F407179

General Info

Members Datasets Scaffolds Average Seq Length
324 237 310 277

Family's Representative Sequence

Representative Sequence 3300002739|JGI25158J39367_1000234|JGI25158J39367_100023412
Length 277
Sequence MQTTGDATAQPAPDLAALKSRQQSAWASGDYSVIGARLQIVGENLCEALDLRSGEKVLDIAAGNGNATLAAARRWAEVTSTDYVPELLERGRERAIANGLAVNFQQADAEALPFKDASFDVVVSTFGVMFTPDQDKAAKEMLRVSRRGGRIGMANWTPESFIGQVFKTIGKHIPPMPGVRSPALWGTKARLEEMFGGQADIEATSRMYNFRYRSPAHWLEVFRTWYGPVYKAFEALPQPGKTALEEDFLALIARFNRAKDGTMVVPAEYLEVVIHKG

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
5 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
6 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
7 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
8 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
9 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
10 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
11 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
12 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
236 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
237 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.37
Metatranscriptomes 0.31
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.95
Nodule 2.78
Rhizoplane 0.62
Rhizosphere 84.26
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000234 3300002739 Bacteria 12906
2 JGI25152J39213_1004701 3300002773 Bacteria 4224
3 JGI25159J45721_1001732 3300002987 Bacteria 8804
4 JGI25151J46595_10000288 3300003187 Bacteria 57079
5 JGI25153J46596_10008059 3300003215 Bacteria 5087
6 JGI25160J50197_1002214 3300003354 Bacteria 9125
7 JGI25161J50226_1000477 3300003374 Bacteria 18148
8 Ga0055526_1001302 3300003771 Bacteria 17888
9 Ga0055524_1011150 3300003775 Bacteria 3532
10 Ga0055528_1001278 3300003790 Bacteria 15830
11 Ga0055540_1003726 3300003792 Bacteria 7207
12 Ga0055543_1000077 3300004625 Bacteria 86457
13 Ga0065165_1002901 3300005262 Bacteria 13155
14 Ga0070658_10175440 3300005327 Bacteria 1802
15 Ga0070676_10025437 3300005328 Bacteria 3346
16 Ga0070690_100042465 3300005330 Bacteria 2880
17 Ga0070690_100056475 3300005330 Bacteria 2517
18 Ga0070670_100344124 3300005331 Bacteria 1309
19 Ga0070677_10014044 3300005333 Bacteria 2812
20 Ga0070680_100282932 3300005336 Bacteria 1405
21 Ga0070689_100039656 3300005340 Bacteria 3607
22 Ga0070689_100403011 3300005340 Bacteria 1156
23 Ga0070668_100621259 3300005347 Bacteria 947
24 Ga0070669_100043033 3300005353 Bacteria 3287
25 Ga0070669_100287983 3300005353 Bacteria 1318
26 Ga0070669_100348495 3300005353 Bacteria 1202
27 Ga0070675_100022570 3300005354 Bacteria 5030
28 Ga0070675_100031865 3300005354 Bacteria 4264
29 Ga0070674_100001190 3300005356 Bacteria 13665
30 Ga0070688_100015484 3300005365 Bacteria 4341
31 Ga0070688_100034066 3300005365 Bacteria 3081
32 Ga0070709_10438834 3300005434 Bacteria 982
33 Ga0070713_100124652 3300005436 Bacteria 2264
34 Ga0070713_100162517 3300005436 Bacteria 1994
35 Ga0070710_10040735 3300005437 Bacteria 2561
36 Ga0070678_100038192 3300005456 Bacteria 3378
37 Ga0070678_100101549 3300005456 Bacteria 2230
38 Ga0070681_10040789 3300005458 Bacteria 4650
39 Ga0068867_100038610 3300005459 Bacteria 3476
40 Ga0070707_100113497 3300005468 Bacteria 2629
41 Ga0070684_100345431 3300005535 Bacteria 1368
42 Ga0068853_100071963 3300005539 Bacteria 3012
43 Ga0070672_100183075 3300005543 Bacteria 1746
44 Ga0070672_100239178 3300005543 Bacteria 1527
45 Ga0070696_100391526 3300005546 Bacteria 1085
46 Ga0070693_100149510 3300005547 Bacteria 1478
47 Ga0068855_100008801 3300005563 Bacteria 12200
48 Ga0068855_100133523 3300005563 Bacteria 2833
49 Ga0068855_100353350 3300005563 Bacteria 1619
50 Ga0068854_100449315 3300005578 Bacteria 1076
51 Ga0068852_100053968 3300005616 Bacteria 3462
52 Ga0068859_100066877 3300005617 Bacteria 3629
53 Ga0068859_100461295 3300005617 Bacteria 1366
54 Ga0068864_100059464 3300005618 Bacteria 3307
55 Ga0068864_100081280 3300005618 Bacteria 2841
56 Ga0068861_100050997 3300005719 Bacteria 3140
57 Ga0068861_100236742 3300005719 Bacteria 1551
58 Ga0068863_100446711 3300005841 Bacteria 1269
59 Ga0068858_100005319 3300005842 Bacteria 12621
60 Ga0081540_1015768 3300005983 Bacteria 4767
61 Ga0070715_10129215 3300006163 Bacteria 1214
62 Ga0097621_100015214 3300006237 Bacteria 5782
63 Ga0097621_100027589 3300006237 Bacteria 4467
64 Ga0068871_100005828 3300006358 Bacteria 8658
65 Ga0068871_100031122 3300006358 Bacteria 4205
66 Ga0075428_100020890 3300006844 Bacteria 7250
67 Ga0075428_100027232 3300006844 Bacteria 6328
68 Ga0075431_100000119 3300006847 Bacteria 51177
69 Ga0075429_100000501 3300006880 Bacteria 29462
70 Ga0075429_100069843 3300006880 Bacteria 3058
71 Ga0097620_100066875 3300006931 Bacteria 3629
72 Ga0097620_100461300 3300006931 Bacteria 1366
73 Ga0075435_100116199 3300007076 Bacteria 2228
74 Ga0105240_10018179 3300009093 Bacteria 9451
75 Ga0105240_10167616 3300009093 Bacteria 2604
76 Ga0111539_10001185 3300009094 Bacteria 34637
77 Ga0111539_10039901 3300009094 Bacteria 5653
78 Ga0111539_10049860 3300009094 Bacteria 4989
79 Ga0111539_10463831 3300009094 Bacteria 1475
80 Ga0105245_10025217 3300009098 Bacteria 5227
