F406853

General Info

Members Datasets Scaffolds Average Seq Length
323 203 319 213

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100000030|Ga0068862_10000003067
Length 245
Sequence MQFHQRLMRYLPAIAFILLCVGRHQLVKERRSASDVLSSVVTPLIAIGGATMTRKMALAAASDVHPTVEAAPQTEPVVDKAAQFDIEIVPATAGPALLSGQQATVVQAMASRYRIVDRALPPGIAPERGLQVKTILASRAISEDFPQIHDIGGVRPDALRWHPNGLALDVMIPNPSSPEGIALGNEIVQYALANAERFDLQDCIWRGVYYTPNGAQGGRGYGHYDHVHITTHGGGYPTMGETYLR

Samples

Sample ID Description Type Environment
1 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
2 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
3 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
4 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
125 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
192 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
197 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
198 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
199 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
200 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
201 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
202 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.65
Nodule 0.31
Rhizoplane 13.31
Rhizosphere 64.09
Stem 0
Stem Tuber 0
Unclassified 4.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1004342 3300001977 Bacteria 2234
2 JGI24743J22301_10017046 3300001991 Bacteria 1360
3 JGI24745J21846_1008991 3300002073 Bacteria 1129
4 JGI24744J21845_10009693 3300002077 Bacteria 1977
5 rootH2_10028555 3300003320 Bacteria 4740
6 Ga0070676_10025542 3300005328 Bacteria 3340
7 Ga0070670_100039271 3300005331 Bacteria 4071
8 Ga0068869_100060555 3300005334 Bacteria 2774
9 Ga0070689_100045816 3300005340 Bacteria 3368
10 Ga0070687_100431139 3300005343 Bacteria 872
11 Ga0070668_100001277 3300005347 Bacteria 17996
12 Ga0070668_100008768 3300005347 Bacteria 7511
13 Ga0070669_100003008 3300005353 Bacteria 12142
14 Ga0070671_100129395 3300005355 Bacteria 2126
15 Ga0070671_100208639 3300005355 Bacteria 1657
16 Ga0070674_100006002 3300005356 Bacteria 7060
17 Ga0070667_100001332 3300005367 Bacteria 22171
18 Ga0070667_100017767 3300005367 Bacteria 5895
19 Ga0070667_100245238 3300005367 Bacteria 1600
20 Ga0070710_10347966 3300005437 Bacteria 980
21 Ga0070711_100192070 3300005439 Bacteria 1570
22 Ga0070700_100125928 3300005441 Bacteria 1722
23 Ga0070663_100112141 3300005455 Bacteria 2051
24 Ga0070663_100204804 3300005455 Bacteria 1542
25 Ga0070685_10046944 3300005466 Bacteria 2481
26 Ga0070672_100761218 3300005543 Bacteria 850
27 Ga0070686_100131686 3300005544 Bacteria 1730
28 Ga0070695_100490115 3300005545 Bacteria 949
29 Ga0070696_100013172 3300005546 Bacteria 5547
30 Ga0070693_100006817 3300005547 Bacteria 5550
31 Ga0070665_100006590 3300005548 Bacteria 11804
32 Ga0070665_100011884 3300005548 Bacteria 8792
33 Ga0070665_100022656 3300005548 Bacteria 6324
34 Ga0070665_100163917 3300005548 Bacteria 2225
35 Ga0070665_100434081 3300005548 Bacteria 1323
36 Ga0070702_100292913 3300005615 Bacteria 1122
37 Ga0068859_100002678 3300005617 Bacteria 18089
38 Ga0068864_100060551 3300005618 Bacteria 3278
39 Ga0068864_100270312 3300005618 Bacteria 1584
40 Ga0068861_100037730 3300005719 Bacteria 3592
41 Ga0068863_100000205 3300005841 Bacteria 63387
42 Ga0068863_100184020 3300005841 Bacteria 2006
43 Ga0068863_100476868 3300005841 Bacteria 1226
44 Ga0068863_100718004 3300005841 Bacteria 994
45 Ga0068858_100010836 3300005842 Bacteria 8618
46 Ga0068858_100336309 3300005842 Bacteria 1445
47 Ga0068860_100000472 3300005843 Bacteria 50060
48 Ga0068860_100039061 3300005843 Bacteria 4541
49 Ga0068860_100606617 3300005843 Bacteria 1100
50 Ga0068862_100000030 3300005844 Bacteria 182487
51 Ga0081455_10084377 3300005937 Bacteria 2593
52 Ga0081538_10104858 3300005981 Bacteria 1409
53 Ga0075365_10017624 3300006038 Bacteria 4375
54 Ga0075365_10023031 3300006038 Bacteria 3912
55 Ga0075365_10033146 3300006038 Bacteria 3326
56 Ga0075365_10038510 3300006038 Bacteria 3108
57 Ga0075365_10271852 3300006038 Bacteria 1192
58 Ga0075368_10016111 3300006042 Bacteria 2782
59 Ga0075363_100004158 3300006048 Bacteria 6287
60 Ga0075363_100004731 3300006048 Bacteria 5995
61 Ga0075363_100006751 3300006048 Bacteria 5239
62 Ga0075363_100026719 3300006048 Bacteria 2954
63 Ga0075363_100115426 3300006048 Bacteria 1495
64 Ga0075364_10384070 3300006051 Bacteria 958
65 Ga0070715_10044722 3300006163 Bacteria 1874
66 Ga0070716_100079619 3300006173 Bacteria 1951
67 Ga0070712_100023353 3300006175 Bacteria 4084
68 Ga0075362_10042178 3300006177 Bacteria 2016
69 Ga0075362_10164572 3300006177 Bacteria 1069
70 Ga0075362_10206128 3300006177 Bacteria 958
71 Ga0075367_10005972 3300006178 Bacteria 6115
72 Ga0075369_10001825 3300006186 Bacteria 7426
