F406853
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 323 | 203 | 319 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_100000030|Ga0068862_10000003067 |
| Length | 245 |
| Sequence | MQFHQRLMRYLPAIAFILLCVGRHQLVKERRSASDVLSSVVTPLIAIGGATMTRKMALAAASDVHPTVEAAPQTEPVVDKAAQFDIEIVPATAGPALLSGQQATVVQAMASRYRIVDRALPPGIAPERGLQVKTILASRAISEDFPQIHDIGGVRPDALRWHPNGLALDVMIPNPSSPEGIALGNEIVQYALANAERFDLQDCIWRGVYYTPNGAQGGRGYGHYDHVHITTHGGGYPTMGETYLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 2 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 3 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 4 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 5 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 43 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 44 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 49 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 50 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 116 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 117 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 118 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 119 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 120 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 121 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 124 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 125 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 126 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 127 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 128 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 129 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 130 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 131 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 132 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 133 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 134 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 135 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 136 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 137 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 138 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 139 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 140 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 157 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 158 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 159 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 160 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 161 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 162 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 165 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 166 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 167 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 168 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 169 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 170 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 171 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 172 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 175 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 176 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 177 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 178 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 179 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 183 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 184 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 187 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 188 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 191 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 192 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 193 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 194 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 195 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 196 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 197 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 198 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 199 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 200 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 201 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 202 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 203 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.76 |
| Metatranscriptomes | 0 |
| Isolates | 1.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.65 |
| Nodule | 0.31 |
| Rhizoplane | 13.31 |
| Rhizosphere | 64.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1004342 | 3300001977 | Bacteria | 2234 |
| 2 | JGI24743J22301_10017046 | 3300001991 | Bacteria | 1360 |
| 3 | JGI24745J21846_1008991 | 3300002073 | Bacteria | 1129 |
| 4 | JGI24744J21845_10009693 | 3300002077 | Bacteria | 1977 |
| 5 | rootH2_10028555 | 3300003320 | Bacteria | 4740 |
| 6 | Ga0070676_10025542 | 3300005328 | Bacteria | 3340 |
| 7 | Ga0070670_100039271 | 3300005331 | Bacteria | 4071 |
| 8 | Ga0068869_100060555 | 3300005334 | Bacteria | 2774 |
| 9 | Ga0070689_100045816 | 3300005340 | Bacteria | 3368 |
| 10 | Ga0070687_100431139 | 3300005343 | Bacteria | 872 |
| 11 | Ga0070668_100001277 | 3300005347 | Bacteria | 17996 |
| 12 | Ga0070668_100008768 | 3300005347 | Bacteria | 7511 |
| 13 | Ga0070669_100003008 | 3300005353 | Bacteria | 12142 |
| 14 | Ga0070671_100129395 | 3300005355 | Bacteria | 2126 |
| 15 | Ga0070671_100208639 | 3300005355 | Bacteria | 1657 |
| 16 | Ga0070674_100006002 | 3300005356 | Bacteria | 7060 |
| 17 | Ga0070667_100001332 | 3300005367 | Bacteria | 22171 |
| 18 | Ga0070667_100017767 | 3300005367 | Bacteria | 5895 |
| 19 | Ga0070667_100245238 | 3300005367 | Bacteria | 1600 |
| 20 | Ga0070710_10347966 | 3300005437 | Bacteria | 980 |
| 21 | Ga0070711_100192070 | 3300005439 | Bacteria | 1570 |
| 22 | Ga0070700_100125928 | 3300005441 | Bacteria | 1722 |
| 23 | Ga0070663_100112141 | 3300005455 | Bacteria | 2051 |
| 24 | Ga0070663_100204804 | 3300005455 | Bacteria | 1542 |
| 25 | Ga0070685_10046944 | 3300005466 | Bacteria | 2481 |
| 26 | Ga0070672_100761218 | 3300005543 | Bacteria | 850 |