81 Ga0105245_10051927 3300009098 Bacteria 3676
82 Ga0114129_10010143 3300009147 Bacteria 13430
83 Ga0114129_10013751 3300009147 Bacteria 11536
84 Ga0105248_10050396 3300009177 Bacteria 4669
85 Ga0105248_10111902 3300009177 Bacteria 3080
86 Ga0105238_10019258 3300009551 Bacteria 6953
87 Ga0105238_10267855 3300009551 Bacteria 1689
88 Ga0157369_10020930 3300013105 Bacteria 7312
89 Ga0157378_10058532 3300013297 Bacteria 3437
90 Ga0163162_10516828 3300013306 Bacteria 1324
91 Ga0157372_10002215 3300013307 Bacteria 21115
92 Ga0157375_10077014 3300013308 Bacteria 3364
93 Ga0163163_10065602 3300014325 Bacteria 3605
94 Ga0163163_10077435 3300014325 Bacteria 3321
95 Ga0157380_10135937 3300014326 Bacteria 2104
96 Ga0157379_10042315 3300014968 Bacteria 4066
97 Ga0157376_10151435 3300014969 Bacteria 2092
98 Ga0209436_100072 3300025208 Bacteria 51104
99 Ga0209129_1000681 3300025258 Bacteria 22426
100 Ga0209673_1002838 3300025273 Bacteria 11114
101 Ga0209130_1000030 3300025284 Bacteria 323323
102 Ga0209025_1000328 3300025294 Bacteria 105594
103 Ga0209564_1000281 3300025295 Bacteria 104019
104 Ga0209758_1000357 3300025297 Bacteria 82792
105 Ga0209758_1001701 3300025297 Bacteria 24721
106 Ga0207426_1000047 3300025302 Bacteria 417011
107 Ga0209051_1002253 3300025303 Bacteria 14170
108 Ga0209257_1013532 3300025304 Bacteria 3615
109 Ga0207682_10000604 3300025893 Bacteria 16696
110 Ga0207692_10080084 3300025898 Bacteria 1744
111 Ga0207699_10069034 3300025906 Bacteria 2153
112 Ga0207645_10017719 3300025907 Bacteria 4695
113 Ga0207707_10030583 3300025912 Bacteria 4711
114 Ga0207695_10125298 3300025913 Bacteria 2532
115 Ga0207693_10032434 3300025915 Bacteria 4123
116 Ga0207693_10259398 3300025915 Bacteria 1363
117 Ga0207657_10000144 3300025919 Bacteria 72030
118 Ga0207646_10112875 3300025922 Bacteria 2439
119 Ga0207694_10086976 3300025924 Bacteria 2461
120 Ga0207650_10283359 3300025925 Bacteria 1350
121 Ga0207687_10088840 3300025927 Bacteria 2249
122 Ga0207700_10017009 3300025928 Bacteria 4846
123 Ga0207664_10058491 3300025929 Bacteria 3066
124 Ga0207644_10321702 3300025931 Bacteria 1251
125 Ga0207686_10100230 3300025934 Bacteria 1932
126 Ga0207670_10039279 3300025936 Bacteria 3098
127 Ga0207670_10050871 3300025936 Bacteria 2779
128 Ga0207670_10339129 3300025936 Bacteria 1187
129 Ga0207669_10001178 3300025937 Bacteria 11092
130 Ga0207704_10161397 3300025938 Bacteria 1595
131 Ga0207665_10012814 3300025939 Bacteria 5512
132 Ga0207691_10031484 3300025940 Bacteria 4950
133 Ga0207711_10267386 3300025941 Bacteria 1573
134 Ga0207667_10009042 3300025949 Bacteria 11782
135 Ga0207667_10239749 3300025949 Bacteria 1856
136 Ga0207667_10619019 3300025949 Bacteria 1090
137 Ga0207703_10003737 3300026035 Bacteria 12664
138 Ga0207703_10053189 3300026035 Bacteria 3291
139 Ga0207639_10075149 3300026041 Bacteria 2656
140 Ga0207648_10011855 3300026089 Bacteria 8193
141 Ga0207676_10211639 3300026095 Bacteria 1720
142 Ga0207683_10002523 3300026121 Bacteria 15985
143 Ga0207683_10024977 3300026121 Bacteria 5151
144 Ga0207698_10005204 3300026142 Bacteria 8000
145 Ga0210000_1000487 3300027462 Bacteria 5438
146 Ga0207428_10003033 3300027907 Bacteria 16531
147 Ga0207428_10012344 3300027907 Bacteria 7509
148 Ga0207428_10022064 3300027907 Bacteria 5377
149 Ga0268265_10121098 3300028380 Bacteria 2156
150 Ga0265334_10006091 3300028573 Bacteria 5229
151 Ga0265760_10032728 3300031090 Bacteria 1536
152 Ga0265332_10002842 3300031238 Bacteria 8572
153 Ga0265314_10003459 3300031711 Bacteria 15256
154 Ga0265314_10079604 3300031711 Bacteria 2166
155 Ga0265342_10170751 3300031712 Bacteria 1196
156 Ga0373934_0015830 3300035086 Bacteria 2864
157 Ga0373923_0174978 3300035111 Bacteria 984
158 Ga0373936_0020130 3300035113 Unclassified 2590
159 Ga0373936_0046511 3300035113 Bacteria 1750
160 Ga0373953_0000891 3300035117 Bacteria 8357
161 Ga0373953_0131481 3300035117 Bacteria 1067
162 Ga0373954_0002436 3300035118 Bacteria 7797
163 Ga0373956_0005897 3300035119 Bacteria 4901
164 Ga0373957_0000693 3300035120 Bacteria 8710
165 Ga0373957_0072264 3300035120 Bacteria 1351
166 Ga0373955_0000505 3300035172 Bacteria 16570
167 Ga0373955_0187732 3300035172 Bacteria 1228
168 Ga0373955_0240568 3300035172 Bacteria 1084
169 Ga0373924_0001776 3300035410 Bacteria 7127
170 Ga0373924_0089131 3300035410 Bacteria 1318
171 Ga0373924_0105263 3300035410 Bacteria 1216
172 Ga0373931_0000327 3300035691 Bacteria 19905
173 Ga0373931_0347900 3300035691 Bacteria 927
174 Ga0373935_0288591 3300035692 Bacteria 1157
175 Ga0373933_0001655 3300035724 Bacteria 12971
176 Ga0373933_0010903 3300035724 Bacteria 4990
177 Ga0373933_0196020 3300035724 Bacteria 1291
178 Ga0373933_0278975 3300035724 Bacteria 1080
179 Ga0373937_0006207 3300036401 Bacteria 10296
180 Ga0373937_0007848 3300036401 Bacteria 9253
181 Ga0373937_0015680 3300036401 Bacteria 6709
182 Ga0373937_0225239 3300036401 Bacteria 1765
183 Ga0373925_0389173 3300037068 Bacteria 1136
184 Ga0373925_0432463 3300037068 Bacteria 1076
185 Ga0395899_0017881 3300037312 Bacteria 5396
186 Ga0395898_0042514 3300037466 Bacteria 4482
187 Ga0400483_049815 3300039062 Bacteria 4562
188 Ga0400483_207635 3300039062 Bacteria 3345