73 Ga0075369_10033814 3300006186 Bacteria 2168
74 Ga0075369_10034375 3300006186 Bacteria 2151
75 Ga0075369_10074588 3300006186 Bacteria 1497
76 Ga0097621_100110012 3300006237 Bacteria 2328
77 Ga0097621_100729744 3300006237 Bacteria 914
78 Ga0075370_10000254 3300006353 Bacteria 19168
79 Ga0075370_10004889 3300006353 Bacteria 6577
80 Ga0075370_10037583 3300006353 Bacteria 2723
81 Ga0075428_100005625 3300006844 Bacteria 13924
82 Ga0075430_100131909 3300006846 Bacteria 2082
83 Ga0075430_100352166 3300006846 Bacteria 1216
84 Ga0075431_100051709 3300006847 Bacteria 4236
85 Ga0075429_100753126 3300006880 Bacteria 853
86 Ga0097620_100002678 3300006931 Bacteria 18089
87 Ga0097620_100029064 3300006931 Bacteria 5546
88 Ga0105245_10009665 3300009098 Bacteria 8411
89 Ga0105245_10194033 3300009098 Bacteria 1947
90 Ga0105245_10698042 3300009098 Bacteria 1048
91 Ga0105247_10000008 3300009101 Bacteria 391450
92 Ga0105247_10045266 3300009101 Bacteria 2699
93 Ga0114129_10056020 3300009147 Bacteria 5524
94 Ga0105243_10093141 3300009148 Bacteria 2486
95 Ga0105243_10888341 3300009148 Bacteria 885
96 Ga0105242_10325922 3300009176 Bacteria 1410
97 Ga0105248_10000257 3300009177 Bacteria 62094
98 Ga0105248_10109395 3300009177 Bacteria 3116
99 Ga0105248_10195187 3300009177 Bacteria 2281
100 Ga0105237_10057664 3300009545 Bacteria 3886
101 Ga0105249_10000036 3300009553 Bacteria 198578
102 Ga0105249_10025752 3300009553 Bacteria 5298
103 Ga0105249_10197317 3300009553 Bacteria 1968
104 Ga0105239_10892533 3300010375 Bacteria 1020
105 Ga0105246_10613808 3300011119 Bacteria 942
106 Ga0157371_10539658 3300013102 Bacteria 864
107 Ga0157374_10111713 3300013296 Bacteria 2629
108 Ga0157374_10843276 3300013296 Bacteria 933
109 Ga0157378_10563173 3300013297 Bacteria 1146
110 Ga0163162_10237539 3300013306 Bacteria 1953
111 Ga0163162_10238530 3300013306 Bacteria 1949
112 Ga0163162_10321802 3300013306 Bacteria 1679
113 Ga0157375_10003762 3300013308 Bacteria 13159
114 Ga0163163_10018730 3300014325 Bacteria 6488
115 Ga0163163_10091094 3300014325 Bacteria 3063
116 Ga0163163_10371720 3300014325 Bacteria 1487
117 Ga0157377_10022444 3300014745 Bacteria 3332
118 Ga0157379_10238255 3300014968 Bacteria 1650
119 Ga0207692_10312090 3300025898 Bacteria 960
120 Ga0207642_10065819 3300025899 Bacteria 1704
121 Ga0207710_10000006 3300025900 Bacteria 538831
122 Ga0207710_10066766 3300025900 Bacteria 1642
123 Ga0207688_10118288 3300025901 Bacteria 1544
124 Ga0207647_10032309 3300025904 Bacteria 3364
125 Ga0207699_10238124 3300025906 Bacteria 1249
126 Ga0207693_10003117 3300025915 Bacteria 14272
127 Ga0207663_10001631 3300025916 Bacteria 10572
128 Ga0207662_10374077 3300025918 Bacteria 961
129 Ga0207652_10342340 3300025921 Bacteria 1350
130 Ga0207681_10013998 3300025923 Bacteria 4972
131 Ga0207681_10440582 3300025923 Bacteria 1058
132 Ga0207681_10486160 3300025923 Bacteria 1009
133 Ga0207694_10143058 3300025924 Bacteria 1924
134 Ga0207694_10705813 3300025924 Bacteria 851
135 Ga0207650_10031817 3300025925 Bacteria 3812
136 Ga0207700_10393625 3300025928 Bacteria 1213
137 Ga0207644_10297792 3300025931 Bacteria 1299
138 Ga0207690_10347417 3300025932 Bacteria 1172
139 Ga0207686_10222562 3300025934 Bacteria 1363
140 Ga0207686_10307084 3300025934 Bacteria 1180
141 Ga0207709_10099122 3300025935 Bacteria 1923
142 Ga0207691_10395628 3300025940 Bacteria 1179
143 Ga0207711_10000269 3300025941 Bacteria 56180
144 Ga0207711_10291273 3300025941 Bacteria 1505
145 Ga0207689_10009543 3300025942 Bacteria 8371
146 Ga0207689_10192710 3300025942 Bacteria 1682
147 Ga0207651_10178296 3300025960 Bacteria 1683
148 Ga0207712_10000036 3300025961 Bacteria 198586
149 Ga0207712_10177804 3300025961 Bacteria 1669
150 Ga0207712_10195944 3300025961 Bacteria 1598
151 Ga0207712_10610281 3300025961 Bacteria 945
152 Ga0207668_10005594 3300025972 Bacteria 7408
153 Ga0207668_10233379 3300025972 Bacteria 1484
154 Ga0207658_10224372 3300025986 Bacteria 1582
155 Ga0207658_10287190 3300025986 Bacteria 1412
156 Ga0207677_10678038 3300026023 Bacteria 912
157 Ga0207703_10251586 3300026035 Bacteria 1593
158 Ga0207639_10099770 3300026041 Bacteria 2344
159 Ga0207678_10213268 3300026067 Bacteria 1652
160 Ga0207708_10037814 3300026075 Bacteria 3676
161 Ga0207641_10000302 3300026088 Bacteria 61385
162 Ga0207641_10375035 3300026088 Bacteria 1361
163 Ga0207676_10011210 3300026095 Bacteria 6403
164 Ga0207676_10180687 3300026095 Bacteria 1847
165 Ga0207675_100077762 3300026118 Bacteria 3109
166 Ga0207675_100198819 3300026118 Bacteria 1925
167 Ga0207683_10007470 3300026121 Bacteria 9376
168 Ga0268266_10005369 3300028379 Bacteria 11976
169 Ga0268266_10010986 3300028379 Bacteria 7880
170 Ga0268265_10000038 3300028380 Bacteria 198640
171 Ga0268264_10000056 3300028381 Bacteria 310339
