4 deleted 0.9753 19 109
AF-A0A1B6LD12-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9658 208 493 GO:0005737
GO:0016651
AF-A0A1E3ZLV9-F1-model_v4 deleted 0.9648 16 111

Map