189 Ga0439465_0036321 3300041413 Bacteria 1582
190 Ga0439434_0001994 3300042435 Bacteria 5905
191 Ga0451577_0056121 3300042876 Bacteria 3513
192 Ga0466960_0100732 3300044901 Bacteria 1487
193 Ga0466959_0140924 3300045049 Bacteria 1704
194 Ga0451576_0004362 3300045051 Bacteria 18444
195 Ga0451576_0367208 3300045051 Bacteria 1507
196 Ga0495592_0001464 3300046454 Bacteria 16415
197 Ga0495592_0154231 3300046454 Bacteria 1585
198 Ga0495603_0167563 3300046455 Bacteria 1273
199 Ga0495629_0003400 3300046459 Bacteria 12036
200 Ga0495653_0005985 3300046463 Bacteria 9956
201 Ga0495650_0002119 3300046471 Bacteria 16976
202 Ga0495582_0262291 3300046473 Bacteria 991
203 Ga0495583_0043718 3300046506 Bacteria 2084
204 Ga0495608_0004612 3300046511 Bacteria 9841
205 Ga0495608_0006887 3300046511 Bacteria 8052
206 Ga0495610_0010206 3300046512 Bacteria 5858
207 Ga0495628_0005745 3300046516 Bacteria 10869
208 Ga0495628_0042622 3300046516 Bacteria 3619
209 Ga0495630_0009714 3300046517 Bacteria 6921
210 Ga0495666_0019354 3300046526 Bacteria 3379
211 Ga0495652_0079309 3300046529 Bacteria 2715
212 Ga0495640_0001742 3300046533 Bacteria 17244
213 Ga0495640_0054109 3300046533 Bacteria 2751
214 Ga0495586_0005436 3300046535 Bacteria 6812
215 Ga0495586_0092048 3300046535 Bacteria 1676
216 Ga0495587_0017609 3300046536 Bacteria 4438
217 Ga0495587_0019979 3300046536 Bacteria 4140
218 Ga0495598_0001342 3300046537 Bacteria 4839
219 Ga0495621_0004111 3300046539 Bacteria 4055
220 Ga0495645_0015767 3300046543 Bacteria 5379
221 Ga0495645_0056564 3300046543 Bacteria 2848
222 Ga0495645_0065452 3300046543 Bacteria 2629
223 Ga0495667_0005604 3300046559 Bacteria 8484
224 Ga0495667_0006325 3300046559 Bacteria 8035
225 Ga0495656_0158842 3300046615 Bacteria 1097
226 Ga0495668_0175033 3300046616 Bacteria 1176
227 Ga0495634_0067059 3300046642 Bacteria 2374
228 Ga0495635_0000534 3300046663 Bacteria 24127
229 Ga0495635_0019248 3300046663 Bacteria 4761
230 Ga0495657_0048818 3300046675 Bacteria 2854
231 Ga0495599_0001643 3300046678 Bacteria 12895
232 Ga0495599_0007138 3300046678 Bacteria 6764
233 Ga0495623_0002907 3300046679 Bacteria 11279
234 Ga0495623_0169054 3300046679 Bacteria 1278
235 Ga0495623_0196874 3300046679 Bacteria 1161
236 Ga0495658_0058306 3300046683 Bacteria 2208
237 Ga0495613_0004190 3300046689 Bacteria 10792
238 Ga0495600_0005488 3300046809 Bacteria 7651
239 Ga0495660_0163581 3300046810 Bacteria 1089
240 Ga0495604_0001489 3300047317 Bacteria 19311
241 Ga0495604_0005932 3300047317 Bacteria 9689
242 Ga0495604_0147443 3300047317 Bacteria 1676
243 Ga0495680_0007971 3300047322 Bacteria 9658
244 Ga0495680_0020583 3300047322 Bacteria 5545
245 Ga0495680_0112474 3300047322 Bacteria 2017
246 Ga0495675_0006182 3300047444 Bacteria 7325
247 Ga0495684_0001012 3300047471 Bacteria 22906
248 Ga0495686_0212032 3300047472 Bacteria 1106
249 Ga0495593_0003628 3300047673 Bacteria 9217
250 Ga0495593_0004977 3300047673 Bacteria 7872
251 Ga0495602_0366232 3300048088 Bacteria 1036
252 Ga0496106_0000326 3300048909 Bacteria 33680
253 Ga0496115_0275302 3300048918 Bacteria 1382
254 Ga0496116_0007936 3300048919 Bacteria 9302
255 Ga0496117_0065193 3300048920 Bacteria 2478
256 Ga0496118_0200116 3300048921 Bacteria 1184
257 Ga0496121_0050578 3300048924 Bacteria 3509
258 Ga0496121_0300500 3300048924 Bacteria 1089
259 Ga0496122_0034244 3300048925 Bacteria 4160
260 Ga0496124_0086837 3300048927 Bacteria 2559
261 Ga0496125_0112738 3300048928 Bacteria 1964
262 Ga0496126_0046689 3300048929 Bacteria 3969
263 Ga0501031_0033556 3300049568 Bacteria 3349
264 Ga0501032_0057920 3300049569 Bacteria 2602
265 Ga0501034_0161416 3300049571 Bacteria 2212
266 Ga0501038_0038534 3300049574 Bacteria 4185
267 Ga0501038_0200071 3300049574 Bacteria 1604
268 Ga0501042_0054491 3300049578 Bacteria 2853
269 Ga0501043_0041273 3300049579 Bacteria 3625
270 Ga0501043_0139107 3300049579 Bacteria 1902
271 Ga0501046_0035358 3300049580 Bacteria 4027
272 Ga0501046_0072468 3300049580 Bacteria 2674
273 Ga0501047_0030316 3300049581 Bacteria 5215
274 Ga0501048_0035299 3300049582 Bacteria 3600
275 Ga0501070_0345088 3300049586 Unclassified 1209
276 Ga0501073_0037359 3300049589 Bacteria 3449
277 Ga0501074_0159228 3300049590 Unclassified 1612
278 Ga0501075_0038220 3300049591 Bacteria 3587
279 Ga0501076_0320237 3300049592 Bacteria 1272
280 Ga0501077_0043788 3300049593 Unclassified 2845
281 Ga0501081_0039128 3300049743 Bacteria 3244
282 Ga0501044_0421513 3300049823 Bacteria 1245
283 Ga0501045_0007747 3300049824 Bacteria 7469
284 Ga0501045_0333814 3300049824 Unclassified 1128
285 nmdc:mga05p37_12615_c1 3300050507 Bacteria 4632
286 nmdc:mga05p37_6854_c1 3300050507 Bacteria 13430
287 nmdc:mga09592_1024_c1 3300050508 Bacteria 22197
288 nmdc:mga09592_66385_c1 3300050508 Bacteria 3058
289 nmdc:mga06r32_1196_c1 3300050510 Bacteria 23343
290 nmdc:mga08y16_19819_c1 3300050511 Bacteria 7092
291 nmdc:mga08y16_30832_c1 3300050511 Bacteria 5639
292 nmdc:mga08y16_361581_c1 3300050511 Bacteria 1490
293 nmdc:mga08y16_3838_c1 3300050511 Bacteria 15634
294 nmdc:mga08y16_504737_c1 3300050511 Bacteria 1228
295 nmdc:mga0rr50_108592_c1 3300050513 Bacteria 2192
296 nmdc:mga0rr50_207831_c1 3300050513 Bacteria 1611