172 Ga0268264_10687477 3300028381 Bacteria 1015
173 Ga0307413_10030662 3300031824 Bacteria 3023
174 Ga0307410_10094907 3300031852 Bacteria 2126
175 Ga0307409_100002742 3300031995 Bacteria 9300
176 Ga0307416_100045762 3300032002 Bacteria 3448
177 Ga0307415_100030046 3300032126 Bacteria 3481
178 Ga0316582_0387432 3300036647 Bacteria 962
179 Ga0439466_0006944 3300041411 Bacteria 4292
180 Ga0439466_0007799 3300041411 Bacteria 4044
181 Ga0439466_0081625 3300041411 Bacteria 1019
182 Ga0439465_0001544 3300041413 Bacteria 7491
183 Ga0439465_0008737 3300041413 Bacteria 3194
184 Ga0439465_0015037 3300041413 Bacteria 2415
185 Ga0451793_1406742 3300041452 Bacteria 808
186 Ga0451802_0116320 3300041460 Bacteria 854
187 Ga0451853_3301171 3300041512 Bacteria 1845
188 Ga0439431_0006526 3300041997 Bacteria 2581
189 Ga0439445_0006137 3300042004 Bacteria 2756
190 Ga0439434_0079888 3300042435 Bacteria 1037
191 Ga0439435_0049430 3300042436 Bacteria 1200
192 Ga0466972_0034399 3300044658 Bacteria 2483
193 Ga0466972_0043166 3300044658 Bacteria 2190
194 Ga0466972_0186275 3300044658 Bacteria 973
195 Ga0466965_0028299 3300044683 Bacteria 2722
196 Ga0466966_0047109 3300044684 Bacteria 2750
197 Ga0466961_0016825 3300044693 Bacteria 4701
198 Ga0466963_0571925 3300044694 Bacteria 798
199 Ga0466968_0012871 3300044735 Bacteria 3282
200 Ga0466970_0050385 3300044765 Bacteria 2221
201 Ga0466970_0133231 3300044765 Bacteria 1366
202 Ga0466970_0272223 3300044765 Bacteria 951
203 Ga0466957_0010035 3300044842 Bacteria 5419
204 Ga0466957_0029927 3300044842 Bacteria 3249
205 Ga0466957_0187221 3300044842 Bacteria 1354
206 Ga0466960_0000816 3300044901 Bacteria 10955
207 Ga0466959_0036074 3300045049 Bacteria 3654
208 Ga0466958_0027859 3300045836 Bacteria 3345
209 Ga0466967_0008926 3300045976 Bacteria 7400
210 Ga0466967_0010259 3300045976 Bacteria 7012
211 Ga0466967_0016026 3300045976 Bacteria 5896
212 Ga0466967_0438442 3300045976 Bacteria 1275
213 Ga0466967_0669236 3300045976 Bacteria 1027
214 Ga0495638_0011184 3300046460 Bacteria 6197
215 Ga0495641_0011170 3300046461 Bacteria 5140
216 Ga0495641_0167507 3300046461 Bacteria 983
217 Ga0495662_0019947 3300046476 Bacteria 3243
218 Ga0495630_0238292 3300046517 Bacteria 1390
219 Ga0495640_0232083 3300046533 Bacteria 1160
220 Ga0495588_0233640 3300046674 Bacteria 970
221 Ga0495658_0009432 3300046683 Bacteria 4865
222 Ga0495613_0106995 3300046689 Bacteria 2018
223 Ga0495624_0046431 3300046690 Bacteria 2761
224 Ga0495649_0071231 3300046694 Bacteria 1863
225 Ga0495581_0084836 3300047315 Bacteria 1836
226 Ga0495674_0040261 3300047319 Bacteria 4181
227 Ga0495676_0094974 3300047321 Bacteria 2220
228 Ga0495593_0005817 3300047673 Bacteria 7271
229 Ga0496100_0001105 3300048903 Bacteria 13060
230 Ga0496100_0057129 3300048903 Bacteria 2555
231 Ga0496100_0553133 3300048903 Bacteria 890
232 Ga0496101_0000254 3300048904 Bacteria 38224
233 Ga0496101_0002552 3300048904 Bacteria 11172
234 Ga0496102_0000973 3300048905 Bacteria 26960
235 Ga0496102_0013106 3300048905 Bacteria 7173
236 Ga0496102_0014834 3300048905 Bacteria 6778
237 Ga0496102_0043266 3300048905 Bacteria 4083
238 Ga0496102_0361988 3300048905 Bacteria 1366
239 Ga0496103_0009564 3300048906 Bacteria 5739
240 Ga0496103_0041478 3300048906 Bacteria 2829
241 Ga0496103_0190197 3300048906 Bacteria 1320
242 Ga0496104_0002159 3300048907 Bacteria 17073
243 Ga0496104_0004575 3300048907 Bacteria 12055
244 Ga0496104_0124972 3300048907 Bacteria 2470
245 Ga0496105_0004735 3300048908 Bacteria 10268
246 Ga0496105_0033681 3300048908 Bacteria 4209
247 Ga0496105_0048688 3300048908 Bacteria 3499
248 Ga0496106_0000576 3300048909 Bacteria 26204
249 Ga0496107_0010741 3300048910 Bacteria 6369
250 Ga0496107_0104137 3300048910 Bacteria 2082
251 Ga0496108_0000189 3300048911 Bacteria 57428
252 Ga0496108_0218983 3300048911 Bacteria 1654
253 Ga0496108_0595535 3300048911 Bacteria 963
254 Ga0496108_0866375 3300048911 Bacteria 777
255 Ga0496109_0333196 3300048912 Bacteria 1433
256 Ga0496109_0398949 3300048912 Bacteria 1299
257 Ga0496111_0041170 3300048914 Bacteria 3315
258 Ga0496112_0096296 3300048915 Bacteria 2930
259 Ga0496112_0169996 3300048915 Bacteria 2145
260 Ga0496113_0139858 3300048916 Bacteria 1904
261 Ga0496113_0217123 3300048916 Bacteria 1523
262 Ga0496113_0406070 3300048916 Bacteria 1094
263 Ga0496114_0001381 3300048917 Bacteria 18383
264 Ga0496114_0153857 3300048917 Bacteria 1996
265 Ga0496114_0653313 3300048917 Bacteria 925
266 Ga0496115_0000976 3300048918 Bacteria 20773
267 Ga0496115_0581516 3300048918 Bacteria 892
268 Ga0496115_0665154 3300048918 Bacteria 822
269 Ga0496115_0707608 3300048918 Bacteria 791
270 Ga0496117_0002095 3300048920 Bacteria 26250
271 Ga0496118_0022063 3300048921 Bacteria 5581
272 Ga0496119_0004258 3300048922 Bacteria 14344