| 27 | Ga0070686_100131686 | 3300005544 | Bacteria | 1730 |
| 28 | Ga0070695_100490115 | 3300005545 | Bacteria | 949 |
| 29 | Ga0070696_100013172 | 3300005546 | Bacteria | 5547 |
| 30 | Ga0070693_100006817 | 3300005547 | Bacteria | 5550 |
| 31 | Ga0070665_100006590 | 3300005548 | Bacteria | 11804 |
| 32 | Ga0070665_100011884 | 3300005548 | Bacteria | 8792 |
| 33 | Ga0070665_100022656 | 3300005548 | Bacteria | 6324 |
| 34 | Ga0070665_100163917 | 3300005548 | Bacteria | 2225 |
| 35 | Ga0070665_100434081 | 3300005548 | Bacteria | 1323 |
| 36 | Ga0070702_100292913 | 3300005615 | Bacteria | 1122 |
| 37 | Ga0068859_100002678 | 3300005617 | Bacteria | 18089 |
| 38 | Ga0068864_100060551 | 3300005618 | Bacteria | 3278 |
| 39 | Ga0068864_100270312 | 3300005618 | Bacteria | 1584 |
| 40 | Ga0068861_100037730 | 3300005719 | Bacteria | 3592 |
| 41 | Ga0068863_100000205 | 3300005841 | Bacteria | 63387 |
| 42 | Ga0068863_100184020 | 3300005841 | Bacteria | 2006 |
| 43 | Ga0068863_100476868 | 3300005841 | Bacteria | 1226 |
| 44 | Ga0068863_100718004 | 3300005841 | Bacteria | 994 |
| 45 | Ga0068858_100010836 | 3300005842 | Bacteria | 8618 |
| 46 | Ga0068858_100336309 | 3300005842 | Bacteria | 1445 |
| 47 | Ga0068860_100000472 | 3300005843 | Bacteria | 50060 |
| 48 | Ga0068860_100039061 | 3300005843 | Bacteria | 4541 |
| 49 | Ga0068860_100606617 | 3300005843 | Bacteria | 1100 |
| 50 | Ga0068862_100000030 | 3300005844 | Bacteria | 182487 |
| 51 | Ga0081455_10084377 | 3300005937 | Bacteria | 2593 |
| 52 | Ga0081538_10104858 | 3300005981 | Bacteria | 1409 |
| 53 | Ga0075365_10017624 | 3300006038 | Bacteria | 4375 |
| 54 | Ga0075365_10023031 | 3300006038 | Bacteria | 3912 |
| 55 | Ga0075365_10033146 | 3300006038 | Bacteria | 3326 |
| 56 | Ga0075365_10038510 | 3300006038 | Bacteria | 3108 |
| 57 | Ga0075365_10271852 | 3300006038 | Bacteria | 1192 |
| 58 | Ga0075368_10016111 | 3300006042 | Bacteria | 2782 |
| 59 | Ga0075363_100004158 | 3300006048 | Bacteria | 6287 |
| 60 | Ga0075363_100004731 | 3300006048 | Bacteria | 5995 |
| 61 | Ga0075363_100006751 | 3300006048 | Bacteria | 5239 |
| 62 | Ga0075363_100026719 | 3300006048 | Bacteria | 2954 |
| 63 | Ga0075363_100115426 | 3300006048 | Bacteria | 1495 |
| 64 | Ga0075364_10384070 | 3300006051 | Bacteria | 958 |
| 65 | Ga0070715_10044722 | 3300006163 | Bacteria | 1874 |
| 66 | Ga0070716_100079619 | 3300006173 | Bacteria | 1951 |
| 67 | Ga0070712_100023353 | 3300006175 | Bacteria | 4084 |
| 68 | Ga0075362_10042178 | 3300006177 | Bacteria | 2016 |
| 69 | Ga0075362_10164572 | 3300006177 | Bacteria | 1069 |
| 70 | Ga0075362_10206128 | 3300006177 | Bacteria | 958 |
| 71 | Ga0075367_10005972 | 3300006178 | Bacteria | 6115 |
| 72 | Ga0075369_10001825 | 3300006186 | Bacteria | 7426 |
| 73 | Ga0075369_10033814 | 3300006186 | Bacteria | 2168 |
| 74 | Ga0075369_10034375 | 3300006186 | Bacteria | 2151 |
| 75 | Ga0075369_10074588 | 3300006186 | Bacteria | 1497 |
| 76 | Ga0097621_100110012 | 3300006237 | Bacteria | 2328 |
| 77 | Ga0097621_100729744 | 3300006237 | Bacteria | 914 |
| 78 | Ga0075370_10000254 | 3300006353 | Bacteria | 19168 |
| 79 | Ga0075370_10004889 | 3300006353 | Bacteria | 6577 |
| 80 | Ga0075370_10037583 | 3300006353 | Bacteria | 2723 |
| 81 | Ga0075428_100005625 | 3300006844 | Bacteria | 13924 |
| 82 | Ga0075430_100131909 | 3300006846 | Bacteria | 2082 |
| 83 | Ga0075430_100352166 | 3300006846 | Bacteria | 1216 |
| 84 | Ga0075431_100051709 | 3300006847 | Bacteria | 4236 |
| 85 | Ga0075429_100753126 | 3300006880 | Bacteria | 853 |
| 86 | Ga0097620_100002678 | 3300006931 | Bacteria | 18089 |
| 87 | Ga0097620_100029064 | 3300006931 | Bacteria | 5546 |
| 88 | Ga0105245_10009665 | 3300009098 | Bacteria | 8411 |
| 89 | Ga0105245_10194033 | 3300009098 | Bacteria | 1947 |
| 90 | Ga0105245_10698042 | 3300009098 | Bacteria | 1048 |
| 91 | Ga0105247_10000008 | 3300009101 | Bacteria | 391450 |
| 92 | Ga0105247_10045266 | 3300009101 | Bacteria | 2699 |
| 93 | Ga0114129_10056020 | 3300009147 | Bacteria | 5524 |
| 94 | Ga0105243_10093141 | 3300009148 | Bacteria | 2486 |
| 95 | Ga0105243_10888341 | 3300009148 | Bacteria | 885 |
| 96 | Ga0105242_10325922 | 3300009176 | Bacteria | 1410 |
| 97 | Ga0105248_10000257 | 3300009177 | Bacteria | 62094 |
| 98 | Ga0105248_10109395 | 3300009177 | Bacteria | 3116 |
| 99 | Ga0105248_10195187 | 3300009177 | Bacteria | 2281 |
| 100 | Ga0105237_10057664 | 3300009545 | Bacteria | 3886 |
| 101 | Ga0105249_10000036 | 3300009553 | Bacteria | 198578 |
| 102 | Ga0105249_10025752 | 3300009553 | Bacteria | 5298 |
| 103 | Ga0105249_10197317 | 3300009553 | Bacteria | 1968 |
| 104 | Ga0105239_10892533 | 3300010375 | Bacteria | 1020 |
| 105 | Ga0105246_10613808 | 3300011119 | Bacteria | 942 |
| 106 | Ga0157371_10539658 | 3300013102 | Bacteria | 864 |
| 107 | Ga0157374_10111713 | 3300013296 | Bacteria | 2629 |
| 108 | Ga0157374_10843276 | 3300013296 | Bacteria | 933 |
| 109 | Ga0157378_10563173 | 3300013297 | Bacteria | 1146 |
| 110 | Ga0163162_10237539 | 3300013306 | Bacteria | 1953 |
| 111 | Ga0163162_10238530 | 3300013306 | Bacteria | 1949 |
| 112 | Ga0163162_10321802 | 3300013306 | Bacteria | 1679 |
| 113 | Ga0157375_10003762 | 3300013308 | Bacteria | 13159 |
| 114 | Ga0163163_10018730 | 3300014325 | Bacteria | 6488 |
| 115 | Ga0163163_10091094 | 3300014325 | Bacteria | 3063 |
| 116 | Ga0163163_10371720 | 3300014325 | Bacteria | 1487 |
| 117 | Ga0157377_10022444 | 3300014745 | Bacteria | 3332 |
| 118 | Ga0157379_10238255 | 3300014968 | Bacteria | 1650 |
| 119 | Ga0207692_10312090 | 3300025898 | Bacteria | 960 |
| 120 | Ga0207642_10065819 | 3300025899 | Bacteria | 1704 |
| 121 | Ga0207710_10000006 | 3300025900 | Bacteria | 538831 |
| 122 | Ga0207710_10066766 | 3300025900 | Bacteria | 1642 |
| 123 | Ga0207688_10118288 | 3300025901 | Bacteria | 1544 |
| 124 | Ga0207647_10032309 | 3300025904 | Bacteria | 3364 |
| 125 | Ga0207699_10238124 | 3300025906 | Bacteria | 1249 |
| 126 | Ga0207693_10003117 | 3300025915 | Bacteria | 14272 |
| 127 | Ga0207663_10001631 | 3300025916 | Bacteria | 10572 |
| 128 | Ga0207662_10374077 | 3300025918 | Bacteria | 961 |
| 129 | Ga0207652_10342340 | 3300025921 | Bacteria | 1350 |