297 nmdc:mga08x19_298086_c1 3300050514 Bacteria 1119
298 Ga0495601_0036103 3300053077 Bacteria 3086
299 Ga0495595_0000465 3300053084 Bacteria 15378
300 Ga0495619_0001330 3300053085 Bacteria 16187
301 Ga0500658_0008894 3300053134 Bacteria 3706
302 Ga0500568_0008522 3300053139 Bacteria 4933
303 Ga0500604_0016896 3300053151 Bacteria 2013
304 Ga0500622_0000918 3300053156 Bacteria 25056
305 Ga0500633_0031392 3300053160 Bacteria 1716
306 Ga0501084_0188544 3300054114 Unclassified 1740
307 Ga0590077_002102 3300059426 Bacteria 4356
308 Ga0501082_0063081 3300060353 Bacteria 3191
309 Ga0530510_0012285 3300061734 Bacteria 6011
310 Ga0530510_0121728 3300061734 Unclassified 1916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0432463 Ga0373925_0432463_325_1059 244
2 3300046810 Ga0495660_0163581 Ga0495660_0163581_163_996 258
3 3300005563 Ga0068855_100353350 Ga0068855_1003533501 260
4 3300009093 Ga0105240_10167616 Ga0105240_101676164 260
5 3300025949 Ga0207667_10239749 Ga0207667_102397492 260
6 3300050511 nmdc:mga08y16_504737_c1 nmdc:mga08y16_504737_c1_44_826 260
7 3300005578 Ga0068854_100449315 Ga0068854_1004493152 264
8 3300025919 Ga0207657_10000144 Ga0207657_1000014438 264
9 3300031711 Ga0265314_10003459 Ga0265314_1000345916 264
10 iso_pu_bacteria 2511231007 2511272422 264
11 3300005468 Ga0070707_100113497 Ga0070707_1001134972 266
12 3300005618 Ga0068864_100059464 Ga0068864_1000594641 266
13 3300025922 Ga0207646_10112875 Ga0207646_101128752 266
14 3300027462 Ga0210000_1000487 Ga0210000_10004874 266
15 3300037312 Ga0395899_0017881 Ga0395899_0017881_3201_4013 266
16 3300037466 Ga0395898_0042514 Ga0395898_0042514_2098_2910 266
17 3300042876 Ga0451577_0056121 Ga0451577_0056121_670_1482 266
18 3300045049 Ga0466959_0140924 Ga0466959_0140924_257_1069 266
19 iso_pu_bacteria 3005718088 3005722527 266
20 iso_pu_bacteria 8056967851 8056968258 266
21 3300045051 Ga0451576_0004362 Ga0451576_0004362_10398_11231 267
22 3300048924 Ga0496121_0300500 Ga0496121_0300500_242_1045 267
23 3300031711 Ga0265314_10079604 Ga0265314_100796042 268
24 3300031712 Ga0265342_10170751 Ga0265342_101707513 268
25 3300046455 Ga0495603_0167563 Ga0495603_0167563_295_1128 268
26 3300035119 Ga0373956_0005897 Ga0373956_0005897_3350_4174 269
27 3300035172 Ga0373955_0187732 Ga0373955_0187732_166_999 269
28 3300035724 Ga0373933_0010903 Ga0373933_0010903_3908_4732 269
29 3300009551 Ga0105238_10267855 Ga0105238_102678552 270
30 3300028380 Ga0268265_10121098 Ga0268265_101210982 270
31 3300035113 Ga0373936_0020130 Ga0373936_0020130_356_1168 270
32 3300042435 Ga0439434_0001994 Ga0439434_0001994_321_1136 270
33 3300048918 Ga0496115_0275302 Ga0496115_0275302_487_1302 270
34 3300049586 Ga0501070_0345088 Ga0501070_0345088_191_1006 270
35 3300049590 Ga0501074_0159228 Ga0501074_0159228_645_1460 270
36 3300049593 Ga0501077_0043788 Ga0501077_0043788_1304_2119 270
37 3300049824 Ga0501045_0333814 Ga0501045_0333814_82_897 270
38 3300054114 Ga0501084_0188544 Ga0501084_0188544_829_1644 270
39 3300061734 Ga0530510_0121728 Ga0530510_0121728_830_1645 270
40 3300059426 Ga0590077_002102 Ga0590077_002102_2059_2880 271
41 iso_pu_bacteria 2513237351 2514586041 271
42 3300045051 Ga0451576_0367208 Ga0451576_0367208_108_929 272
43 3300050514 nmdc:mga08x19_298086_c1 nmdc:mga08x19_298086_c1_164_1042 272
44 3300005330 Ga0070690_100042465 Ga0070690_1000424654 273
45 3300005340 Ga0070689_100039656 Ga0070689_1000396566 273
46 3300005436 Ga0070713_100124652 Ga0070713_1001246522 273
47 3300005543 Ga0070672_100239178 Ga0070672_1002391782 273
48 3300005546 Ga0070696_100391526 Ga0070696_1003915262 273
49 3300005617 Ga0068859_100461295 Ga0068859_1004612952 273
50 3300006163 Ga0070715_10129215 Ga0070715_101292152 273
51 3300006237 Ga0097621_100015214 Ga0097621_1000152147 273
52 3300006237 Ga0097621_100027589 Ga0097621_1000275892 273
53 3300006358 Ga0068871_100005828 Ga0068871_1000058285 273
54 3300006358 Ga0068871_100031122 Ga0068871_1000311222 273
55 3300006931 Ga0097620_100461300 Ga0097620_1004613002 273
56 3300009098 Ga0105245_10025217 Ga0105245_100252176 273
57 3300009098 Ga0105245_10051927 Ga0105245_100519272 273
58 3300009177 Ga0105248_10111902 Ga0105248_101119023 273
59 3300013297 Ga0157378_10058532 Ga0157378_100585323 273
60 3300013308 Ga0157375_10077014 Ga0157375_100770143 273
61 3300014968 Ga0157379_10042315 Ga0157379_100423154 273
62 3300025915 Ga0207693_10259398 Ga0207693_102593982 273
63 3300025927 Ga0207687_10088840 Ga0207687_100888402 273
64 3300025934 Ga0207686_10100230 Ga0207686_101002302 273
65 3300025936 Ga0207670_10050871 Ga0207670_100508713 273
66 3300025936 Ga0207670_10339129 Ga0207670_103391292 273
67 3300025938 Ga0207704_10161397 Ga0207704_101613972 273
68 3300026035 Ga0207703_10053189 Ga0207703_100531892 273
69 3300035410 Ga0373924_0089131 Ga0373924_0089131_125_949 273
70 3300035692 Ga0373935_0288591 Ga0373935_0288591_312_1133 273
71 3300036401 Ga0373937_0015680 Ga0373937_0015680_3295_4119 273
72 3300046454 Ga0495592_0154231 Ga0495592_0154231_103_927 273
73 3300046473 Ga0495582_0262291 Ga0495582_0262291_78_902 273
74 3300046511 Ga0495608_0004612 Ga0495608_0004612_1664_2488 273