273 Ga0496120_0080020 3300048923 Bacteria 1772
274 Ga0496121_0033508 3300048924 Bacteria 4646
275 Ga0496122_0044641 3300048925 Bacteria 3455
276 Ga0496123_0011261 3300048926 Bacteria 7774
277 Ga0496124_0052441 3300048927 Bacteria 3464
278 Ga0496125_0050715 3300048928 Bacteria 3432
279 Ga0496126_0003940 3300048929 Bacteria 18168
280 Ga0501034_0146205 3300049571 Bacteria 2341
281 Ga0501070_0307709 3300049586 Bacteria 1290
282 Ga0501073_0269603 3300049589 Bacteria 1175
283 nmdc:mga03683_153290_c1 3300050489 Bacteria 1041
284 nmdc:mga03n38_101639_c1 3300050490 Bacteria 1387
285 nmdc:mga03n38_152042_c1 3300050490 Bacteria 1165
286 nmdc:mga03n38_30323_c1 3300050490 Bacteria 2273
287 nmdc:mga03n38_365183_c1 3300050490 Bacteria 788
288 nmdc:mga03n38_4236_c1 3300050490 Bacteria 4720
289 nmdc:mga03n38_7762_c1 3300050490 Bacteria 3808
290 nmdc:mga00v17_206348_c1 3300050491 Bacteria 1271
291 nmdc:mga00v17_22674_c1 3300050491 Bacteria 3625
292 nmdc:mga00v17_24032_c1 3300050491 Bacteria 3531
293 nmdc:mga00v17_73789_c1 3300050491 Bacteria 2119
294 nmdc:mga0yw44_10299_c1 3300050492 Bacteria 4769
295 nmdc:mga0yw44_2052_c1 3300050492 Bacteria 8403
296 nmdc:mga0yw44_36571_c1 3300050492 Bacteria 2894
297 nmdc:mga06z11_193428_c1 3300050494 Bacteria 1178
298 nmdc:mga07m45_18605_c1 3300050496 Bacteria 3754
299 nmdc:mga07m45_231165_c1 3300050496 Bacteria 1076
300 nmdc:mga07m45_37787_c1 3300050496 Bacteria 2693
301 nmdc:mga05p37_126442_c1 3300050507 Bacteria 3139
302 nmdc:mga0qj67_139377_c1 3300050509 Bacteria 1966
303 nmdc:mga0qj67_273207_c1 3300050509 Bacteria 1370
304 nmdc:mga0sz30_3030_c1 3300050516 Bacteria 2530
305 nmdc:mga0sz30_3140_c2 3300050516 Bacteria 5245
306 Ga0500610_0014931 3300053079 Bacteria 3660
307 Ga0500635_0112955 3300053080 Bacteria 1011
308 Ga0500578_0172469 3300053086 Bacteria 1337
309 Ga0500643_001418 3300053087 Bacteria 13845
310 Ga0500556_0002277 3300053104 Bacteria 6338
311 Ga0500562_085114 3300053108 Bacteria 856
312 Ga0500608_092995 3300053122 Bacteria 1407
313 Ga0500652_023729 3300053131 Bacteria 2335
314 Ga0500559_0099812 3300053136 Bacteria 1337
315 Ga0500588_0173055 3300053146 Bacteria 791
316 Ga0500620_052164 3300053155 Bacteria 1374
317 Ga0500627_0014225 3300053158 Bacteria 3042
318 Ga0500645_000006 3300053730 Bacteria 276677
319 Ga0500645_047550 3300053730 Bacteria 1257

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10194033 Ga0105245_101940332 176
2 3300041452 Ga0451793_1406742 Ga0451793_1406742_54_677 176
3 3300041512 Ga0451853_3301171 Ga0451853_3301171_707_1330 176
4 3300009177 Ga0105248_10195187 Ga0105248_101951872 177
5 3300005437 Ga0070710_10347966 Ga0070710_103479661 178
6 3300025898 Ga0207692_10312090 Ga0207692_103120901 178
7 3300036647 Ga0316582_0387432 Ga0316582_0387432_147_842 179
8 3300013306 Ga0163162_10238530 Ga0163162_102385302 180
9 3300048911 Ga0496108_0866375 Ga0496108_0866375_77_652 180
10 3300053730 Ga0500645_047550 Ga0500645_047550_154_753 180
11 3300045976 Ga0466967_0008926 Ga0466967_0008926_666_1346 181
12 3300041411 Ga0439466_0007799 Ga0439466_0007799_1761_2351 182
13 3300041413 Ga0439465_0001544 Ga0439465_0001544_2515_3105 182
14 3300042004 Ga0439445_0006137 Ga0439445_0006137_1880_2470 182
15 3300005355 Ga0070671_100129395 Ga0070671_1001293951 183
16 3300025961 Ga0207712_10177804 Ga0207712_101778041 185
17 3300044684 Ga0466966_0047109 Ga0466966_0047109_543_1121 186
18 3300044693 Ga0466961_0016825 Ga0466961_0016825_2338_2916 186
19 3300044694 Ga0466963_0571925 Ga0466963_0571925_170_748 186
20 3300044842 Ga0466957_0029927 Ga0466957_0029927_539_1117 186
21 3300045049 Ga0466959_0036074 Ga0466959_0036074_413_991 186
22 3300045836 Ga0466958_0027859 Ga0466958_0027859_2278_2856 186
23 3300006038 Ga0075365_10017624 Ga0075365_100176243 187
24 3300009545 Ga0105237_10057664 Ga0105237_100576644 187
25 3300050492 nmdc:mga0yw44_2052_c1 nmdc:mga0yw44_2052_c1_5161_5781 187
26 3300048916 Ga0496113_0406070 Ga0496113_0406070_208_831 188
27 3300053080 Ga0500635_0112955 Ga0500635_0112955_325_948 188
28 3300053086 Ga0500578_0172469 Ga0500578_0172469_226_849 188
29 3300053087 Ga0500643_001418 Ga0500643_001418_6760_7383 188
30 3300053131 Ga0500652_023729 Ga0500652_023729_397_1020 188
31 3300053146 Ga0500588_0173055 Ga0500588_0173055_71_694 188
32 3300053158 Ga0500627_0014225 Ga0500627_0014225_188_811 188
33 3300053730 Ga0500645_000006 Ga0500645_000006_214404_215027 188
34 3300005353 Ga0070669_100003008 Ga0070669_1000030086 189
35 3300005367 Ga0070667_100001332 Ga0070667_10000133216 189
36 3300005548 Ga0070665_100022656 Ga0070665_1000226562 189
37 3300005617 Ga0068859_100002678 Ga0068859_1000026782 189
38 3300005618 Ga0068864_100270312 Ga0068864_1002703122 189
39 3300005843 Ga0068860_100000472 Ga0068860_10000047238 189