| 130 | Ga0207681_10013998 | 3300025923 | Bacteria | 4972 |
| 131 | Ga0207681_10440582 | 3300025923 | Bacteria | 1058 |
| 132 | Ga0207681_10486160 | 3300025923 | Bacteria | 1009 |
| 133 | Ga0207694_10143058 | 3300025924 | Bacteria | 1924 |
| 134 | Ga0207694_10705813 | 3300025924 | Bacteria | 851 |
| 135 | Ga0207650_10031817 | 3300025925 | Bacteria | 3812 |
| 136 | Ga0207700_10393625 | 3300025928 | Bacteria | 1213 |
| 137 | Ga0207644_10297792 | 3300025931 | Bacteria | 1299 |
| 138 | Ga0207690_10347417 | 3300025932 | Bacteria | 1172 |
| 139 | Ga0207686_10222562 | 3300025934 | Bacteria | 1363 |
| 140 | Ga0207686_10307084 | 3300025934 | Bacteria | 1180 |
| 141 | Ga0207709_10099122 | 3300025935 | Bacteria | 1923 |
| 142 | Ga0207691_10395628 | 3300025940 | Bacteria | 1179 |
| 143 | Ga0207711_10000269 | 3300025941 | Bacteria | 56180 |
| 144 | Ga0207711_10291273 | 3300025941 | Bacteria | 1505 |
| 145 | Ga0207689_10009543 | 3300025942 | Bacteria | 8371 |
| 146 | Ga0207689_10192710 | 3300025942 | Bacteria | 1682 |
| 147 | Ga0207651_10178296 | 3300025960 | Bacteria | 1683 |
| 148 | Ga0207712_10000036 | 3300025961 | Bacteria | 198586 |
| 149 | Ga0207712_10177804 | 3300025961 | Bacteria | 1669 |
| 150 | Ga0207712_10195944 | 3300025961 | Bacteria | 1598 |
| 151 | Ga0207712_10610281 | 3300025961 | Bacteria | 945 |
| 152 | Ga0207668_10005594 | 3300025972 | Bacteria | 7408 |
| 153 | Ga0207668_10233379 | 3300025972 | Bacteria | 1484 |
| 154 | Ga0207658_10224372 | 3300025986 | Bacteria | 1582 |
| 155 | Ga0207658_10287190 | 3300025986 | Bacteria | 1412 |
| 156 | Ga0207677_10678038 | 3300026023 | Bacteria | 912 |
| 157 | Ga0207703_10251586 | 3300026035 | Bacteria | 1593 |
| 158 | Ga0207639_10099770 | 3300026041 | Bacteria | 2344 |
| 159 | Ga0207678_10213268 | 3300026067 | Bacteria | 1652 |
| 160 | Ga0207708_10037814 | 3300026075 | Bacteria | 3676 |
| 161 | Ga0207641_10000302 | 3300026088 | Bacteria | 61385 |
| 162 | Ga0207641_10375035 | 3300026088 | Bacteria | 1361 |
| 163 | Ga0207676_10011210 | 3300026095 | Bacteria | 6403 |
| 164 | Ga0207676_10180687 | 3300026095 | Bacteria | 1847 |
| 165 | Ga0207675_100077762 | 3300026118 | Bacteria | 3109 |
| 166 | Ga0207675_100198819 | 3300026118 | Bacteria | 1925 |
| 167 | Ga0207683_10007470 | 3300026121 | Bacteria | 9376 |
| 168 | Ga0268266_10005369 | 3300028379 | Bacteria | 11976 |
| 169 | Ga0268266_10010986 | 3300028379 | Bacteria | 7880 |
| 170 | Ga0268265_10000038 | 3300028380 | Bacteria | 198640 |
| 171 | Ga0268264_10000056 | 3300028381 | Bacteria | 310339 |
| 172 | Ga0268264_10687477 | 3300028381 | Bacteria | 1015 |
| 173 | Ga0307413_10030662 | 3300031824 | Bacteria | 3023 |
| 174 | Ga0307410_10094907 | 3300031852 | Bacteria | 2126 |
| 175 | Ga0307409_100002742 | 3300031995 | Bacteria | 9300 |
| 176 | Ga0307416_100045762 | 3300032002 | Bacteria | 3448 |
| 177 | Ga0307415_100030046 | 3300032126 | Bacteria | 3481 |
| 178 | Ga0316582_0387432 | 3300036647 | Bacteria | 962 |
| 179 | Ga0439466_0006944 | 3300041411 | Bacteria | 4292 |
| 180 | Ga0439466_0007799 | 3300041411 | Bacteria | 4044 |
| 181 | Ga0439466_0081625 | 3300041411 | Bacteria | 1019 |
| 182 | Ga0439465_0001544 | 3300041413 | Bacteria | 7491 |
| 183 | Ga0439465_0008737 | 3300041413 | Bacteria | 3194 |
| 184 | Ga0439465_0015037 | 3300041413 | Bacteria | 2415 |
| 185 | Ga0451793_1406742 | 3300041452 | Bacteria | 808 |
| 186 | Ga0451802_0116320 | 3300041460 | Bacteria | 854 |
| 187 | Ga0451853_3301171 | 3300041512 | Bacteria | 1845 |
| 188 | Ga0439431_0006526 | 3300041997 | Bacteria | 2581 |
| 189 | Ga0439445_0006137 | 3300042004 | Bacteria | 2756 |
| 190 | Ga0439434_0079888 | 3300042435 | Bacteria | 1037 |
| 191 | Ga0439435_0049430 | 3300042436 | Bacteria | 1200 |
| 192 | Ga0466972_0034399 | 3300044658 | Bacteria | 2483 |
| 193 | Ga0466972_0043166 | 3300044658 | Bacteria | 2190 |
| 194 | Ga0466972_0186275 | 3300044658 | Bacteria | 973 |
| 195 | Ga0466965_0028299 | 3300044683 | Bacteria | 2722 |
| 196 | Ga0466966_0047109 | 3300044684 | Bacteria | 2750 |
| 197 | Ga0466961_0016825 | 3300044693 | Bacteria | 4701 |
| 198 | Ga0466963_0571925 | 3300044694 | Bacteria | 798 |
| 199 | Ga0466968_0012871 | 3300044735 | Bacteria | 3282 |
| 200 | Ga0466970_0050385 | 3300044765 | Bacteria | 2221 |
| 201 | Ga0466970_0133231 | 3300044765 | Bacteria | 1366 |
| 202 | Ga0466970_0272223 | 3300044765 | Bacteria | 951 |
| 203 | Ga0466957_0010035 | 3300044842 | Bacteria | 5419 |
| 204 | Ga0466957_0029927 | 3300044842 | Bacteria | 3249 |
| 205 | Ga0466957_0187221 | 3300044842 | Bacteria | 1354 |
| 206 | Ga0466960_0000816 | 3300044901 | Bacteria | 10955 |
| 207 | Ga0466959_0036074 | 3300045049 | Bacteria | 3654 |
| 208 | Ga0466958_0027859 | 3300045836 | Bacteria | 3345 |
| 209 | Ga0466967_0008926 | 3300045976 | Bacteria | 7400 |
| 210 | Ga0466967_0010259 | 3300045976 | Bacteria | 7012 |
| 211 | Ga0466967_0016026 | 3300045976 | Bacteria | 5896 |
| 212 | Ga0466967_0438442 | 3300045976 | Bacteria | 1275 |
| 213 | Ga0466967_0669236 | 3300045976 | Bacteria | 1027 |
| 214 | Ga0495638_0011184 | 3300046460 | Bacteria | 6197 |
| 215 | Ga0495641_0011170 | 3300046461 | Bacteria | 5140 |
| 216 | Ga0495641_0167507 | 3300046461 | Bacteria | 983 |
| 217 | Ga0495662_0019947 | 3300046476 | Bacteria | 3243 |
| 218 | Ga0495630_0238292 | 3300046517 | Bacteria | 1390 |
| 219 | Ga0495640_0232083 | 3300046533 | Bacteria | 1160 |
| 220 | Ga0495588_0233640 | 3300046674 | Bacteria | 970 |
| 221 | Ga0495658_0009432 | 3300046683 | Bacteria | 4865 |
| 222 | Ga0495613_0106995 | 3300046689 | Bacteria | 2018 |
| 223 | Ga0495624_0046431 | 3300046690 | Bacteria | 2761 |
| 224 | Ga0495649_0071231 | 3300046694 | Bacteria | 1863 |
| 225 | Ga0495581_0084836 | 3300047315 | Bacteria | 1836 |
| 226 | Ga0495674_0040261 | 3300047319 | Bacteria | 4181 |
| 227 | Ga0495676_0094974 | 3300047321 | Bacteria | 2220 |
| 228 | Ga0495593_0005817 | 3300047673 | Bacteria | 7271 |
| 229 | Ga0496100_0001105 | 3300048903 | Bacteria | 13060 |
| 230 | Ga0496100_0057129 | 3300048903 | Bacteria | 2555 |
| 231 | Ga0496100_0553133 | 3300048903 | Bacteria | 890 |
| 232 | Ga0496101_0000254 | 3300048904 | Bacteria | 38224 |