75 3300046516 Ga0495628_0042622 Ga0495628_0042622_784_1608 273
76 3300046517 Ga0495630_0009714 Ga0495630_0009714_3798_4622 273
77 3300046526 Ga0495666_0019354 Ga0495666_0019354_112_936 273
78 3300046529 Ga0495652_0079309 Ga0495652_0079309_967_1791 273
79 3300046533 Ga0495640_0001742 Ga0495640_0001742_2580_3404 273
80 3300046535 Ga0495586_0005436 Ga0495586_0005436_4164_4988 273
81 3300046535 Ga0495586_0092048 Ga0495586_0092048_740_1564 273
82 3300046536 Ga0495587_0017609 Ga0495587_0017609_2586_3410 273
83 3300046543 Ga0495645_0015767 Ga0495645_0015767_2611_3435 273
84 3300046543 Ga0495645_0056564 Ga0495645_0056564_1511_2335 273
85 3300046559 Ga0495667_0005604 Ga0495667_0005604_1775_2599 273
86 3300046642 Ga0495634_0067059 Ga0495634_0067059_1304_2128 273
87 3300046663 Ga0495635_0019248 Ga0495635_0019248_2154_2978 273
88 3300046675 Ga0495657_0048818 Ga0495657_0048818_271_1095 273
89 3300046678 Ga0495599_0001643 Ga0495599_0001643_6875_7699 273
90 3300046679 Ga0495623_0169054 Ga0495623_0169054_237_1061 273
91 3300046689 Ga0495613_0004190 Ga0495613_0004190_9659_10483 273
92 3300046809 Ga0495600_0005488 Ga0495600_0005488_3816_4640 273
93 3300047317 Ga0495604_0005932 Ga0495604_0005932_2896_3720 273
94 3300047317 Ga0495604_0147443 Ga0495604_0147443_758_1582 273
95 3300047322 Ga0495680_0007971 Ga0495680_0007971_6464_7288 273
96 3300047322 Ga0495680_0112474 Ga0495680_0112474_85_909 273
97 3300048088 Ga0495602_0366232 Ga0495602_0366232_150_974 273
98 3300050513 nmdc:mga0rr50_207831_c1 nmdc:mga0rr50_207831_c1_372_1196 273
99 iso_pu_bacteria 2510917030 2511198416 273
100 iso_pu_bacteria 2582581298 2585224796 273
101 iso_pu_bacteria 2585427529 2585547352 273
102 iso_pu_bacteria 2919100787 2919104550 273
103 3300005353 Ga0070669_100287983 Ga0070669_1002879831 274
104 3300005617 Ga0068859_100066877 Ga0068859_1000668773 274
105 3300005618 Ga0068864_100081280 Ga0068864_1000812802 274
106 3300005719 Ga0068861_100050997 Ga0068861_1000509972 274
107 3300005842 Ga0068858_100005319 Ga0068858_1000053192 274
108 3300006844 Ga0075428_100020890 Ga0075428_1000208903 274
109 3300006880 Ga0075429_100000501 Ga0075429_10000050116 274
110 3300006931 Ga0097620_100066875 Ga0097620_1000668753 274
111 3300009094 Ga0111539_10039901 Ga0111539_100399012 274
112 3300009094 Ga0111539_10049860 Ga0111539_100498603 274
113 3300009147 Ga0114129_10013751 Ga0114129_100137518 274
114 3300014325 Ga0163163_10065602 Ga0163163_100656023 274
115 3300014325 Ga0163163_10077435 Ga0163163_100774352 274
116 3300025915 Ga0207693_10032434 Ga0207693_100324345 274
117 3300025941 Ga0207711_10267386 Ga0207711_102673862 274
118 3300026035 Ga0207703_10003737 Ga0207703_100037373 274
119 3300026095 Ga0207676_10211639 Ga0207676_102116393 274
120 3300027907 Ga0207428_10003033 Ga0207428_100030332 274
121 3300027907 Ga0207428_10022064 Ga0207428_100220642 274
122 3300035111 Ga0373923_0174978 Ga0373923_0174978_26_859 274
123 3300035117 Ga0373953_0131481 Ga0373953_0131481_127_960 274
124 3300035172 Ga0373955_0240568 Ga0373955_0240568_42_869 274
125 3300035410 Ga0373924_0105263 Ga0373924_0105263_138_971 274
126 3300035724 Ga0373933_0196020 Ga0373933_0196020_365_1198 274
127 3300035724 Ga0373933_0278975 Ga0373933_0278975_243_1070 274
128 3300036401 Ga0373937_0007848 Ga0373937_0007848_7346_8179 274
129 3300036401 Ga0373937_0225239 Ga0373937_0225239_676_1503 274
130 3300046679 Ga0495623_0196874 Ga0495623_0196874_194_1021 274
131 3300046683 Ga0495658_0058306 Ga0495658_0058306_1131_1964 274
132 3300050507 nmdc:mga05p37_12615_c1 nmdc:mga05p37_12615_c1_430_1257 274
133 3300050508 nmdc:mga09592_1024_c1 nmdc:mga09592_1024_c1_10444_11271 274
134 3300050511 nmdc:mga08y16_19819_c1 nmdc:mga08y16_19819_c1_3134_3961 274
135 3300050511 nmdc:mga08y16_30832_c1 nmdc:mga08y16_30832_c1_3262_4182 274
136 iso_pu_bacteria 2884298095 2884300035 274
137 3300005327 Ga0070658_10175440 Ga0070658_101754402 275
138 3300005328 Ga0070676_10025437 Ga0070676_100254372 275
139 3300005330 Ga0070690_100056475 Ga0070690_1000564752 275
140 3300005333 Ga0070677_10014044 Ga0070677_100140442 275
141 3300005336 Ga0070680_100282932 Ga0070680_1002829322 275
142 3300005340 Ga0070689_100403011 Ga0070689_1004030111 275
143 3300005347 Ga0070668_100621259 Ga0070668_1006212591 275
144 3300005353 Ga0070669_100043033 Ga0070669_1000430334 275
145 3300005354 Ga0070675_100022570 Ga0070675_1000225702 275
146 3300005356 Ga0070674_100001190 Ga0070674_1000011908 275
147 3300005365 Ga0070688_100034066 Ga0070688_1000340662 275
148 3300005456 Ga0070678_100038192 Ga0070678_1000381922 275
149 3300005456 Ga0070678_100101549 Ga0070678_1001015492 275
150 3300005458 Ga0070681_10040789 Ga0070681_100407894 275
151 3300005459 Ga0068867_100038610 Ga0068867_1000386103 275
152 3300005535 Ga0070684_100345431 Ga0070684_1003454311 275
153 3300005539 Ga0068853_100071963 Ga0068853_1000719632 275
154 3300005543 Ga0070672_100183075 Ga0070672_1001830751 275
155 3300005547 Ga0070693_100149510 Ga0070693_1001495102 275
156 3300005563 Ga0068855_100008801 Ga0068855_1000088017 275
157 3300005563 Ga0068855_100133523 Ga0068855_1001335233 275
158 3300005616 Ga0068852_100053968 Ga0068852_1000539683 275