40 3300006931 Ga0097620_100002678 Ga0097620_1000026782 189
41 3300009101 Ga0105247_10000008 Ga0105247_1000000883 189
42 3300009177 Ga0105248_10000257 Ga0105248_100002576 189
43 3300009553 Ga0105249_10000036 Ga0105249_1000003685 189
44 3300025900 Ga0207710_10000006 Ga0207710_10000006464 189
45 3300025923 Ga0207681_10013998 Ga0207681_100139983 189
46 3300025941 Ga0207711_10000269 Ga0207711_100002696 189
47 3300025961 Ga0207712_10000036 Ga0207712_1000003682 189
48 3300025986 Ga0207658_10224372 Ga0207658_102243722 189
49 3300026095 Ga0207676_10180687 Ga0207676_101806873 189
50 3300028381 Ga0268264_10000056 Ga0268264_100000566 189
51 3300048903 Ga0496100_0057129 Ga0496100_0057129_168_917 189
52 3300048904 Ga0496101_0002552 Ga0496101_0002552_6196_6945 189
53 3300048905 Ga0496102_0000973 Ga0496102_0000973_23587_24336 189
54 3300048906 Ga0496103_0009564 Ga0496103_0009564_1340_2089 189
55 3300048910 Ga0496107_0104137 Ga0496107_0104137_943_1692 189
56 3300048920 Ga0496117_0002095 Ga0496117_0002095_2352_3101 189
57 3300048921 Ga0496118_0022063 Ga0496118_0022063_2360_3109 189
58 3300048922 Ga0496119_0004258 Ga0496119_0004258_13171_13920 189
59 3300048923 Ga0496120_0080020 Ga0496120_0080020_366_1115 189
60 3300048924 Ga0496121_0033508 Ga0496121_0033508_2760_3509 189
61 3300048928 Ga0496125_0050715 Ga0496125_0050715_892_1641 189
62 3300005328 Ga0070676_10025542 Ga0070676_100255422 190
63 3300005340 Ga0070689_100045816 Ga0070689_1000458163 190
64 3300005347 Ga0070668_100008768 Ga0070668_1000087683 190
65 3300005356 Ga0070674_100006002 Ga0070674_1000060025 190
66 3300005547 Ga0070693_100006817 Ga0070693_1000068171 190
67 3300006163 Ga0070715_10044722 Ga0070715_100447223 190
68 3300006237 Ga0097621_100110012 Ga0097621_1001100122 190
69 3300009177 Ga0105248_10109395 Ga0105248_101093952 190
70 3300014968 Ga0157379_10238255 Ga0157379_102382552 190
71 3300025900 Ga0207710_10066766 Ga0207710_100667661 190
72 3300025921 Ga0207652_10342340 Ga0207652_103423402 190
73 3300025923 Ga0207681_10440582 Ga0207681_104405821 190
74 3300025924 Ga0207694_10143058 Ga0207694_101430582 190
75 3300025932 Ga0207690_10347417 Ga0207690_103474171 190
76 3300025934 Ga0207686_10307084 Ga0207686_103070841 190
77 3300025935 Ga0207709_10099122 Ga0207709_100991221 190
78 3300025942 Ga0207689_10192710 Ga0207689_101927101 190
79 3300025960 Ga0207651_10178296 Ga0207651_101782961 190
80 3300025961 Ga0207712_10610281 Ga0207712_106102811 190
81 3300025972 Ga0207668_10233379 Ga0207668_102333791 190
82 3300041460 Ga0451802_0116320 Ga0451802_0116320_194_796 190
83 3300048903 Ga0496100_0001105 Ga0496100_0001105_12136_12774 190
84 3300048909 Ga0496106_0000576 Ga0496106_0000576_21589_22227 190
85 3300048910 Ga0496107_0010741 Ga0496107_0010741_2233_2871 190
86 3300048912 Ga0496109_0333196 Ga0496109_0333196_327_965 190
87 3300048917 Ga0496114_0001381 Ga0496114_0001381_11574_12212 190
88 3300011119 Ga0105246_10613808 Ga0105246_106138082 191
89 3300013296 Ga0157374_10843276 Ga0157374_108432762 191
90 3300028381 Ga0268264_10687477 Ga0268264_106874771 191
91 3300005981 Ga0081538_10104858 Ga0081538_101048581 192
92 3300009148 Ga0105243_10888341 Ga0105243_108883411 192
93 3300009553 Ga0105249_10025752 Ga0105249_100257524 192
94 3300048904 Ga0496101_0000254 Ga0496101_0000254_15210_15848 192
95 3300048907 Ga0496104_0002159 Ga0496104_0002159_11022_11660 192
96 3300048908 Ga0496105_0004735 Ga0496105_0004735_8881_9519 192
97 3300048918 Ga0496115_0000976 Ga0496115_0000976_9042_9680 192
98 3300025924 Ga0207694_10705813 Ga0207694_107058131 193
99 3300049571 Ga0501034_0146205 Ga0501034_0146205_1311_1985 193
100 3300053079 Ga0500610_0014931 Ga0500610_0014931_230_871 194
101 3300003320 rootH2_10028555 rootH2_100285555 195
102 3300005367 Ga0070667_100017767 Ga0070667_1000177675 195
103 3300005544 Ga0070686_100131686 Ga0070686_1001316862 195
104 3300005548 Ga0070665_100006590 Ga0070665_10000659014 195
105 3300006048 Ga0075363_100006751 Ga0075363_1000067512 195
106 3300006353 Ga0075370_10004889 Ga0075370_100048892 195
107 3300014325 Ga0163163_10018730 Ga0163163_100187304 195
108 3300028379 Ga0268266_10005369 Ga0268266_1000536914 195
109 3300045976 Ga0466967_0010259 Ga0466967_0010259_3385_3978 195
110 3300048903 Ga0496100_0553133 Ga0496100_0553133_142_837 195
111 3300048905 Ga0496102_0014834 Ga0496102_0014834_403_1098 195
112 3300048906 Ga0496103_0041478 Ga0496103_0041478_874_1569 195
113 3300048907 Ga0496104_0004575 Ga0496104_0004575_6449_7144 195
114 3300048911 Ga0496108_0218983 Ga0496108_0218983_609_1304 195
115 3300048914 Ga0496111_0041170 Ga0496111_0041170_2046_2741 195
116 3300048915 Ga0496112_0169996 Ga0496112_0169996_1387_1995 195
117 3300048916 Ga0496113_0217123 Ga0496113_0217123_204_812 195
118 3300048918 Ga0496115_0665154 Ga0496115_0665154_67_675 195