| 233 | Ga0496101_0002552 | 3300048904 | Bacteria | 11172 |
| 234 | Ga0496102_0000973 | 3300048905 | Bacteria | 26960 |
| 235 | Ga0496102_0013106 | 3300048905 | Bacteria | 7173 |
| 236 | Ga0496102_0014834 | 3300048905 | Bacteria | 6778 |
| 237 | Ga0496102_0043266 | 3300048905 | Bacteria | 4083 |
| 238 | Ga0496102_0361988 | 3300048905 | Bacteria | 1366 |
| 239 | Ga0496103_0009564 | 3300048906 | Bacteria | 5739 |
| 240 | Ga0496103_0041478 | 3300048906 | Bacteria | 2829 |
| 241 | Ga0496103_0190197 | 3300048906 | Bacteria | 1320 |
| 242 | Ga0496104_0002159 | 3300048907 | Bacteria | 17073 |
| 243 | Ga0496104_0004575 | 3300048907 | Bacteria | 12055 |
| 244 | Ga0496104_0124972 | 3300048907 | Bacteria | 2470 |
| 245 | Ga0496105_0004735 | 3300048908 | Bacteria | 10268 |
| 246 | Ga0496105_0033681 | 3300048908 | Bacteria | 4209 |
| 247 | Ga0496105_0048688 | 3300048908 | Bacteria | 3499 |
| 248 | Ga0496106_0000576 | 3300048909 | Bacteria | 26204 |
| 249 | Ga0496107_0010741 | 3300048910 | Bacteria | 6369 |
| 250 | Ga0496107_0104137 | 3300048910 | Bacteria | 2082 |
| 251 | Ga0496108_0000189 | 3300048911 | Bacteria | 57428 |
| 252 | Ga0496108_0218983 | 3300048911 | Bacteria | 1654 |
| 253 | Ga0496108_0595535 | 3300048911 | Bacteria | 963 |
| 254 | Ga0496108_0866375 | 3300048911 | Bacteria | 777 |
| 255 | Ga0496109_0333196 | 3300048912 | Bacteria | 1433 |
| 256 | Ga0496109_0398949 | 3300048912 | Bacteria | 1299 |
| 257 | Ga0496111_0041170 | 3300048914 | Bacteria | 3315 |
| 258 | Ga0496112_0096296 | 3300048915 | Bacteria | 2930 |
| 259 | Ga0496112_0169996 | 3300048915 | Bacteria | 2145 |
| 260 | Ga0496113_0139858 | 3300048916 | Bacteria | 1904 |
| 261 | Ga0496113_0217123 | 3300048916 | Bacteria | 1523 |
| 262 | Ga0496113_0406070 | 3300048916 | Bacteria | 1094 |
| 263 | Ga0496114_0001381 | 3300048917 | Bacteria | 18383 |
| 264 | Ga0496114_0153857 | 3300048917 | Bacteria | 1996 |
| 265 | Ga0496114_0653313 | 3300048917 | Bacteria | 925 |
| 266 | Ga0496115_0000976 | 3300048918 | Bacteria | 20773 |
| 267 | Ga0496115_0581516 | 3300048918 | Bacteria | 892 |
| 268 | Ga0496115_0665154 | 3300048918 | Bacteria | 822 |
| 269 | Ga0496115_0707608 | 3300048918 | Bacteria | 791 |
| 270 | Ga0496117_0002095 | 3300048920 | Bacteria | 26250 |
| 271 | Ga0496118_0022063 | 3300048921 | Bacteria | 5581 |
| 272 | Ga0496119_0004258 | 3300048922 | Bacteria | 14344 |
| 273 | Ga0496120_0080020 | 3300048923 | Bacteria | 1772 |
| 274 | Ga0496121_0033508 | 3300048924 | Bacteria | 4646 |
| 275 | Ga0496122_0044641 | 3300048925 | Bacteria | 3455 |
| 276 | Ga0496123_0011261 | 3300048926 | Bacteria | 7774 |
| 277 | Ga0496124_0052441 | 3300048927 | Bacteria | 3464 |
| 278 | Ga0496125_0050715 | 3300048928 | Bacteria | 3432 |
| 279 | Ga0496126_0003940 | 3300048929 | Bacteria | 18168 |
| 280 | Ga0501034_0146205 | 3300049571 | Bacteria | 2341 |
| 281 | Ga0501070_0307709 | 3300049586 | Bacteria | 1290 |
| 282 | Ga0501073_0269603 | 3300049589 | Bacteria | 1175 |
| 283 | nmdc:mga03683_153290_c1 | 3300050489 | Bacteria | 1041 |
| 284 | nmdc:mga03n38_101639_c1 | 3300050490 | Bacteria | 1387 |
| 285 | nmdc:mga03n38_152042_c1 | 3300050490 | Bacteria | 1165 |
| 286 | nmdc:mga03n38_30323_c1 | 3300050490 | Bacteria | 2273 |
| 287 | nmdc:mga03n38_365183_c1 | 3300050490 | Bacteria | 788 |
| 288 | nmdc:mga03n38_4236_c1 | 3300050490 | Bacteria | 4720 |
| 289 | nmdc:mga03n38_7762_c1 | 3300050490 | Bacteria | 3808 |
| 290 | nmdc:mga00v17_206348_c1 | 3300050491 | Bacteria | 1271 |
| 291 | nmdc:mga00v17_22674_c1 | 3300050491 | Bacteria | 3625 |
| 292 | nmdc:mga00v17_24032_c1 | 3300050491 | Bacteria | 3531 |
| 293 | nmdc:mga00v17_73789_c1 | 3300050491 | Bacteria | 2119 |
| 294 | nmdc:mga0yw44_10299_c1 | 3300050492 | Bacteria | 4769 |
| 295 | nmdc:mga0yw44_2052_c1 | 3300050492 | Bacteria | 8403 |
| 296 | nmdc:mga0yw44_36571_c1 | 3300050492 | Bacteria | 2894 |
| 297 | nmdc:mga06z11_193428_c1 | 3300050494 | Bacteria | 1178 |
| 298 | nmdc:mga07m45_18605_c1 | 3300050496 | Bacteria | 3754 |
| 299 | nmdc:mga07m45_231165_c1 | 3300050496 | Bacteria | 1076 |
| 300 | nmdc:mga07m45_37787_c1 | 3300050496 | Bacteria | 2693 |
| 301 | nmdc:mga05p37_126442_c1 | 3300050507 | Bacteria | 3139 |
| 302 | nmdc:mga0qj67_139377_c1 | 3300050509 | Bacteria | 1966 |
| 303 | nmdc:mga0qj67_273207_c1 | 3300050509 | Bacteria | 1370 |
| 304 | nmdc:mga0sz30_3030_c1 | 3300050516 | Bacteria | 2530 |
| 305 | nmdc:mga0sz30_3140_c2 | 3300050516 | Bacteria | 5245 |
| 306 | Ga0500610_0014931 | 3300053079 | Bacteria | 3660 |
| 307 | Ga0500635_0112955 | 3300053080 | Bacteria | 1011 |
| 308 | Ga0500578_0172469 | 3300053086 | Bacteria | 1337 |
| 309 | Ga0500643_001418 | 3300053087 | Bacteria | 13845 |
| 310 | Ga0500556_0002277 | 3300053104 | Bacteria | 6338 |
| 311 | Ga0500562_085114 | 3300053108 | Bacteria | 856 |
| 312 | Ga0500608_092995 | 3300053122 | Bacteria | 1407 |
| 313 | Ga0500652_023729 | 3300053131 | Bacteria | 2335 |
| 314 | Ga0500559_0099812 | 3300053136 | Bacteria | 1337 |
| 315 | Ga0500588_0173055 | 3300053146 | Bacteria | 791 |
| 316 | Ga0500620_052164 | 3300053155 | Bacteria | 1374 |
| 317 | Ga0500627_0014225 | 3300053158 | Bacteria | 3042 |
| 318 | Ga0500645_000006 | 3300053730 | Bacteria | 276677 |
| 319 | Ga0500645_047550 | 3300053730 | Bacteria | 1257 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_10194033 | Ga0105245_101940332 | 176 |
| 2 | 3300041452 | Ga0451793_1406742 | Ga0451793_1406742_54_677 | 176 |
| 3 | 3300041512 | Ga0451853_3301171 | Ga0451853_3301171_707_1330 | 176 |
| 4 | 3300009177 | Ga0105248_10195187 | Ga0105248_101951872 | 177 |
| 5 | 3300005437 | Ga0070710_10347966 | Ga0070710_103479661 | 178 |
| 6 | 3300025898 | Ga0207692_10312090 | Ga0207692_103120901 | 178 |
| 7 | 3300036647 | Ga0316582_0387432 | Ga0316582_0387432_147_842 | 179 |
| 8 | 3300013306 | Ga0163162_10238530 | Ga0163162_102385302 | 180 |
| 9 | 3300048911 | Ga0496108_0866375 | Ga0496108_0866375_77_652 | 180 |
| 10 | 3300053730 | Ga0500645_047550 | Ga0500645_047550_154_753 | 180 |
| 11 | 3300045976 | Ga0466967_0008926 | Ga0466967_0008926_666_1346 | 181 |
| 12 | 3300041411 | Ga0439466_0007799 | Ga0439466_0007799_1761_2351 | 182 |