159 3300005841 Ga0068863_100446711 Ga0068863_1004467111 275
160 3300005983 Ga0081540_1015768 Ga0081540_10157683 275
161 3300006844 Ga0075428_100027232 Ga0075428_1000272325 275
162 3300006847 Ga0075431_100000119 Ga0075431_1000001194 275
163 3300006880 Ga0075429_100069843 Ga0075429_1000698433 275
164 3300009093 Ga0105240_10018179 Ga0105240_100181792 275
165 3300009094 Ga0111539_10001185 Ga0111539_100011854 275
166 3300009147 Ga0114129_10010143 Ga0114129_1001014312 275
167 3300009177 Ga0105248_10050396 Ga0105248_100503967 275
168 3300009551 Ga0105238_10019258 Ga0105238_100192588 275
169 3300013105 Ga0157369_10020930 Ga0157369_100209304 275
170 3300013306 Ga0163162_10516828 Ga0163162_105168282 275
171 3300013307 Ga0157372_10002215 Ga0157372_100022158 275
172 3300014326 Ga0157380_10135937 Ga0157380_101359372 275
173 3300014969 Ga0157376_10151435 Ga0157376_101514352 275
174 3300025893 Ga0207682_10000604 Ga0207682_1000060413 275
175 3300025907 Ga0207645_10017719 Ga0207645_100177193 275
176 3300025912 Ga0207707_10030583 Ga0207707_100305834 275
177 3300025913 Ga0207695_10125298 Ga0207695_101252982 275
178 3300025924 Ga0207694_10086976 Ga0207694_100869762 275
179 3300025931 Ga0207644_10321702 Ga0207644_103217021 275
180 3300025936 Ga0207670_10039279 Ga0207670_100392793 275
181 3300025937 Ga0207669_10001178 Ga0207669_100011788 275
182 3300025940 Ga0207691_10031484 Ga0207691_100314841 275
183 3300025949 Ga0207667_10009042 Ga0207667_100090427 275
184 3300026041 Ga0207639_10075149 Ga0207639_100751492 275
185 3300026089 Ga0207648_10011855 Ga0207648_100118556 275
186 3300026121 Ga0207683_10002523 Ga0207683_1000252315 275
187 3300026121 Ga0207683_10024977 Ga0207683_100249771 275
188 3300026142 Ga0207698_10005204 Ga0207698_100052048 275
189 3300027907 Ga0207428_10012344 Ga0207428_100123442 275
190 3300028573 Ga0265334_10006091 Ga0265334_100060912 275
191 3300031090 Ga0265760_10032728 Ga0265760_100327281 275
192 3300031238 Ga0265332_10002842 Ga0265332_100028422 275
193 3300035086 Ga0373934_0015830 Ga0373934_0015830_1185_2027 275
194 3300035113 Ga0373936_0046511 Ga0373936_0046511_837_1679 275
195 3300035117 Ga0373953_0000891 Ga0373953_0000891_1502_2344 275
196 3300035118 Ga0373954_0002436 Ga0373954_0002436_6581_7423 275
197 3300035120 Ga0373957_0000693 Ga0373957_0000693_6443_7285 275
198 3300035120 Ga0373957_0072264 Ga0373957_0072264_114_956 275
199 3300035172 Ga0373955_0000505 Ga0373955_0000505_9537_10379 275
200 3300035410 Ga0373924_0001776 Ga0373924_0001776_1956_2798 275
201 3300035691 Ga0373931_0000327 Ga0373931_0000327_12790_13638 275
202 3300035691 Ga0373931_0347900 Ga0373931_0347900_15_857 275
203 3300035724 Ga0373933_0001655 Ga0373933_0001655_9126_9968 275
204 3300036401 Ga0373937_0006207 Ga0373937_0006207_3201_4043 275
205 3300039062 Ga0400483_049815 Ga0400483_049815_1718_2548 275
206 3300039062 Ga0400483_207635 Ga0400483_207635_1907_2737 275
207 3300044901 Ga0466960_0100732 Ga0466960_0100732_20_865 275
208 3300046454 Ga0495592_0001464 Ga0495592_0001464_11435_12277 275
209 3300046459 Ga0495629_0003400 Ga0495629_0003400_6601_7443 275
210 3300046463 Ga0495653_0005985 Ga0495653_0005985_4467_5309 275
211 3300046471 Ga0495650_0002119 Ga0495650_0002119_7585_8415 275
212 3300046511 Ga0495608_0006887 Ga0495608_0006887_4393_5235 275
213 3300046516 Ga0495628_0005745 Ga0495628_0005745_3710_4552 275
214 3300046533 Ga0495640_0054109 Ga0495640_0054109_1003_1845 275
215 3300046536 Ga0495587_0019979 Ga0495587_0019979_3041_3883 275
216 3300046537 Ga0495598_0001342 Ga0495598_0001342_594_1430 275
217 3300046539 Ga0495621_0004111 Ga0495621_0004111_2634_3470 275
218 3300046543 Ga0495645_0065452 Ga0495645_0065452_950_1792 275
219 3300046559 Ga0495667_0006325 Ga0495667_0006325_6048_6890 275
220 3300046615 Ga0495656_0158842 Ga0495656_0158842_22_864 275
221 3300046663 Ga0495635_0000534 Ga0495635_0000534_12283_13125 275
222 3300046678 Ga0495599_0007138 Ga0495599_0007138_5016_5858 275
223 3300046679 Ga0495623_0002907 Ga0495623_0002907_4519_5361 275
224 3300047317 Ga0495604_0001489 Ga0495604_0001489_6413_7255 275
225 3300047322 Ga0495680_0020583 Ga0495680_0020583_3201_4043 275
226 3300047444 Ga0495675_0006182 Ga0495675_0006182_780_1622 275
227 3300047471 Ga0495684_0001012 Ga0495684_0001012_9845_10687 275
228 3300047673 Ga0495593_0003628 Ga0495593_0003628_6486_7328 275
229 3300047673 Ga0495593_0004977 Ga0495593_0004977_3671_4558 275
230 3300048924 Ga0496121_0050578 Ga0496121_0050578_1701_2543 275
231 3300048929 Ga0496126_0046689 Ga0496126_0046689_697_1539 275
232 3300049568 Ga0501031_0033556 Ga0501031_0033556_2026_2874 275
233 3300049571 Ga0501034_0161416 Ga0501034_0161416_758_1603 275
234 3300049578 Ga0501042_0054491 Ga0501042_0054491_1882_2730 275
235 3300049580 Ga0501046_0035358 Ga0501046_0035358_942_1790 275
236 3300049592 Ga0501076_0320237 Ga0501076_0320237_400_1245 275
237 3300049823 Ga0501044_0421513 Ga0501044_0421513_306_1154 275
238 3300050507 nmdc:mga05p37_6854_c1 nmdc:mga05p37_6854_c1_9286_10131 275
239 3300050508 nmdc:mga09592_66385_c1 nmdc:mga09592_66385_c1_1007_1852 275
240 3300050510 nmdc:mga06r32_1196_c1 nmdc:mga06r32_1196_c1_3658_4503 275
241 3300050511 nmdc:mga08y16_3838_c1 nmdc:mga08y16_3838_c1_12952_13797 275