119 3300048925 Ga0496122_0044641 Ga0496122_0044641_2837_3445 195
120 3300048926 Ga0496123_0011261 Ga0496123_0011261_783_1391 195
121 3300048929 Ga0496126_0003940 Ga0496126_0003940_5453_6061 195
122 3300050490 nmdc:mga03n38_30323_c1 nmdc:mga03n38_30323_c1_1200_1817 195
123 3300050496 nmdc:mga07m45_18605_c1 nmdc:mga07m45_18605_c1_2521_3138 195
124 3300005343 Ga0070687_100431139 Ga0070687_1004311392 196
125 3300005615 Ga0070702_100292913 Ga0070702_1002929131 196
126 3300006038 Ga0075365_10038510 Ga0075365_100385101 196
127 3300006048 Ga0075363_100026719 Ga0075363_1000267191 196
128 3300006177 Ga0075362_10042178 Ga0075362_100421782 196
129 3300009098 Ga0105245_10009665 Ga0105245_100096658 196
130 3300010375 Ga0105239_10892533 Ga0105239_108925332 196
131 3300013297 Ga0157378_10563173 Ga0157378_105631732 196
132 3300013308 Ga0157375_10003762 Ga0157375_100037626 196
133 3300014325 Ga0163163_10371720 Ga0163163_103717202 196
134 3300014745 Ga0157377_10022444 Ga0157377_100224441 196
135 3300025923 Ga0207681_10486160 Ga0207681_104861601 196
136 3300046460 Ga0495638_0011184 Ga0495638_0011184_5031_5645 196
137 3300046461 Ga0495641_0167507 Ga0495641_0167507_14_742 196
138 3300048905 Ga0496102_0013106 Ga0496102_0013106_5014_5622 196
139 3300048907 Ga0496104_0124972 Ga0496104_0124972_1613_2221 196
140 3300048908 Ga0496105_0048688 Ga0496105_0048688_2364_2972 196
141 3300048911 Ga0496108_0000189 Ga0496108_0000189_50105_50713 196
142 3300048915 Ga0496112_0096296 Ga0496112_0096296_303_911 196
143 3300048916 Ga0496113_0139858 Ga0496113_0139858_592_1200 196
144 3300048918 Ga0496115_0707608 Ga0496115_0707608_35_643 196
145 3300053104 Ga0500556_0002277 Ga0500556_0002277_178_792 196
146 3300053108 Ga0500562_085114 Ga0500562_085114_177_791 196
147 3300045976 Ga0466967_0669236 Ga0466967_0669236_337_993 197
148 3300050490 nmdc:mga03n38_101639_c1 nmdc:mga03n38_101639_c1_234_851 197
149 3300050490 nmdc:mga03n38_152042_c1 nmdc:mga03n38_152042_c1_532_1149 197
150 3300006038 Ga0075365_10023031 Ga0075365_100230313 198
151 3300006038 Ga0075365_10271852 Ga0075365_102718521 198
152 3300006048 Ga0075363_100004731 Ga0075363_1000047313 198
153 3300006051 Ga0075364_10384070 Ga0075364_103840702 198
154 3300006177 Ga0075362_10164572 Ga0075362_101645721 198
155 3300006177 Ga0075362_10206128 Ga0075362_102061281 198
156 3300006186 Ga0075369_10074588 Ga0075369_100745882 198
157 3300006353 Ga0075370_10037583 Ga0075370_100375832 198
158 3300031824 Ga0307413_10030662 Ga0307413_100306622 198
159 3300031995 Ga0307409_100002742 Ga0307409_1000027426 198
160 3300032002 Ga0307416_100045762 Ga0307416_1000457623 198
161 3300032126 Ga0307415_100030046 Ga0307415_1000300463 198
162 3300050489 nmdc:mga03683_153290_c1 nmdc:mga03683_153290_c1_303_935 198
163 3300050490 nmdc:mga03n38_7762_c1 nmdc:mga03n38_7762_c1_3118_3723 198
164 3300050491 nmdc:mga00v17_206348_c1 nmdc:mga00v17_206348_c1_301_930 198
165 3300050491 nmdc:mga00v17_24032_c1 nmdc:mga00v17_24032_c1_84_689 198
166 3300050492 nmdc:mga0yw44_10299_c1 nmdc:mga0yw44_10299_c1_3650_4255 198
167 3300050496 nmdc:mga07m45_37787_c1 nmdc:mga07m45_37787_c1_1236_1841 198
168 iso_pu_bacteria 2902799365 2902804591 198
169 3300005455 Ga0070663_100204804 Ga0070663_1002048042 199
170 3300013306 Ga0163162_10321802 Ga0163162_103218023 199
171 3300048905 Ga0496102_0043266 Ga0496102_0043266_550_1233 199
172 3300048906 Ga0496103_0190197 Ga0496103_0190197_466_1149 199
173 3300050494 nmdc:mga06z11_193428_c1 nmdc:mga06z11_193428_c1_51_734 199
174 iso_pu_bacteria 2738541274 2738704196 199
175 iso_pu_bacteria 2738543028 2739331320 199
176 3300005466 Ga0070685_10046944 Ga0070685_100469442 200
177 3300005546 Ga0070696_100013172 Ga0070696_1000131725 200
178 3300025904 Ga0207647_10032309 Ga0207647_100323092 200
179 3300025928 Ga0207700_10393625 Ga0207700_103936251 200
180 3300026118 Ga0207675_100198819 Ga0207675_1001988194 200
181 3300044658 Ga0466972_0034399 Ga0466972_0034399_1319_2014 200
182 3300044765 Ga0466970_0133231 Ga0466970_0133231_458_1081 200
183 3300050496 nmdc:mga07m45_231165_c1 nmdc:mga07m45_231165_c1_314_997 200
184 3300005841 Ga0068863_100000205 Ga0068863_1000002052 201
185 3300005842 Ga0068858_100336309 Ga0068858_1003363092 201
186 3300005844 Ga0068862_100000030 Ga0068862_10000003067 201
187 3300014325 Ga0163163_10091094 Ga0163163_100910942 201
188 3300026035 Ga0207703_10251586 Ga0207703_102515862 201
189 3300026088 Ga0207641_10000302 Ga0207641_1000030242 201
190 3300028380 Ga0268265_10000038 Ga0268265_1000003883 201
191 3300048917 Ga0496114_0653313 Ga0496114_0653313_107_856 201
192 3300048927 Ga0496124_0052441 Ga0496124_0052441_2625_3374 201
193 3300053155 Ga0500620_052164 Ga0500620_052164_286_1035 201
194 3300005719 Ga0068861_100037730 Ga0068861_1000377304 202
195 3300006880 Ga0075429_100753126 Ga0075429_1007531261 202
196 3300009553 Ga0105249_10197317 Ga0105249_101973173 202
197 3300013306 Ga0163162_10237539 Ga0163162_102375392 202
198 3300025961 Ga0207712_10195944 Ga0207712_101959442 202
199 3300026023 Ga0207677_10678038 Ga0207677_106780381 202
200 3300026118 Ga0207675_100077762 Ga0207675_1000777623 202
201 3300049586 Ga0501070_0307709 Ga0501070_0307709_558_1184 202
202 3300005841 Ga0068863_100718004 Ga0068863_1007180042 203
203 3300042436 Ga0439435_0049430 Ga0439435_0049430_214_837 203
204 3300050516 nmdc:mga0sz30_3030_c1 nmdc:mga0sz30_3030_c1_558_1181 203
205 3300053122 Ga0500608_092995 Ga0500608_092995_568_1239 203
206 3300053136 Ga0500559_0099812 Ga0500559_0099812_27_698 203
207 3300025901 Ga0207688_10118288 Ga0207688_101182886 204
208 3300048905 Ga0496102_0361988 Ga0496102_0361988_625_1323 204
209 3300048911 Ga0496108_0595535 Ga0496108_0595535_61_759 204
210 3300048912 Ga0496109_0398949 Ga0496109_0398949_558_1256 204
211 3300048917 Ga0496114_0153857 Ga0496114_0153857_124_822 204
212 3300005543 Ga0070672_100761218 Ga0070672_1007612181 205
213 3300005548 Ga0070665_100163917 Ga0070665_1001639173 205
214 3300005841 Ga0068863_100476868 Ga0068863_1004768682 205
215 3300005843 Ga0068860_100606617 Ga0068860_1006066172 205
216 3300006186 Ga0075369_10001825 Ga0075369_100018255 205
217 3300025941 Ga0207711_10291273 Ga0207711_102912732 205
218 3300026088 Ga0207641_10375035 Ga0207641_103750351 205
219 3300050516 nmdc:mga0sz30_3140_c2 nmdc:mga0sz30_3140_c2_2117_2764 205
220 3300041411 Ga0439466_0081625 Ga0439466_0081625_351_992 206
221 3300050491 nmdc:mga00v17_22674_c1 nmdc:mga00v17_22674_c1_2679_3362 206
222 3300005439 Ga0070711_100192070 Ga0070711_1001920702 207
223 3300050507 nmdc:mga05p37_126442_c1 nmdc:mga05p37_126442_c1_2147_2863 207
224 3300025986 Ga0207658_10287190 Ga0207658_102871902 208
225 3300044842 Ga0466957_0187221 Ga0466957_0187221_317_973 208
226 iso_pu_bacteria 2842134933 2842135337 209
227 3300025925 Ga0207650_10031817 Ga0207650_100318174 211
228 3300005331 Ga0070670_100039271 Ga0070670_1000392714 212
229 3300046533 Ga0495640_0232083 Ga0495640_0232083_255_929 212
230 3300048908 Ga0496105_0033681 Ga0496105_0033681_1058_1753 212
231 3300049589 Ga0501073_0269603 Ga0501073_0269603_161_832 212
232 3300048918 Ga0496115_0581516 Ga0496115_0581516_164_835 214
233 3300006186 Ga0075369_10033814 Ga0075369_100338141 215
234 3300006186 Ga0075369_10034375 Ga0075369_100343752 216
235 3300006844 Ga0075428_100005625 Ga0075428_1000056252 216
236 3300006846 Ga0075430_100352166 Ga0075430_1003521662 216
237 3300006847 Ga0075431_100051709 Ga0075431_1000517093 216
238 3300009147 Ga0114129_10056020 Ga0114129_100560204 216
239 3300044658 Ga0466972_0186275 Ga0466972_0186275_236_922 216
240 3300050491 nmdc:mga00v17_73789_c1 nmdc:mga00v17_73789_c1_287_973 216
241 3300006038 Ga0075365_10033146 Ga0075365_100331463 217
242 3300006042 Ga0075368_10016111 Ga0075368_100161112 217
243 3300006048 Ga0075363_100004158 Ga0075363_1000041582 217
244 3300006178 Ga0075367_10005972 Ga0075367_100059725 217
245 3300006353 Ga0075370_10000254 Ga0075370_1000025413 217
246 3300031852 Ga0307410_10094907 Ga0307410_100949072 217
247 3300044765 Ga0466970_0272223 Ga0466970_0272223_217_903 217
248 3300045976 Ga0466967_0438442 Ga0466967_0438442_217_888 217
249 3300046694 Ga0495649_0071231 Ga0495649_0071231_232_915 217
250 3300050490 nmdc:mga03n38_4236_c1 nmdc:mga03n38_4236_c1_1780_2481 217
251 3300050492 nmdc:mga0yw44_36571_c1 nmdc:mga0yw44_36571_c1_17_718 217
252 3300044765 Ga0466970_0050385 Ga0466970_0050385_924_1619 218
253 3300046461 Ga0495641_0011170 Ga0495641_0011170_4026_4721 218
254 3300046476 Ga0495662_0019947 Ga0495662_0019947_2065_2760 218
255 3300046517 Ga0495630_0238292 Ga0495630_0238292_624_1319 218
256 3300046674 Ga0495588_0233640 Ga0495588_0233640_77_772 218
257 3300046683 Ga0495658_0009432 Ga0495658_0009432_1353_2048 218
258 3300046689 Ga0495613_0106995 Ga0495613_0106995_856_1551 218
259 3300046690 Ga0495624_0046431 Ga0495624_0046431_1460_2155 218
260 3300047315 Ga0495581_0084836 Ga0495581_0084836_138_833 218
261 3300047319 Ga0495674_0040261 Ga0495674_0040261_1408_2103 218
262 3300047321 Ga0495676_0094974 Ga0495676_0094974_1084_1779 218
263 3300047673 Ga0495593_0005817 Ga0495593_0005817_5537_6232 218
264 3300044658 Ga0466972_0043166 Ga0466972_0043166_1439_2155 219
265 3300044683 Ga0466965_0028299 Ga0466965_0028299_533_1249 219
266 3300044735 Ga0466968_0012871 Ga0466968_0012871_358_1074 219
267 3300044842 Ga0466957_0010035 Ga0466957_0010035_4171_4887 219
268 3300044901 Ga0466960_0000816 Ga0466960_0000816_2819_3535 219
269 3300045976 Ga0466967_0016026 Ga0466967_0016026_3683_4399 219
270 3300041413 Ga0439465_0015037 Ga0439465_0015037_1599_2282 220
271 3300042435 Ga0439434_0079888 Ga0439434_0079888_303_986 220
272 3300001977 JGI24746J21847_1004342 JGI24746J21847_10043422 221
273 3300001991 JGI24743J22301_10017046 JGI24743J22301_100170462 221
274 3300002073 JGI24745J21846_1008991 JGI24745J21846_10089911 221
275 3300002077 JGI24744J21845_10009693 JGI24744J21845_100096933 221
276 3300005334 Ga0068869_100060555 Ga0068869_1000605552 221
277 3300005347 Ga0070668_100001277 Ga0070668_1000012778 221
278 3300005355 Ga0070671_100208639 Ga0070671_1002086392 221
279 3300005367 Ga0070667_100245238 Ga0070667_1002452382 221
280 3300005441 Ga0070700_100125928 Ga0070700_1001259283 221
281 3300005455 Ga0070663_100112141 Ga0070663_1001121413 221
282 3300005545 Ga0070695_100490115 Ga0070695_1004901152 221
283 3300005548 Ga0070665_100011884 Ga0070665_1000118846 221
284 3300005548 Ga0070665_100434081 Ga0070665_1004340811 221
285 3300005618 Ga0068864_100060551 Ga0068864_1000605513 221
286 3300005841 Ga0068863_100184020 Ga0068863_1001840202 221
287 3300005842 Ga0068858_100010836 Ga0068858_1000108368 221
288 3300005843 Ga0068860_100039061 Ga0068860_1000390613 221
289 3300005937 Ga0081455_10084377 Ga0081455_100843772 221
290 3300006048 Ga0075363_100115426 Ga0075363_1001154262 221
291 3300006173 Ga0070716_100079619 Ga0070716_1000796192 221
292 3300006175 Ga0070712_100023353 Ga0070712_1000233535 221
293 3300006237 Ga0097621_100729744 Ga0097621_1007297441 221
294 3300006846 Ga0075430_100131909 Ga0075430_1001319092 221
295 3300006931 Ga0097620_100029064 Ga0097620_1000290643 221
296 3300009098 Ga0105245_10698042 Ga0105245_106980422 221
297 3300009101 Ga0105247_10045266 Ga0105247_100452663 221
298 3300009148 Ga0105243_10093141 Ga0105243_100931411 221
299 3300009176 Ga0105242_10325922 Ga0105242_103259222 221
300 3300013102 Ga0157371_10539658 Ga0157371_105396581 221
301 3300013296 Ga0157374_10111713 Ga0157374_101117134 221
302 3300025899 Ga0207642_10065819 Ga0207642_100658193 221
303 3300025906 Ga0207699_10238124 Ga0207699_102381241 221
304 3300025915 Ga0207693_10003117 Ga0207693_1000311714 221
305 3300025916 Ga0207663_10001631 Ga0207663_100016314 221
306 3300025918 Ga0207662_10374077 Ga0207662_103740771 221
307 3300025931 Ga0207644_10297792 Ga0207644_102977922 221
308 3300025934 Ga0207686_10222562 Ga0207686_102225622 221
309 3300025940 Ga0207691_10395628 Ga0207691_103956282 221
310 3300025942 Ga0207689_10009543 Ga0207689_100095433 221
311 3300025972 Ga0207668_10005594 Ga0207668_100055943 221
312 3300026041 Ga0207639_10099770 Ga0207639_100997703 221
313 3300026067 Ga0207678_10213268 Ga0207678_102132681 221
314 3300026075 Ga0207708_10037814 Ga0207708_100378142 221
315 3300026095 Ga0207676_10011210 Ga0207676_100112108 221
316 3300026121 Ga0207683_10007470 Ga0207683_100074707 221
317 3300028379 Ga0268266_10010986 Ga0268266_100109866 221
318 3300041411 Ga0439466_0006944 Ga0439466_0006944_2604_3299 221
319 3300041413 Ga0439465_0008737 Ga0439465_0008737_1123_1818 221
320 3300041997 Ga0439431_0006526 Ga0439431_0006526_1043_1738 221
321 3300050490 nmdc:mga03n38_365183_c1 nmdc:mga03n38_365183_c1_67_768 221
322 3300050509 nmdc:mga0qj67_139377_c1 nmdc:mga0qj67_139377_c1_779_1510 221
323 3300050509 nmdc:mga0qj67_273207_c1 nmdc:mga0qj67_273207_c1_165_881 221

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xhz-assembly1.cif.gz_A crystal structure of sav2152 from mrsa 0.5901 144 209
7rhq-assembly1.cif.gz_C cryo-em structure of xenopus patched-1 in complex with gas1 and sonic hedgehog 0.5318 110 207
3jb9-assembly1.cif.gz_c cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.4256 143 208
3x04-assembly1.cif.gz_B crystal structure of pip4kiibeta complex with gmppnp 0.3477 139 207
1xph-assembly1.cif.gz_A structure of dc-signr and a portion of repeat domain 8 0.3379 143 213
ID Description Score Start End Superfamily
af_Q2FWA2_5_277_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6222 140 210 3.40.50.1000
af_Q9LRA7_720_855_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.5062 158 197 3.40.50.1000
3bi6A01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.458 140 207 3.30.200.20
af_Q4DZR3_212_341_3.40.140.100 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Ubiquitin-like modifier-activating enzyme ATG7 C-terminal domain 0.4417 153 207 3.40.140.100
af_Q4DRC2_58_167_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.423 132 217 3.30.200.20
ID Description Score Start End GO Terms
AF-X8FP28-F1-model_v4 deleted 0.9495 102 221
AF-A0A5C7YAC5-F1-model_v4 Glycoside hydrolase 0.9479 96 217 GO:0016787
AF-I0RHD8-F1-model_v4 deleted 0.9476 95 221
AF-A0A2S8BKT3-F1-model_v4 Glycoside hydrolase 0.9397 97 220
AF-A0A2S8MKP5-F1-model_v4 deleted 0.9389 92 221

Feature Viewer

pLDDT pTM Quality
67.64 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map