| 13 | 3300041413 | Ga0439465_0001544 | Ga0439465_0001544_2515_3105 | 182 |
| 14 | 3300042004 | Ga0439445_0006137 | Ga0439445_0006137_1880_2470 | 182 |
| 15 | 3300005355 | Ga0070671_100129395 | Ga0070671_1001293951 | 183 |
| 16 | 3300025961 | Ga0207712_10177804 | Ga0207712_101778041 | 185 |
| 17 | 3300044684 | Ga0466966_0047109 | Ga0466966_0047109_543_1121 | 186 |
| 18 | 3300044693 | Ga0466961_0016825 | Ga0466961_0016825_2338_2916 | 186 |
| 19 | 3300044694 | Ga0466963_0571925 | Ga0466963_0571925_170_748 | 186 |
| 20 | 3300044842 | Ga0466957_0029927 | Ga0466957_0029927_539_1117 | 186 |
| 21 | 3300045049 | Ga0466959_0036074 | Ga0466959_0036074_413_991 | 186 |
| 22 | 3300045836 | Ga0466958_0027859 | Ga0466958_0027859_2278_2856 | 186 |
| 23 | 3300006038 | Ga0075365_10017624 | Ga0075365_100176243 | 187 |
| 24 | 3300009545 | Ga0105237_10057664 | Ga0105237_100576644 | 187 |
| 25 | 3300050492 | nmdc:mga0yw44_2052_c1 | nmdc:mga0yw44_2052_c1_5161_5781 | 187 |
| 26 | 3300048916 | Ga0496113_0406070 | Ga0496113_0406070_208_831 | 188 |
| 27 | 3300053080 | Ga0500635_0112955 | Ga0500635_0112955_325_948 | 188 |
| 28 | 3300053086 | Ga0500578_0172469 | Ga0500578_0172469_226_849 | 188 |
| 29 | 3300053087 | Ga0500643_001418 | Ga0500643_001418_6760_7383 | 188 |
| 30 | 3300053131 | Ga0500652_023729 | Ga0500652_023729_397_1020 | 188 |
| 31 | 3300053146 | Ga0500588_0173055 | Ga0500588_0173055_71_694 | 188 |
| 32 | 3300053158 | Ga0500627_0014225 | Ga0500627_0014225_188_811 | 188 |
| 33 | 3300053730 | Ga0500645_000006 | Ga0500645_000006_214404_215027 | 188 |
| 34 | 3300005353 | Ga0070669_100003008 | Ga0070669_1000030086 | 189 |
| 35 | 3300005367 | Ga0070667_100001332 | Ga0070667_10000133216 | 189 |
| 36 | 3300005548 | Ga0070665_100022656 | Ga0070665_1000226562 | 189 |
| 37 | 3300005617 | Ga0068859_100002678 | Ga0068859_1000026782 | 189 |
| 38 | 3300005618 | Ga0068864_100270312 | Ga0068864_1002703122 | 189 |
| 39 | 3300005843 | Ga0068860_100000472 | Ga0068860_10000047238 | 189 |
| 40 | 3300006931 | Ga0097620_100002678 | Ga0097620_1000026782 | 189 |
| 41 | 3300009101 | Ga0105247_10000008 | Ga0105247_1000000883 | 189 |
| 42 | 3300009177 | Ga0105248_10000257 | Ga0105248_100002576 | 189 |
| 43 | 3300009553 | Ga0105249_10000036 | Ga0105249_1000003685 | 189 |
| 44 | 3300025900 | Ga0207710_10000006 | Ga0207710_10000006464 | 189 |
| 45 | 3300025923 | Ga0207681_10013998 | Ga0207681_100139983 | 189 |
| 46 | 3300025941 | Ga0207711_10000269 | Ga0207711_100002696 | 189 |
| 47 | 3300025961 | Ga0207712_10000036 | Ga0207712_1000003682 | 189 |
| 48 | 3300025986 | Ga0207658_10224372 | Ga0207658_102243722 | 189 |
| 49 | 3300026095 | Ga0207676_10180687 | Ga0207676_101806873 | 189 |
| 50 | 3300028381 | Ga0268264_10000056 | Ga0268264_100000566 | 189 |
| 51 | 3300048903 | Ga0496100_0057129 | Ga0496100_0057129_168_917 | 189 |
| 52 | 3300048904 | Ga0496101_0002552 | Ga0496101_0002552_6196_6945 | 189 |
| 53 | 3300048905 | Ga0496102_0000973 | Ga0496102_0000973_23587_24336 | 189 |
| 54 | 3300048906 | Ga0496103_0009564 | Ga0496103_0009564_1340_2089 | 189 |
| 55 | 3300048910 | Ga0496107_0104137 | Ga0496107_0104137_943_1692 | 189 |
| 56 | 3300048920 | Ga0496117_0002095 | Ga0496117_0002095_2352_3101 | 189 |
| 57 | 3300048921 | Ga0496118_0022063 | Ga0496118_0022063_2360_3109 | 189 |
| 58 | 3300048922 | Ga0496119_0004258 | Ga0496119_0004258_13171_13920 | 189 |
| 59 | 3300048923 | Ga0496120_0080020 | Ga0496120_0080020_366_1115 | 189 |
| 60 | 3300048924 | Ga0496121_0033508 | Ga0496121_0033508_2760_3509 | 189 |
| 61 | 3300048928 | Ga0496125_0050715 | Ga0496125_0050715_892_1641 | 189 |
| 62 | 3300005328 | Ga0070676_10025542 | Ga0070676_100255422 | 190 |
| 63 | 3300005340 | Ga0070689_100045816 | Ga0070689_1000458163 | 190 |
| 64 | 3300005347 | Ga0070668_100008768 | Ga0070668_1000087683 | 190 |
| 65 | 3300005356 | Ga0070674_100006002 | Ga0070674_1000060025 | 190 |
| 66 | 3300005547 | Ga0070693_100006817 | Ga0070693_1000068171 | 190 |
| 67 | 3300006163 | Ga0070715_10044722 | Ga0070715_100447223 | 190 |
| 68 | 3300006237 | Ga0097621_100110012 | Ga0097621_1001100122 | 190 |
| 69 | 3300009177 | Ga0105248_10109395 | Ga0105248_101093952 | 190 |
| 70 | 3300014968 | Ga0157379_10238255 | Ga0157379_102382552 | 190 |
| 71 | 3300025900 | Ga0207710_10066766 | Ga0207710_100667661 | 190 |
| 72 | 3300025921 | Ga0207652_10342340 | Ga0207652_103423402 | 190 |
| 73 | 3300025923 | Ga0207681_10440582 | Ga0207681_104405821 | 190 |
| 74 | 3300025924 | Ga0207694_10143058 | Ga0207694_101430582 | 190 |
| 75 | 3300025932 | Ga0207690_10347417 | Ga0207690_103474171 | 190 |
| 76 | 3300025934 | Ga0207686_10307084 | Ga0207686_103070841 | 190 |
| 77 | 3300025935 | Ga0207709_10099122 | Ga0207709_100991221 | 190 |
| 78 | 3300025942 | Ga0207689_10192710 | Ga0207689_101927101 | 190 |
| 79 | 3300025960 | Ga0207651_10178296 | Ga0207651_101782961 | 190 |
| 80 | 3300025961 | Ga0207712_10610281 | Ga0207712_106102811 | 190 |
| 81 | 3300025972 | Ga0207668_10233379 | Ga0207668_102333791 | 190 |
| 82 | 3300041460 | Ga0451802_0116320 | Ga0451802_0116320_194_796 | 190 |
| 83 | 3300048903 | Ga0496100_0001105 | Ga0496100_0001105_12136_12774 | 190 |
| 84 | 3300048909 | Ga0496106_0000576 | Ga0496106_0000576_21589_22227 | 190 |
| 85 | 3300048910 | Ga0496107_0010741 | Ga0496107_0010741_2233_2871 | 190 |
| 86 | 3300048912 | Ga0496109_0333196 | Ga0496109_0333196_327_965 | 190 |
| 87 | 3300048917 | Ga0496114_0001381 | Ga0496114_0001381_11574_12212 | 190 |
| 88 | 3300011119 | Ga0105246_10613808 | Ga0105246_106138082 | 191 |
| 89 | 3300013296 | Ga0157374_10843276 | Ga0157374_108432762 | 191 |
| 90 | 3300028381 | Ga0268264_10687477 | Ga0268264_106874771 | 191 |
| 91 | 3300005981 | Ga0081538_10104858 | Ga0081538_101048581 | 192 |
| 92 | 3300009148 | Ga0105243_10888341 | Ga0105243_108883411 | 192 |
| 93 | 3300009553 | Ga0105249_10025752 | Ga0105249_100257524 | 192 |
| 94 | 3300048904 | Ga0496101_0000254 | Ga0496101_0000254_15210_15848 | 192 |
| 95 | 3300048907 | Ga0496104_0002159 | Ga0496104_0002159_11022_11660 | 192 |
| 96 | 3300048908 | Ga0496105_0004735 | Ga0496105_0004735_8881_9519 | 192 |
| 97 | 3300048918 | Ga0496115_0000976 | Ga0496115_0000976_9042_9680 | 192 |