242 3300053077 Ga0495601_0036103 Ga0495601_0036103_301_1143 275
243 3300053084 Ga0495595_0000465 Ga0495595_0000465_4011_4853 275
244 3300053085 Ga0495619_0001330 Ga0495619_0001330_9106_9948 275
245 3300003187 JGI25151J46595_10000288 JGI25151J46595_1000028815 276
246 3300005436 Ga0070713_100162517 Ga0070713_1001625172 276
247 3300005437 Ga0070710_10040735 Ga0070710_100407352 276
248 3300007076 Ga0075435_100116199 Ga0075435_1001161991 276
249 3300025294 Ga0209025_1000328 Ga0209025_100032836 276
250 3300025297 Ga0209758_1001701 Ga0209758_10017012 276
251 3300025898 Ga0207692_10080084 Ga0207692_100800841 276
252 3300025906 Ga0207699_10069034 Ga0207699_100690342 276
253 3300025928 Ga0207700_10017009 Ga0207700_100170095 276
254 3300025939 Ga0207665_10012814 Ga0207665_100128144 276
255 3300025949 Ga0207667_10619019 Ga0207667_106190191 276
256 3300049574 Ga0501038_0038534 Ga0501038_0038534_2445_3299 276
257 3300049579 Ga0501043_0139107 Ga0501043_0139107_439_1293 276
258 3300049582 Ga0501048_0035299 Ga0501048_0035299_2657_3511 276
259 3300049591 Ga0501075_0038220 Ga0501075_0038220_1293_2147 276
260 3300049743 Ga0501081_0039128 Ga0501081_0039128_1216_2070 276
261 3300049824 Ga0501045_0007747 Ga0501045_0007747_5215_6069 276
262 3300050513 nmdc:mga0rr50_108592_c1 nmdc:mga0rr50_108592_c1_1242_2090 276
263 3300061734 Ga0530510_0012285 Ga0530510_0012285_5087_5941 276
264 3300002739 JGI25158J39367_1000234 JGI25158J39367_100023412 277
265 3300002773 JGI25152J39213_1004701 JGI25152J39213_10047015 277
266 3300002987 JGI25159J45721_1001732 JGI25159J45721_10017328 277
267 3300003215 JGI25153J46596_10008059 JGI25153J46596_100080593 277
268 3300003354 JGI25160J50197_1002214 JGI25160J50197_10022145 277
269 3300003374 JGI25161J50226_1000477 JGI25161J50226_10004777 277
270 3300003771 Ga0055526_1001302 Ga0055526_10013027 277
271 3300003775 Ga0055524_1011150 Ga0055524_10111502 277
272 3300003790 Ga0055528_1001278 Ga0055528_10012788 277
273 3300003792 Ga0055540_1003726 Ga0055540_10037265 277
274 3300004625 Ga0055543_1000077 Ga0055543_100007778 277
275 3300005262 Ga0065165_1002901 Ga0065165_10029014 277
276 3300005331 Ga0070670_100344124 Ga0070670_1003441242 277
277 3300005353 Ga0070669_100348495 Ga0070669_1003484951 277
278 3300005354 Ga0070675_100031865 Ga0070675_1000318655 277
279 3300005365 Ga0070688_100015484 Ga0070688_1000154846 277
280 3300005434 Ga0070709_10438834 Ga0070709_104388341 277
281 3300005719 Ga0068861_100236742 Ga0068861_1002367421 277
282 3300009094 Ga0111539_10463831 Ga0111539_104638312 277
283 3300025208 Ga0209436_100072 Ga0209436_10007224 277
284 3300025258 Ga0209129_1000681 Ga0209129_100068124 277
285 3300025273 Ga0209673_1002838 Ga0209673_10028386 277
286 3300025284 Ga0209130_1000030 Ga0209130_1000030181 277
287 3300025295 Ga0209564_1000281 Ga0209564_100028142 277
288 3300025297 Ga0209758_1000357 Ga0209758_100035754 277
289 3300025302 Ga0207426_1000047 Ga0207426_1000047219 277
290 3300025303 Ga0209051_1002253 Ga0209051_10022535 277
291 3300025304 Ga0209257_1013532 Ga0209257_10135321 277
292 3300025925 Ga0207650_10283359 Ga0207650_102833591 277
293 3300025929 Ga0207664_10058491 Ga0207664_100584912 277
294 3300037068 Ga0373925_0389173 Ga0373925_0389173_226_1089 277
295 3300041413 Ga0439465_0036321 Ga0439465_0036321_611_1444 277
296 3300046506 Ga0495583_0043718 Ga0495583_0043718_279_1112 277
297 3300046512 Ga0495610_0010206 Ga0495610_0010206_1782_2615 277
298 3300046616 Ga0495668_0175033 Ga0495668_0175033_237_1070 277
299 3300047472 Ga0495686_0212032 Ga0495686_0212032_232_1065 277
300 3300048909 Ga0496106_0000326 Ga0496106_0000326_19048_19881 277
301 3300048919 Ga0496116_0007936 Ga0496116_0007936_2349_3182 277
302 3300048920 Ga0496117_0065193 Ga0496117_0065193_1422_2255 277
303 3300048921 Ga0496118_0200116 Ga0496118_0200116_119_952 277
304 3300048925 Ga0496122_0034244 Ga0496122_0034244_2223_3056 277
305 3300048927 Ga0496124_0086837 Ga0496124_0086837_853_1686 277
306 3300048928 Ga0496125_0112738 Ga0496125_0112738_542_1375 277
307 3300049569 Ga0501032_0057920 Ga0501032_0057920_1119_1952 277
308 3300049574 Ga0501038_0200071 Ga0501038_0200071_726_1559 277
309 3300049579 Ga0501043_0041273 Ga0501043_0041273_1452_2285 277
310 3300049580 Ga0501046_0072468 Ga0501046_0072468_1554_2387 277
311 3300049581 Ga0501047_0030316 Ga0501047_0030316_242_1075 277
312 3300049589 Ga0501073_0037359 Ga0501073_0037359_889_1722 277
313 3300050511 nmdc:mga08y16_361581_c1 nmdc:mga08y16_361581_c1_502_1353 277
314 3300053134 Ga0500658_0008894 Ga0500658_0008894_1537_2370 277
315 3300053139 Ga0500568_0008522 Ga0500568_0008522_1237_2070 277
316 3300053151 Ga0500604_0016896 Ga0500604_0016896_351_1184 277
317 3300053156 Ga0500622_0000918 Ga0500622_0000918_4542_5375 277
318 3300053160 Ga0500633_0031392 Ga0500633_0031392_586_1419 277
319 3300060353 Ga0501082_0063081 Ga0501082_0063081_1717_2550 277
320 iso_pu_bacteria 2510065019 2510134830 277
321 iso_pu_bacteria 2513237103 2513710770 277
322 iso_pu_bacteria 2516653077 2517037545 277
323 iso_pu_bacteria 8024479707 8024481934 277
324 iso_pu_bacteria 8057874678 8057876975 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