| 98 | 3300025924 | Ga0207694_10705813 | Ga0207694_107058131 | 193 |
| 99 | 3300049571 | Ga0501034_0146205 | Ga0501034_0146205_1311_1985 | 193 |
| 100 | 3300053079 | Ga0500610_0014931 | Ga0500610_0014931_230_871 | 194 |
| 101 | 3300003320 | rootH2_10028555 | rootH2_100285555 | 195 |
| 102 | 3300005367 | Ga0070667_100017767 | Ga0070667_1000177675 | 195 |
| 103 | 3300005544 | Ga0070686_100131686 | Ga0070686_1001316862 | 195 |
| 104 | 3300005548 | Ga0070665_100006590 | Ga0070665_10000659014 | 195 |
| 105 | 3300006048 | Ga0075363_100006751 | Ga0075363_1000067512 | 195 |
| 106 | 3300006353 | Ga0075370_10004889 | Ga0075370_100048892 | 195 |
| 107 | 3300014325 | Ga0163163_10018730 | Ga0163163_100187304 | 195 |
| 108 | 3300028379 | Ga0268266_10005369 | Ga0268266_1000536914 | 195 |
| 109 | 3300045976 | Ga0466967_0010259 | Ga0466967_0010259_3385_3978 | 195 |
| 110 | 3300048903 | Ga0496100_0553133 | Ga0496100_0553133_142_837 | 195 |
| 111 | 3300048905 | Ga0496102_0014834 | Ga0496102_0014834_403_1098 | 195 |
| 112 | 3300048906 | Ga0496103_0041478 | Ga0496103_0041478_874_1569 | 195 |
| 113 | 3300048907 | Ga0496104_0004575 | Ga0496104_0004575_6449_7144 | 195 |
| 114 | 3300048911 | Ga0496108_0218983 | Ga0496108_0218983_609_1304 | 195 |
| 115 | 3300048914 | Ga0496111_0041170 | Ga0496111_0041170_2046_2741 | 195 |
| 116 | 3300048915 | Ga0496112_0169996 | Ga0496112_0169996_1387_1995 | 195 |
| 117 | 3300048916 | Ga0496113_0217123 | Ga0496113_0217123_204_812 | 195 |
| 118 | 3300048918 | Ga0496115_0665154 | Ga0496115_0665154_67_675 | 195 |
| 119 | 3300048925 | Ga0496122_0044641 | Ga0496122_0044641_2837_3445 | 195 |
| 120 | 3300048926 | Ga0496123_0011261 | Ga0496123_0011261_783_1391 | 195 |
| 121 | 3300048929 | Ga0496126_0003940 | Ga0496126_0003940_5453_6061 | 195 |
| 122 | 3300050490 | nmdc:mga03n38_30323_c1 | nmdc:mga03n38_30323_c1_1200_1817 | 195 |
| 123 | 3300050496 | nmdc:mga07m45_18605_c1 | nmdc:mga07m45_18605_c1_2521_3138 | 195 |
| 124 | 3300005343 | Ga0070687_100431139 | Ga0070687_1004311392 | 196 |
| 125 | 3300005615 | Ga0070702_100292913 | Ga0070702_1002929131 | 196 |
| 126 | 3300006038 | Ga0075365_10038510 | Ga0075365_100385101 | 196 |
| 127 | 3300006048 | Ga0075363_100026719 | Ga0075363_1000267191 | 196 |
| 128 | 3300006177 | Ga0075362_10042178 | Ga0075362_100421782 | 196 |
| 129 | 3300009098 | Ga0105245_10009665 | Ga0105245_100096658 | 196 |
| 130 | 3300010375 | Ga0105239_10892533 | Ga0105239_108925332 | 196 |
| 131 | 3300013297 | Ga0157378_10563173 | Ga0157378_105631732 | 196 |
| 132 | 3300013308 | Ga0157375_10003762 | Ga0157375_100037626 | 196 |
| 133 | 3300014325 | Ga0163163_10371720 | Ga0163163_103717202 | 196 |
| 134 | 3300014745 | Ga0157377_10022444 | Ga0157377_100224441 | 196 |
| 135 | 3300025923 | Ga0207681_10486160 | Ga0207681_104861601 | 196 |
| 136 | 3300046460 | Ga0495638_0011184 | Ga0495638_0011184_5031_5645 | 196 |
| 137 | 3300046461 | Ga0495641_0167507 | Ga0495641_0167507_14_742 | 196 |
| 138 | 3300048905 | Ga0496102_0013106 | Ga0496102_0013106_5014_5622 | 196 |
| 139 | 3300048907 | Ga0496104_0124972 | Ga0496104_0124972_1613_2221 | 196 |
| 140 | 3300048908 | Ga0496105_0048688 | Ga0496105_0048688_2364_2972 | 196 |
| 141 | 3300048911 | Ga0496108_0000189 | Ga0496108_0000189_50105_50713 | 196 |
| 142 | 3300048915 | Ga0496112_0096296 | Ga0496112_0096296_303_911 | 196 |
| 143 | 3300048916 | Ga0496113_0139858 | Ga0496113_0139858_592_1200 | 196 |
| 144 | 3300048918 | Ga0496115_0707608 | Ga0496115_0707608_35_643 | 196 |
| 145 | 3300053104 | Ga0500556_0002277 | Ga0500556_0002277_178_792 | 196 |
| 146 | 3300053108 | Ga0500562_085114 | Ga0500562_085114_177_791 | 196 |
| 147 | 3300045976 | Ga0466967_0669236 | Ga0466967_0669236_337_993 | 197 |
| 148 | 3300050490 | nmdc:mga03n38_101639_c1 | nmdc:mga03n38_101639_c1_234_851 | 197 |
| 149 | 3300050490 | nmdc:mga03n38_152042_c1 | nmdc:mga03n38_152042_c1_532_1149 | 197 |
| 150 | 3300006038 | Ga0075365_10023031 | Ga0075365_100230313 | 198 |
| 151 | 3300006038 | Ga0075365_10271852 | Ga0075365_102718521 | 198 |
| 152 | 3300006048 | Ga0075363_100004731 | Ga0075363_1000047313 | 198 |
| 153 | 3300006051 | Ga0075364_10384070 | Ga0075364_103840702 | 198 |
| 154 | 3300006177 | Ga0075362_10164572 | Ga0075362_101645721 | 198 |
| 155 | 3300006177 | Ga0075362_10206128 | Ga0075362_102061281 | 198 |
| 156 | 3300006186 | Ga0075369_10074588 | Ga0075369_100745882 | 198 |
| 157 | 3300006353 | Ga0075370_10037583 | Ga0075370_100375832 | 198 |
| 158 | 3300031824 | Ga0307413_10030662 | Ga0307413_100306622 | 198 |
| 159 | 3300031995 | Ga0307409_100002742 | Ga0307409_1000027426 | 198 |
| 160 | 3300032002 | Ga0307416_100045762 | Ga0307416_1000457623 | 198 |
| 161 | 3300032126 | Ga0307415_100030046 | Ga0307415_1000300463 | 198 |
| 162 | 3300050489 | nmdc:mga03683_153290_c1 | nmdc:mga03683_153290_c1_303_935 | 198 |
| 163 | 3300050490 | nmdc:mga03n38_7762_c1 | nmdc:mga03n38_7762_c1_3118_3723 | 198 |
| 164 | 3300050491 | nmdc:mga00v17_206348_c1 | nmdc:mga00v17_206348_c1_301_930 | 198 |
| 165 | 3300050491 | nmdc:mga00v17_24032_c1 | nmdc:mga00v17_24032_c1_84_689 | 198 |
| 166 | 3300050492 | nmdc:mga0yw44_10299_c1 | nmdc:mga0yw44_10299_c1_3650_4255 | 198 |
| 167 | 3300050496 | nmdc:mga07m45_37787_c1 | nmdc:mga07m45_37787_c1_1236_1841 | 198 |
| 168 | iso_pu_bacteria | 2902799365 | 2902804591 | 198 |
| 169 | 3300005455 | Ga0070663_100204804 | Ga0070663_1002048042 | 199 |
| 170 | 3300013306 | Ga0163162_10321802 | Ga0163162_103218023 | 199 |
| 171 | 3300048905 | Ga0496102_0043266 | Ga0496102_0043266_550_1233 | 199 |
| 172 | 3300048906 | Ga0496103_0190197 | Ga0496103_0190197_466_1149 | 199 |
| 173 | 3300050494 | nmdc:mga06z11_193428_c1 | nmdc:mga06z11_193428_c1_51_734 | 199 |
| 174 | iso_pu_bacteria | 2738541274 | 2738704196 | 199 |
| 175 | iso_pu_bacteria | 2738543028 | 2739331320 | 199 |
| 176 | 3300005466 | Ga0070685_10046944 | Ga0070685_100469442 | 200 |
| 177 | 3300005546 | Ga0070696_100013172 | Ga0070696_1000131725 | 200 |
| 178 | 3300025904 | Ga0207647_10032309 | Ga0207647_100323092 | 200 |
| 179 | 3300025928 | Ga0207700_10393625 | Ga0207700_103936251 | 200 |
| 180 | 3300026118 | Ga0207675_100198819 | Ga0207675_1001988194 | 200 |
| 181 | 3300044658 | Ga0466972_0034399 | Ga0466972_0034399_1319_2014 | 200 |
| 182 | 3300044765 | Ga0466970_0133231 | Ga0466970_0133231_458_1081 | 200 |
| 183 | 3300050496 | nmdc:mga07m45_231165_c1 | nmdc:mga07m45_231165_c1_314_997 | 200 |
| 184 | 3300005841 | Ga0068863_100000205 | Ga0068863_1000002052 | 201 |
| 185 | 3300005842 | Ga0068858_100336309 | Ga0068858_1003363092 | 201 |
| 186 | 3300005844 | Ga0068862_100000030 | Ga0068862_10000003067 | 201 |
| 187 | 3300014325 | Ga0163163_10091094 | Ga0163163_100910942 | 201 |
| 188 | 3300026035 | Ga0207703_10251586 | Ga0207703_102515862 | 201 |
| 189 | 3300026088 | Ga0207641_10000302 | Ga0207641_1000030242 | 201 |
| 190 | 3300028380 | Ga0268265_10000038 | Ga0268265_1000003883 | 201 |
| 191 | 3300048917 | Ga0496114_0653313 | Ga0496114_0653313_107_856 | 201 |
| 192 | 3300048927 | Ga0496124_0052441 | Ga0496124_0052441_2625_3374 | 201 |
| 193 | 3300053155 | Ga0500620_052164 | Ga0500620_052164_286_1035 | 201 |
| 194 | 3300005719 | Ga0068861_100037730 | Ga0068861_1000377304 | 202 |
| 195 | 3300006880 | Ga0075429_100753126 | Ga0075429_1007531261 | 202 |
| 196 | 3300009553 | Ga0105249_10197317 | Ga0105249_101973173 | 202 |
| 197 | 3300013306 | Ga0163162_10237539 | Ga0163162_102375392 | 202 |
| 198 | 3300025961 | Ga0207712_10195944 | Ga0207712_101959442 | 202 |
| 199 | 3300026023 | Ga0207677_10678038 | Ga0207677_106780381 | 202 |
| 200 | 3300026118 | Ga0207675_100077762 | Ga0207675_1000777623 | 202 |
| 201 | 3300049586 | Ga0501070_0307709 | Ga0501070_0307709_558_1184 | 202 |
| 202 | 3300005841 | Ga0068863_100718004 | Ga0068863_1007180042 | 203 |
| 203 | 3300042436 | Ga0439435_0049430 | Ga0439435_0049430_214_837 | 203 |
| 204 | 3300050516 | nmdc:mga0sz30_3030_c1 | nmdc:mga0sz30_3030_c1_558_1181 | 203 |
| 205 | 3300053122 | Ga0500608_092995 | Ga0500608_092995_568_1239 | 203 |
| 206 | 3300053136 | Ga0500559_0099812 | Ga0500559_0099812_27_698 | 203 |
| 207 | 3300025901 | Ga0207688_10118288 | Ga0207688_101182886 | 204 |
| 208 | 3300048905 | Ga0496102_0361988 | Ga0496102_0361988_625_1323 | 204 |
| 209 | 3300048911 | Ga0496108_0595535 | Ga0496108_0595535_61_759 | 204 |
| 210 | 3300048912 | Ga0496109_0398949 | Ga0496109_0398949_558_1256 | 204 |
| 211 | 3300048917 | Ga0496114_0153857 | Ga0496114_0153857_124_822 | 204 |
| 212 | 3300005543 | Ga0070672_100761218 | Ga0070672_1007612181 | 205 |
| 213 | 3300005548 | Ga0070665_100163917 | Ga0070665_1001639173 | 205 |
| 214 | 3300005841 | Ga0068863_100476868 | Ga0068863_1004768682 | 205 |
| 215 | 3300005843 | Ga0068860_100606617 | Ga0068860_1006066172 | 205 |
| 216 | 3300006186 | Ga0075369_10001825 | Ga0075369_100018255 | 205 |
| 217 | 3300025941 | Ga0207711_10291273 | Ga0207711_102912732 | 205 |
| 218 | 3300026088 | Ga0207641_10375035 | Ga0207641_103750351 | 205 |
| 219 | 3300050516 | nmdc:mga0sz30_3140_c2 | nmdc:mga0sz30_3140_c2_2117_2764 | 205 |
| 220 | 3300041411 | Ga0439466_0081625 | Ga0439466_0081625_351_992 | 206 |
| 221 | 3300050491 | nmdc:mga00v17_22674_c1 | nmdc:mga00v17_22674_c1_2679_3362 | 206 |
| 222 | 3300005439 | Ga0070711_100192070 | Ga0070711_1001920702 | 207 |
| 223 | 3300050507 | nmdc:mga05p37_126442_c1 | nmdc:mga05p37_126442_c1_2147_2863 | 207 |
| 224 | 3300025986 | Ga0207658_10287190 | Ga0207658_102871902 | 208 |
| 225 | 3300044842 | Ga0466957_0187221 | Ga0466957_0187221_317_973 | 208 |
| 226 | iso_pu_bacteria | 2842134933 | 2842135337 | 209 |
| 227 | 3300025925 | Ga0207650_10031817 | Ga0207650_100318174 | 211 |
| 228 | 3300005331 | Ga0070670_100039271 | Ga0070670_1000392714 | 212 |
| 229 | 3300046533 | Ga0495640_0232083 | Ga0495640_0232083_255_929 | 212 |
| 230 | 3300048908 | Ga0496105_0033681 | Ga0496105_0033681_1058_1753 | 212 |
| 231 | 3300049589 | Ga0501073_0269603 | Ga0501073_0269603_161_832 | 212 |
| 232 | 3300048918 | Ga0496115_0581516 | Ga0496115_0581516_164_835 | 214 |
| 233 | 3300006186 | Ga0075369_10033814 | Ga0075369_100338141 | 215 |
| 234 | 3300006186 | Ga0075369_10034375 | Ga0075369_100343752 | 216 |
| 235 | 3300006844 | Ga0075428_100005625 | Ga0075428_1000056252 | 216 |
| 236 | 3300006846 | Ga0075430_100352166 | Ga0075430_1003521662 | 216 |
| 237 | 3300006847 | Ga0075431_100051709 | Ga0075431_1000517093 | 216 |
| 238 | 3300009147 | Ga0114129_10056020 | Ga0114129_100560204 | 216 |
| 239 | 3300044658 | Ga0466972_0186275 | Ga0466972_0186275_236_922 | 216 |
| 240 | 3300050491 | nmdc:mga00v17_73789_c1 | nmdc:mga00v17_73789_c1_287_973 | 216 |
| 241 | 3300006038 | Ga0075365_10033146 | Ga0075365_100331463 | 217 |
| 242 | 3300006042 | Ga0075368_10016111 | Ga0075368_100161112 | 217 |
| 243 | 3300006048 | Ga0075363_100004158 | Ga0075363_1000041582 | 217 |
| 244 | 3300006178 | Ga0075367_10005972 | Ga0075367_100059725 | 217 |
| 245 | 3300006353 | Ga0075370_10000254 | Ga0075370_1000025413 | 217 |
| 246 | 3300031852 | Ga0307410_10094907 | Ga0307410_100949072 | 217 |
| 247 | 3300044765 | Ga0466970_0272223 | Ga0466970_0272223_217_903 | 217 |
| 248 | 3300045976 | Ga0466967_0438442 | Ga0466967_0438442_217_888 | 217 |
| 249 | 3300046694 | Ga0495649_0071231 | Ga0495649_0071231_232_915 | 217 |
| 250 | 3300050490 | nmdc:mga03n38_4236_c1 | nmdc:mga03n38_4236_c1_1780_2481 | 217 |
| 251 | 3300050492 | nmdc:mga0yw44_36571_c1 | nmdc:mga0yw44_36571_c1_17_718 | 217 |
| 252 | 3300044765 | Ga0466970_0050385 | Ga0466970_0050385_924_1619 | 218 |
| 253 | 3300046461 | Ga0495641_0011170 | Ga0495641_0011170_4026_4721 | 218 |
| 254 | 3300046476 | Ga0495662_0019947 | Ga0495662_0019947_2065_2760 | 218 |
| 255 | 3300046517 | Ga0495630_0238292 | Ga0495630_0238292_624_1319 | 218 |
| 256 | 3300046674 | Ga0495588_0233640 | Ga0495588_0233640_77_772 | 218 |
| 257 | 3300046683 | Ga0495658_0009432 | Ga0495658_0009432_1353_2048 | 218 |
| 258 | 3300046689 | Ga0495613_0106995 | Ga0495613_0106995_856_1551 | 218 |
| 259 | 3300046690 | Ga0495624_0046431 | Ga0495624_0046431_1460_2155 | 218 |
| 260 | 3300047315 | Ga0495581_0084836 | Ga0495581_0084836_138_833 | 218 |
| 261 | 3300047319 | Ga0495674_0040261 | Ga0495674_0040261_1408_2103 | 218 |
| 262 | 3300047321 | Ga0495676_0094974 | Ga0495676_0094974_1084_1779 | 218 |