58

153

0.99

PF13649

Methyltransf_25

Methyltransferase domain

57

149

0.95

PF13847

Methyltransf_31

Methyltransferase domain

51

220

0.93

PF08242

Methyltransf_12

Methyltransferase domain

58

151

0.92

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

42

178

0.9

PF07021

MetW

Methionine biosynthesis protein MetW

44

156

0.88

PF13489

Methyltransf_23

Methyltransferase domain

36

232

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nxe-assembly2.cif.gz_B t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with s-adenosyl-l-methionine 0.8513 42 154
3cjq-assembly3.cif.gz_G ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 0.8506 41 154
3cjq-assembly1.cif.gz_A ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 0.8491 41 154
3cjt-assembly7.cif.gz_M ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.8483 41 154
2zbr-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-ornithine 0.8462 41 154
ID Description Score Start End Superfamily
af_P9WLY7_8_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9317 13 277 3.40.50.150
af_P9WLY7_8_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9216 13 277 3.40.50.150
af_Q9BTF0_272_433_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9185 39 153 3.40.50.150
af_P25087_39_327_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9165 38 157 3.40.50.150
af_Q4CM63_15_263_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9155 38 157 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W0GKN9-F1-model_v4 Methyltransferase domain-containing protein 0.9849 90 275 GO:0008757
GO:0032259
AF-A0A8B5XBL4-F1-model_v4 Class I SAM-dependent methyltransferase 0.9809 13 277 GO:0008168
GO:0032259
AF-A0A4R2CR44-F1-model_v4 Methyltransferase family protein 0.979 9 277 GO:0008757
GO:0032259
AF-A0A4R2CR44-F1-model_v4 Methyltransferase family protein 0.9683 9 277 GO:0008757
GO:0032259
AF-A0A7W0GKN9-F1-model_v4 Methyltransferase domain-containing protein 0.9644 90 275 GO:0008757
GO:0032259

Feature Viewer

pLDDT pTM Quality
94.78 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map