| 263 | 3300047673 | Ga0495593_0005817 | Ga0495593_0005817_5537_6232 | 218 |
| 264 | 3300044658 | Ga0466972_0043166 | Ga0466972_0043166_1439_2155 | 219 |
| 265 | 3300044683 | Ga0466965_0028299 | Ga0466965_0028299_533_1249 | 219 |
| 266 | 3300044735 | Ga0466968_0012871 | Ga0466968_0012871_358_1074 | 219 |
| 267 | 3300044842 | Ga0466957_0010035 | Ga0466957_0010035_4171_4887 | 219 |
| 268 | 3300044901 | Ga0466960_0000816 | Ga0466960_0000816_2819_3535 | 219 |
| 269 | 3300045976 | Ga0466967_0016026 | Ga0466967_0016026_3683_4399 | 219 |
| 270 | 3300041413 | Ga0439465_0015037 | Ga0439465_0015037_1599_2282 | 220 |
| 271 | 3300042435 | Ga0439434_0079888 | Ga0439434_0079888_303_986 | 220 |
| 272 | 3300001977 | JGI24746J21847_1004342 | JGI24746J21847_10043422 | 221 |
| 273 | 3300001991 | JGI24743J22301_10017046 | JGI24743J22301_100170462 | 221 |
| 274 | 3300002073 | JGI24745J21846_1008991 | JGI24745J21846_10089911 | 221 |
| 275 | 3300002077 | JGI24744J21845_10009693 | JGI24744J21845_100096933 | 221 |
| 276 | 3300005334 | Ga0068869_100060555 | Ga0068869_1000605552 | 221 |
| 277 | 3300005347 | Ga0070668_100001277 | Ga0070668_1000012778 | 221 |
| 278 | 3300005355 | Ga0070671_100208639 | Ga0070671_1002086392 | 221 |
| 279 | 3300005367 | Ga0070667_100245238 | Ga0070667_1002452382 | 221 |
| 280 | 3300005441 | Ga0070700_100125928 | Ga0070700_1001259283 | 221 |
| 281 | 3300005455 | Ga0070663_100112141 | Ga0070663_1001121413 | 221 |
| 282 | 3300005545 | Ga0070695_100490115 | Ga0070695_1004901152 | 221 |
| 283 | 3300005548 | Ga0070665_100011884 | Ga0070665_1000118846 | 221 |
| 284 | 3300005548 | Ga0070665_100434081 | Ga0070665_1004340811 | 221 |
| 285 | 3300005618 | Ga0068864_100060551 | Ga0068864_1000605513 | 221 |
| 286 | 3300005841 | Ga0068863_100184020 | Ga0068863_1001840202 | 221 |
| 287 | 3300005842 | Ga0068858_100010836 | Ga0068858_1000108368 | 221 |
| 288 | 3300005843 | Ga0068860_100039061 | Ga0068860_1000390613 | 221 |
| 289 | 3300005937 | Ga0081455_10084377 | Ga0081455_100843772 | 221 |
| 290 | 3300006048 | Ga0075363_100115426 | Ga0075363_1001154262 | 221 |
| 291 | 3300006173 | Ga0070716_100079619 | Ga0070716_1000796192 | 221 |
| 292 | 3300006175 | Ga0070712_100023353 | Ga0070712_1000233535 | 221 |
| 293 | 3300006237 | Ga0097621_100729744 | Ga0097621_1007297441 | 221 |
| 294 | 3300006846 | Ga0075430_100131909 | Ga0075430_1001319092 | 221 |
| 295 | 3300006931 | Ga0097620_100029064 | Ga0097620_1000290643 | 221 |
| 296 | 3300009098 | Ga0105245_10698042 | Ga0105245_106980422 | 221 |
| 297 | 3300009101 | Ga0105247_10045266 | Ga0105247_100452663 | 221 |
| 298 | 3300009148 | Ga0105243_10093141 | Ga0105243_100931411 | 221 |
| 299 | 3300009176 | Ga0105242_10325922 | Ga0105242_103259222 | 221 |
| 300 | 3300013102 | Ga0157371_10539658 | Ga0157371_105396581 | 221 |
| 301 | 3300013296 | Ga0157374_10111713 | Ga0157374_101117134 | 221 |
| 302 | 3300025899 | Ga0207642_10065819 | Ga0207642_100658193 | 221 |
| 303 | 3300025906 | Ga0207699_10238124 | Ga0207699_102381241 | 221 |
| 304 | 3300025915 | Ga0207693_10003117 | Ga0207693_1000311714 | 221 |
| 305 | 3300025916 | Ga0207663_10001631 | Ga0207663_100016314 | 221 |
| 306 | 3300025918 | Ga0207662_10374077 | Ga0207662_103740771 | 221 |
| 307 | 3300025931 | Ga0207644_10297792 | Ga0207644_102977922 | 221 |
| 308 | 3300025934 | Ga0207686_10222562 | Ga0207686_102225622 | 221 |
| 309 | 3300025940 | Ga0207691_10395628 | Ga0207691_103956282 | 221 |
| 310 | 3300025942 | Ga0207689_10009543 | Ga0207689_100095433 | 221 |
| 311 | 3300025972 | Ga0207668_10005594 | Ga0207668_100055943 | 221 |
| 312 | 3300026041 | Ga0207639_10099770 | Ga0207639_100997703 | 221 |
| 313 | 3300026067 | Ga0207678_10213268 | Ga0207678_102132681 | 221 |
| 314 | 3300026075 | Ga0207708_10037814 | Ga0207708_100378142 | 221 |
| 315 | 3300026095 | Ga0207676_10011210 | Ga0207676_100112108 | 221 |
| 316 | 3300026121 | Ga0207683_10007470 | Ga0207683_100074707 | 221 |
| 317 | 3300028379 | Ga0268266_10010986 | Ga0268266_100109866 | 221 |
| 318 | 3300041411 | Ga0439466_0006944 | Ga0439466_0006944_2604_3299 | 221 |
| 319 | 3300041413 | Ga0439465_0008737 | Ga0439465_0008737_1123_1818 | 221 |
| 320 | 3300041997 | Ga0439431_0006526 | Ga0439431_0006526_1043_1738 | 221 |
| 321 | 3300050490 | nmdc:mga03n38_365183_c1 | nmdc:mga03n38_365183_c1_67_768 | 221 |
| 322 | 3300050509 | nmdc:mga0qj67_139377_c1 | nmdc:mga0qj67_139377_c1_779_1510 | 221 |
| 323 | 3300050509 | nmdc:mga0qj67_273207_c1 | nmdc:mga0qj67_273207_c1_165_881 | 221 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xhz-assembly1.cif.gz_A | crystal structure of sav2152 from mrsa | 0.5901 | 144 | 209 |
| 7rhq-assembly1.cif.gz_C | cryo-em structure of xenopus patched-1 in complex with gas1 and sonic hedgehog | 0.5318 | 110 | 207 |
| 3jb9-assembly1.cif.gz_c | cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution | 0.4256 | 143 | 208 |
| 3x04-assembly1.cif.gz_B | crystal structure of pip4kiibeta complex with gmppnp | 0.3477 | 139 | 207 |
| 1xph-assembly1.cif.gz_A | structure of dc-signr and a portion of repeat domain 8 | 0.3379 | 143 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWA2_5_277_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.6222 | 140 | 210 | 3.40.50.1000 |
| af_Q9LRA7_720_855_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.5062 | 158 | 197 | 3.40.50.1000 |
| 3bi6A01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.458 | 140 | 207 | 3.30.200.20 |
| af_Q4DZR3_212_341_3.40.140.100 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Ubiquitin-like modifier-activating enzyme ATG7 C-terminal domain | 0.4417 | 153 | 207 | 3.40.140.100 |
| af_Q4DRC2_58_167_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.423 | 132 | 217 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X8FP28-F1-model_v4 | deleted | 0.9495 | 102 | 221 |
|
| AF-A0A5C7YAC5-F1-model_v4 | Glycoside hydrolase | 0.9479 | 96 | 217 |
GO:0016787
|
| AF-I0RHD8-F1-model_v4 | deleted | 0.9476 | 95 | 221 |
|
| AF-A0A2S8BKT3-F1-model_v4 | Glycoside hydrolase | 0.9397 | 97 | 220 |
|
| AF-A0A2S8MKP5-F1-model_v4 | deleted | 0.9389 | 92 | 221 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar