F406783

General Info

Members Datasets Scaffolds Average Seq Length
323 155 646 117

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100294650|Ga0070671_1002946502
Length 133
Sequence MLVSFSLSRANLSTHMSHSVEPGDYLIFQLESAYGLLRVLAIDGDGADTVWHLLAYDEFFPDVESAEKVLAGGGPLSVRKAHMALTDRAFERTPTARLDNHPLTDEELVGYRAWQDSDRSVSDRSALLMLGLR

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
138 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
139 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
143 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
144 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
145 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
146 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
147 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.93
Rhizosphere 99.07
Stem 0
Stem Tuber 0
Unclassified 36.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100294650 3300005355 Bacteria 1381
2 MBSR1b_contig_9754369 2162886012 Eukaryota 1212
3 Ga0065704_10045006 3300005289 Bacteria 782
4 Ga0065712_10095092 3300005290 Bacteria 2230
5 Ga0065712_10399738 3300005290 Unclassified 709
6 Ga0065715_10002428 3300005293 Bacteria 5529
7 Ga0065715_10015889 3300005293 Bacteria 2591
8 Ga0065715_10052354 3300005293 Unclassified 1123
9 Ga0065715_10103568 3300005293 Bacteria 3025
10 Ga0065715_10163534 3300005293 Bacteria 1607
11 Ga0065715_10182322 3300005293 Unclassified 1468
12 Ga0065715_10221667 3300005293 Unclassified 1259
13 Ga0070676_10647795 3300005328 Bacteria 766
14 Ga0070690_100013710 3300005330 Bacteria 4799
15 Ga0070670_100002102 3300005331 Bacteria 16329
16 Ga0068869_100081065 3300005334 Bacteria 2423
17 Ga0070680_100100692 3300005336 Bacteria 2398
18 Ga0070682_100005386 3300005337 Bacteria 7122
19 Ga0068868_100027890 3300005338 Bacteria 4311
20 Ga0068868_100875345 3300005338 Unclassified 815
21 Ga0070689_102182306 3300005340 Unclassified 507
22 Ga0070687_100025160 3300005343 Bacteria 2852
23 Ga0070692_10063179 3300005345 Bacteria 1955
24 Ga0070692_10441585 3300005345 Bacteria 831
25 Ga0070669_100089061 3300005353 Bacteria 2311
26 Ga0070669_100544624 3300005353 Unclassified 967
27 Ga0070671_100118988 3300005355 Bacteria 2222
28 Ga0070673_100059328 3300005364 Bacteria 3028
29 Ga0070673_100288272 3300005364 Unclassified 1442
30 Ga0070673_100540074 3300005364 Unclassified 1058
31 Ga0070673_100652817 3300005364 Bacteria 963
32 Ga0070673_100824226 3300005364 Bacteria 858
33 Ga0070673_100882869 3300005364 Unclassified 828
34 Ga0070673_101343154 3300005364 Bacteria 672
35 Ga0070667_100115434 3300005367 Bacteria 2332
36 Ga0070701_10062138 3300005438 Bacteria 1972
37 Ga0070701_10442693 3300005438 Unclassified 832
38 Ga0070700_100091160 3300005441 Unclassified 1989
39 Ga0070700_100343594 3300005441 Unclassified 1104
40 Ga0070700_100967047 3300005441 Bacteria 698
41 Ga0070700_101674136 3300005441 Unclassified 545
42 Ga0070694_100058859 3300005444 Bacteria 2615
43 Ga0070694_100241984 3300005444 Bacteria 1361
44 Ga0070708_100003716 3300005445 Bacteria 11967
45 Ga0070708_101645494 3300005445 Unclassified 597
46 Ga0070678_100877035 3300005456 Bacteria 819
47 Ga0070678_101690766 3300005456 Unclassified 595
48 Ga0068867_100104481 3300005459 Bacteria 2168
49 Ga0068867_100116670 3300005459 Unclassified 2058
50 Ga0068867_100267947 3300005459 Bacteria 1395
51 Ga0070685_10851102 3300005466 Bacteria 676
52 Ga0070706_100006829 3300005467 Bacteria 10774
53 Ga0070706_100548368 3300005467 Bacteria 1075
54 Ga0070707_100479327 3300005468 Bacteria 1206
55 Ga0070707_102254908 3300005468 Unclassified 512
56 Ga0070698_100008079 3300005471 Bacteria 11381
57 Ga0070698_100026408 3300005471 Bacteria 6044
58 Ga0070698_100872956 3300005471 Bacteria 845
59 Ga0070699_100004780 3300005518 Bacteria 11972
60 Ga0070697_100967918 3300005536 Unclassified 756
61 Ga0070672_100344985 3300005543 Bacteria 1268
62 Ga0070672_100351045 3300005543 Bacteria 1257
63 Ga0070686_100035981 3300005544 Unclassified 3061
64 Ga0070686_100037771 3300005544 Bacteria 2997
65 Ga0070695_100334027 3300005545 Viruses 1130
66 Ga0070695_100817563 3300005545 Unclassified 748
67 Ga0070695_100941706 3300005545 Unclassified 700
68 Ga0070695_101213273 3300005545 Bacteria 621
69 Ga0070696_100017772 3300005546 Bacteria 4801
70 Ga0070696_100351812 3300005546 Unclassified 1141
71 Ga0070696_101008725 3300005546 Unclassified 696
72 Ga0070693_100067468 3300005547 Bacteria 2097
73 Ga0070693_100510708 3300005547 Bacteria 854
74 Ga0070665_100083617 3300005548 Bacteria 3196
75 Ga0070665_100688138 3300005548 Unclassified 1036
76 Ga0070704_100231100 3300005549 Unclassified 1509
77 Ga0070704_100487584 3300005549 Bacteria 1067
78 Ga0070704_101067123 3300005549 Unclassified 733
79 Ga0068855_101369734 3300005563 Bacteria 730
80 Ga0068855_101708354 3300005563 Bacteria 642
81 Ga0070664_100012844 3300005564 Bacteria 6812
82 Ga0070664_100099938 3300005564 Bacteria 2521
83 Ga0070664_100151439 3300005564 Unclassified 2048
84 Ga0070664_100349370 3300005564 Unclassified 1345
85 Ga0068857_100026669 3300005577 Bacteria 5093
86 Ga0068857_100086595 3300005577 Bacteria 2801
87 Ga0068857_101200135 3300005577 Unclassified 735
88 Ga0068854_101355867 3300005578 Unclassified 642
89 Ga0070702_100054693 3300005615 Bacteria 2298
90 Ga0070702_100208909 3300005615 Bacteria 1298
91 Ga0068852_101624227 3300005616 Bacteria 669
92 Ga0068859_100015753 3300005617 Bacteria 7596
93 Ga0068859_100506578 3300005617 Bacteria 1302
94 Ga0068859_100640807 3300005617 Bacteria 1155
95 Ga0068864_100030450 3300005618 Bacteria 4574
96 Ga0068864_100388302 3300005618 Bacteria 1324
97 Ga0068864_101058640 3300005618 Unclassified 806
98 Ga0068864_101992865 3300005618 Bacteria 587
99 Ga0068861_100761310 3300005719 Unclassified 905
100 Ga0068861_100802643 3300005719 Unclassified 883
101 Ga0068863_100353321 3300005841 Bacteria 1432
102 Ga0068863_100380740 3300005841 Unclassified 1378
103 Ga0068863_100981527 3300005841 Bacteria 847
104 Ga0068858_100075231 3300005842 Bacteria 3136
105 Ga0068858_100098426 3300005842 Bacteria 2727
106 Ga0068858_100102862 3300005842 Bacteria 2664
107 Ga0068858_100263651 3300005842 Bacteria 1638
108 Ga0068858_100691121 3300005842 Bacteria 992
109 Ga0068860_100043913 3300005843 Bacteria 4261
110 Ga0068860_100048220 3300005843 Bacteria 4059
111 Ga0068860_100084696 3300005843 Bacteria 3016
112 Ga0068860_100249673 3300005843 Bacteria 1727
113 Ga0068860_100279734 3300005843 Bacteria 1630
114 Ga0068860_101547235 3300005843 Unclassified 685
115 Ga0068862_100045956 3300005844 Bacteria 3727
116 Ga0068862_101987255 3300005844 Unclassified 592
117 Ga0081540_1089460 3300005983 Bacteria 1358
118 Ga0081539_10044012 3300005985 Bacteria 2581
119 Ga0097621_100008163 3300006237 Bacteria 7528
120 Ga0097621_100013236 3300006237 Bacteria 6141
121 Ga0068871_100003200 3300006358 Bacteria 11231
122 Ga0068871_100007595 3300006358 Bacteria 7752
123 Ga0068871_100570414 3300006358 Unclassified 1027
124 Ga0075428_100666222 3300006844 Unclassified 1109
125 Ga0075430_100440452 3300006846 Bacteria 1076
126 Ga0075431_100248226 3300006847 Bacteria 1809
127 Ga0075429_100123102 3300006880 Unclassified 2267
128 Ga0068865_100442667 3300006881 Unclassified 1073
129 Ga0097620_100015753 3300006931 Bacteria 7596
130 Ga0097620_100506620 3300006931 Bacteria 1302
131 Ga0097620_100640733 3300006931 Bacteria 1155
132 Ga0097620_102710827 3300006931 Unclassified 545
133 Ga0075435_100085576 3300007076 Bacteria 2595
134 Ga0075435_100241862 3300007076 Unclassified 1535
135 Ga0075435_100618407 3300007076 Unclassified 940
136 Ga0105251_10383897 3300009011 Unclassified 644
137 Ga0105245_10384693 3300009098 Unclassified 1398
138 Ga0105245_11004852 3300009098 Unclassified 879
139 Ga0105247_10000421 3300009101 Bacteria 36009
140 Ga0114129_10045409 3300009147 Bacteria 6176
141 Ga0114129_10064789 3300009147 Bacteria 5100
142 Ga0114129_10442243 3300009147 Bacteria 1706
143 Ga0114129_10588603 3300009147 Unclassified 1443
144 Ga0114129_11453689 3300009147 Bacteria 844
145 Ga0114129_11668082 3300009147 Unclassified 779
146 Ga0105243_10087186 3300009148 Bacteria 2562
147 Ga0105243_10832665 3300009148 Unclassified 912
148 Ga0105243_12530559 3300009148 Bacteria 552
149 Ga0105241_10806535 3300009174 Unclassified 865
150 Ga0105241_10946850 3300009174 Unclassified 802
151 Ga0105241_12517319 3300009174 Bacteria 516
152 Ga0105241_12609975 3300009174 Bacteria 507
153 Ga0105242_10594148 3300009176 Bacteria 1068
154 Ga0105242_12345803 3300009176 Unclassified 580
155 Ga0105248_10140039 3300009177 Unclassified 2729
156 Ga0105248_10183136 3300009177 Bacteria 2360
157 Ga0105248_10680049 3300009177 Bacteria 1161
158 Ga0105248_11383185 3300009177 Unclassified 796
159 Ga0105248_11508459 3300009177 Bacteria 761
160 Ga0105248_12270874 3300009177 Bacteria 618
161 Ga0105237_10492776 3300009545 Unclassified 1232
162 Ga0105249_10039509 3300009553 Bacteria 4285
163 Ga0105249_10688000 3300009553 Bacteria 1082
164 Ga0105249_13089561 3300009553 Bacteria 535
165 Ga0105239_11130507 3300010375 Unclassified 902
166 Ga0105239_11495816 3300010375 Unclassified 780
167 Ga0105246_10168228 3300011119 Unclassified 1676
168 Ga0105246_11657119 3300011119 Unclassified 606
169 Ga0157373_10341770 3300013100 Unclassified 1067
170 Ga0157371_10171970 3300013102 Bacteria 1548
171 Ga0157371_10808919 3300013102 Unclassified 707
172 Ga0157374_10258178 3300013296 Bacteria 1716
173 Ga0157374_10262987 3300013296 Unclassified 1700
174 Ga0157378_10370915 3300013297 Bacteria 1403
175 Ga0157378_10481516 3300013297 Unclassified 1237
176 Ga0157378_10642195 3300013297 Bacteria 1076
177 Ga0157378_10650215 3300013297 Bacteria 1070
178 Ga0157378_11017156 3300013297 Bacteria 863
179 Ga0157378_11265895 3300013297 Bacteria 778
180 Ga0163162_10004385 3300013306 Bacteria 13582
181 Ga0163162_10020007 3300013306 Bacteria 6574
182 Ga0163162_10132429 3300013306 Bacteria 2602
183 Ga0163162_11051022 3300013306 Bacteria 922
184 Ga0163162_11179108 3300013306 Bacteria 869
185 Ga0157372_10253147 3300013307 Bacteria 2044
186 Ga0157375_10226777 3300013308 Bacteria 2027
187 Ga0157375_10933914 3300013308 Bacteria 1010
188 Ga0157375_13330323 3300013308 Unclassified 535
189 Ga0163163_10001070 3300014325 Bacteria 23278
190 Ga0163163_10002106 3300014325 Bacteria 16799
191 Ga0163163_10003204 3300014325 Bacteria 13862
192 Ga0163163_10156281 3300014325 Bacteria 2325
193 Ga0163163_11011621 3300014325 Unclassified 894
194 Ga0157379_10520987 3300014968 Bacteria 1104
195 Ga0157379_11311395 3300014968 Bacteria 699
196 Ga0157379_11359932 3300014968 Unclassified 687
197 Ga0157376_10396446 3300014969 Bacteria 1333
198 Ga0163161_10387154 3300017792 Bacteria 1119
199 Ga0207713_1099813 3300025735 Unclassified 1004
200 Ga0207710_10000553 3300025900 Bacteria 22414
201 Ga0207647_10016890 3300025904 Bacteria 4970
202 Ga0207684_10074839 3300025910 Bacteria 2877
203 Ga0207684_10251882 3300025910 Unclassified 1523
204 Ga0207654_10099399 3300025911 Bacteria 1790
205 Ga0207707_10121322 3300025912 Bacteria 2285
206 Ga0207671_10147135 3300025914 Bacteria 1818
207 Ga0207671_11024342 3300025914 Unclassified 650
208 Ga0207662_10029956 3300025918 Unclassified 3156
209 Ga0207649_10089164 3300025920 Bacteria 2016
210 Ga0207652_10146084 3300025921 Bacteria 2117
211 Ga0207646_10107950 3300025922 Bacteria 2497
212 Ga0207646_10335382 3300025922 Unclassified 1366
213 Ga0207681_10057434 3300025923 Unclassified 2660
214 Ga0207650_10000005 3300025925 Bacteria 663190
215 Ga0207650_10246836 3300025925 Unclassified 1444
216 Ga0207659_10173386 3300025926 Bacteria 1703
217 Ga0207687_11787240 3300025927 Unclassified 526
218 Ga0207690_10066747 3300025932 Bacteria 2465
219 Ga0207706_10230229 3300025933 Bacteria 1622
220 Ga0207686_10341927 3300025934 Bacteria 1124
221 Ga0207709_10004720 3300025935 Bacteria 7831
222 Ga0207709_10902872 3300025935 Bacteria 718
223 Ga0207670_11660715 3300025936 Unclassified 543
224 Ga0207704_10840193 3300025938 Bacteria 769
225 Ga0207691_10332668 3300025940 Bacteria 1301
226 Ga0207711_10508890 3300025941 Bacteria 1122
227 Ga0207711_10804677 3300025941 Unclassified 875
228 Ga0207711_11030238 3300025941 Bacteria 763
229 Ga0207711_11555879 3300025941 Bacteria 604
230 Ga0207689_10096786 3300025942 Bacteria 2424
231 Ga0207689_10198257 3300025942 Unclassified 1657
232 Ga0207689_10273610 3300025942 Unclassified 1398
233 Ga0207689_10955980 3300025942 Bacteria 723
234 Ga0207679_10045657 3300025945 Bacteria 3170
235 Ga0207679_10100252 3300025945 Bacteria 2263
236 Ga0207679_10159923 3300025945 Bacteria 1843
237 Ga0207679_10361494 3300025945 Bacteria 1268
238 Ga0207679_10593993 3300025945 Unclassified 997
239 Ga0207651_10020354 3300025960 Bacteria 4003
240 Ga0207651_10299188 3300025960 Unclassified 1337
241 Ga0207651_10430031 3300025960 Bacteria 1129
242 Ga0207651_10583177 3300025960 Unclassified 976
243 Ga0207651_10732069 3300025960 Bacteria 873
244 Ga0207712_10000695 3300025961 Bacteria 25951
245 Ga0207640_10748243 3300025981 Bacteria 842
246 Ga0207640_11194941 3300025981 Unclassified 676
247 Ga0207640_11270668 3300025981 Unclassified 656
248 Ga0207658_10512724 3300025986 Bacteria 1069
249 Ga0207677_10894975 3300026023 Unclassified 800
250 Ga0207703_10048728 3300026035 Bacteria 3421
251 Ga0207703_10097539 3300026035 Bacteria 2484
252 Ga0207703_10219110 3300026035 Bacteria 1701
253 Ga0207703_10233561 3300026035 Bacteria 1650
254 Ga0207639_10230409 3300026041 Bacteria 1605
255 Ga0207639_10408938 3300026041 Bacteria 1224
256 Ga0207708_10115050 3300026075 Bacteria 2091
257 Ga0207708_10126360 3300026075 Unclassified 1996
258 Ga0207708_10898192 3300026075 Bacteria 767
259 Ga0207641_10457115 3300026088 Unclassified 1235
260 Ga0207641_11073975 3300026088 Unclassified 803
261 Ga0207641_11595054 3300026088 Bacteria 654
262 Ga0207648_10058580 3300026089 Bacteria 3359
263 Ga0207648_10092846 3300026089 Bacteria 2639
264 Ga0207648_10349743 3300026089 Unclassified 1332
265 Ga0207648_10712891 3300026089 Unclassified 930
266 Ga0207676_10212720 3300026095 Bacteria 1716
267 Ga0207676_10250663 3300026095 Bacteria 1593
268 Ga0207676_10786314 3300026095 Unclassified 928
269 Ga0207676_11783816 3300026095 Bacteria 614
270 Ga0207674_10002367 3300026116 Bacteria 23830
271 Ga0207674_10063709 3300026116 Bacteria 3720
272 Ga0207674_10495476 3300026116 Archaea 1181
273 Ga0207674_10664793 3300026116 Bacteria 1006
274 Ga0207675_100698914 3300026118 Unclassified 1023
275 Ga0207675_100912258 3300026118 Bacteria 895
276 Ga0207683_11527260 3300026121 Unclassified 616
277 Ga0207698_10827595 3300026142 Bacteria 930
278 Ga0268266_10048331 3300028379 Bacteria 3647
279 Ga0268265_10129176 3300028380 Bacteria 2097
280 Ga0268264_10034849 3300028381 Bacteria 4142
281 Ga0268264_10049462 3300028381 Bacteria 3498
282 Ga0268264_10128504 3300028381 Bacteria 2243
283 Ga0268264_10285199 3300028381 Unclassified 1549
284 Ga0268264_10847703 3300028381 Unclassified 915
285 Ga0268264_11168685 3300028381 Bacteria 779
286 Ga0307405_10819884 3300031731 Unclassified 781
287 Ga0307405_12087869 3300031731 Unclassified 508
288 Ga0307410_11087280 3300031852 Unclassified 693
289 Ga0307406_11106301 3300031901 Bacteria 684
290 Ga0307409_101837295 3300031995 Unclassified 635
291 Ga0307416_100210832 3300032002 Unclassified 1853
292 Ga0307416_101436882 3300032002 Bacteria 795
293 Ga0307411_10434335 3300032005 Unclassified 1094
294 Ga0373961_0166111 3300035241 Bacteria 761
295 Ga0373937_0751765 3300036401 Bacteria 922
296 Ga0439439_0163846 3300041406 Unclassified 635
297 Ga0451787_629879 3300041441 Unclassified 531
298 Ga0439457_166341 3300042014 Unclassified 535
299 Ga0439434_0085623 3300042435 Bacteria 1004
300 Ga0495651_0843971 3300046462 Unclassified 563
301 Ga0496113_0662048 3300048916 Unclassified 835
302 Ga0496113_0716868 3300048916 Bacteria 798
303 Ga0501295_032250 3300049518 Bacteria 1041
304 Ga0501202_027397 3300049652 Bacteria 1171
305 Ga0501202_088299 3300049652 Unclassified 738
306 Ga0501217_269593 3300049661 Unclassified 554
307 Ga0501227_253623 3300049665 Unclassified 501
308 Ga0501235_032929 3300049669 Bacteria 1173
309 Ga0501221_019529 3300049704 Unclassified 1316
310 nmdc:mga05p37_260963_c1 3300050507 Bacteria 2073
311 nmdc:mga05p37_275469_c1 3300050507 Bacteria 2009
312 nmdc:mga05p37_31051_c1 3300050507 Bacteria 6524
313 nmdc:mga09592_443821_c1 3300050508 Bacteria 1120
314 nmdc:mga06r32_354270_c1 3300050510 Bacteria 1452
315 nmdc:mga06r32_849878_c1 3300050510 Unclassified 871
316 nmdc:mga0rr50_1205394_c1 3300050513 Unclassified 643
317 nmdc:mga0rr50_1523328_c1 3300050513 Unclassified 565
318 nmdc:mga0rr50_42909_c1 3300050513 Bacteria 3306
319 nmdc:mga08x19_1324051_c1 3300050514 Unclassified 510
320 nmdc:mga0a205_100811_c1 3300050515 Bacteria 2786
321 nmdc:mga0a205_802335_c1 3300050515 Unclassified 789
322 Ga0495655_0070267 3300053083 Unclassified 977
323 Ga0530510_0375058 3300061734 Unclassified 1070
324 Ga0070671_100294650
325 MBSR1b_contig_9754369
326 Ga0065704_10045006
327 Ga0065712_10095092
328 Ga0065712_10399738
329 Ga0065715_10002428
330 Ga0065715_10015889
331 Ga0065715_10052354
332 Ga0065715_10103568
333 Ga0065715_10163534
334 Ga0065715_10182322
335 Ga0065715_10221667
336 Ga0070676_10647795
337 Ga0070690_100013710
338 Ga0070670_100002102
339 Ga0068869_100081065
340 Ga0070680_100100692
341 Ga0070682_100005386
342 Ga0068868_100027890
343 Ga0068868_100875345
344 Ga0070689_102182306
345 Ga0070687_100025160
346 Ga0070692_10063179
347 Ga0070692_10441585
348 Ga0070669_100089061
349 Ga0070669_100544624
350 Ga0070671_100118988
351 Ga0070673_100059328
352 Ga0070673_100288272
353 Ga0070673_100540074
354 Ga0070673_100652817
355 Ga0070673_100824226
356 Ga0070673_100882869
357 Ga0070673_101343154
358 Ga0070667_100115434
359 Ga0070701_10062138
360 Ga0070701_10442693
361 Ga0070700_100091160
362 Ga0070700_100343594
363 Ga0070700_100967047
364 Ga0070700_101674136
365 Ga0070694_100058859
366 Ga0070694_100241984
367 Ga0070708_100003716
368 Ga0070708_101645494
369 Ga0070678_100877035
370 Ga0070678_101690766
371 Ga0068867_100104481
372 Ga0068867_100116670
373 Ga0068867_100267947
374 Ga0070685_10851102
375 Ga0070706_100006829
376 Ga0070706_100548368
377 Ga0070707_100479327
378 Ga0070707_102254908
379 Ga0070698_100008079
380 Ga0070698_100026408
381 Ga0070698_100872956
382 Ga0070699_100004780
383 Ga0070697_100967918
384 Ga0070672_100344985
385 Ga0070672_100351045
386 Ga0070686_100035981
387 Ga0070686_100037771
388 Ga0070695_100334027
389 Ga0070695_100817563
390 Ga0070695_100941706
391 Ga0070695_101213273
392 Ga0070696_100017772
393 Ga0070696_100351812
394 Ga0070696_101008725
395 Ga0070693_100067468
396 Ga0070693_100510708
397 Ga0070665_100083617
398 Ga0070665_100688138
399 Ga0070704_100231100
400 Ga0070704_100487584
401 Ga0070704_101067123
402 Ga0068855_101369734
403 Ga0068855_101708354
404 Ga0070664_100012844
405 Ga0070664_100099938
406 Ga0070664_100151439
407 Ga0070664_100349370
408 Ga0068857_100026669
409 Ga0068857_100086595
410 Ga0068857_101200135
411 Ga0068854_101355867
412 Ga0070702_100054693
413 Ga0070702_100208909
414 Ga0068852_101624227
415 Ga0068859_100015753
416 Ga0068859_100506578
417 Ga0068859_100640807
418 Ga0068864_100030450
419 Ga0068864_100388302
420 Ga0068864_101058640
421 Ga0068864_101992865
422 Ga0068861_100761310
423 Ga0068861_100802643
424 Ga0068863_100353321
425 Ga0068863_100380740
426 Ga0068863_100981527
427 Ga0068858_100075231
428 Ga0068858_100098426
429 Ga0068858_100102862
430 Ga0068858_100263651
431 Ga0068858_100691121
432 Ga0068860_100043913
433 Ga0068860_100048220
434 Ga0068860_100084696
435 Ga0068860_100249673
436 Ga0068860_100279734
437 Ga0068860_101547235
438 Ga0068862_100045956
439 Ga0068862_101987255
440 Ga0081540_1089460
441 Ga0081539_10044012
442 Ga0097621_100008163
443 Ga0097621_100013236
444 Ga0068871_100003200
445 Ga0068871_100007595
446 Ga0068871_100570414
447 Ga0075428_100666222
448 Ga0075430_100440452
449 Ga0075431_100248226
450 Ga0075429_100123102
451 Ga0068865_100442667
452 Ga0097620_100015753
453 Ga0097620_100506620
454 Ga0097620_100640733
455 Ga0097620_102710827
456 Ga0075435_100085576
457 Ga0075435_100241862
458 Ga0075435_100618407
459 Ga0105251_10383897
460 Ga0105245_10384693
461 Ga0105245_11004852
462 Ga0105247_10000421
463 Ga0114129_10045409
464 Ga0114129_10064789
465 Ga0114129_10442243
466 Ga0114129_10588603
467 Ga0114129_11453689
468 Ga0114129_11668082
469 Ga0105243_10087186
470 Ga0105243_10832665
471 Ga0105243_12530559
472 Ga0105241_10806535
473 Ga0105241_10946850
474 Ga0105241_12517319
475 Ga0105241_12609975
476 Ga0105242_10594148
477 Ga0105242_12345803
478 Ga0105248_10140039
479 Ga0105248_10183136
480 Ga0105248_10680049
481 Ga0105248_11383185
482 Ga0105248_11508459
483 Ga0105248_12270874
484 Ga0105237_10492776
485 Ga0105249_10039509
486 Ga0105249_10688000
487 Ga0105249_13089561
488 Ga0105239_11130507
489 Ga0105239_11495816
490 Ga0105246_10168228
491 Ga0105246_11657119
492 Ga0157373_10341770
493 Ga0157371_10171970
494 Ga0157371_10808919
495 Ga0157374_10258178
496 Ga0157374_10262987
497 Ga0157378_10370915
498 Ga0157378_10481516
499 Ga0157378_10642195
500 Ga0157378_10650215
501 Ga0157378_11017156
502 Ga0157378_11265895
503 Ga0163162_10004385
504 Ga0163162_10020007
505 Ga0163162_10132429
506 Ga0163162_11051022
507 Ga0163162_11179108
508 Ga0157372_10253147
509 Ga0157375_10226777
510 Ga0157375_10933914
511 Ga0157375_13330323
512 Ga0163163_10001070
513 Ga0163163_10002106
514 Ga0163163_10003204
515 Ga0163163_10156281
516 Ga0163163_11011621
517 Ga0157379_10520987
518 Ga0157379_11311395
519 Ga0157379_11359932
520 Ga0157376_10396446
521 Ga0163161_10387154
522 Ga0207713_1099813
523 Ga0207710_10000553
524 Ga0207647_10016890
525 Ga0207684_10074839
526 Ga0207684_10251882
527 Ga0207654_10099399
528 Ga0207707_10121322
529 Ga0207671_10147135
530 Ga0207671_11024342
531 Ga0207662_10029956
532 Ga0207649_10089164
533 Ga0207652_10146084
534 Ga0207646_10107950
535 Ga0207646_10335382
536 Ga0207681_10057434
537 Ga0207650_10000005
538 Ga0207650_10246836
539 Ga0207659_10173386
540 Ga0207687_11787240
541 Ga0207690_10066747
542 Ga0207706_10230229
543 Ga0207686_10341927
544 Ga0207709_10004720
545 Ga0207709_10902872
546 Ga0207670_11660715
547 Ga0207704_10840193
548 Ga0207691_10332668
549 Ga0207711_10508890
550 Ga0207711_10804677
551 Ga0207711_11030238
552 Ga0207711_11555879
553 Ga0207689_10096786
554 Ga0207689_10198257
555 Ga0207689_10273610
556 Ga0207689_10955980
557 Ga0207679_10045657
558 Ga0207679_10100252
559 Ga0207679_10159923
560 Ga0207679_10361494
561 Ga0207679_10593993
562 Ga0207651_10020354
563 Ga0207651_10299188
564 Ga0207651_10430031
565 Ga0207651_10583177
566 Ga0207651_10732069
567 Ga0207712_10000695
568 Ga0207640_10748243
569 Ga0207640_11194941
570 Ga0207640_11270668
571 Ga0207658_10512724
572 Ga0207677_10894975
573 Ga0207703_10048728
574 Ga0207703_10097539
575 Ga0207703_10219110
576 Ga0207703_10233561
577 Ga0207639_10230409
578 Ga0207639_10408938
579 Ga0207708_10115050
580 Ga0207708_10126360
581 Ga0207708_10898192
582 Ga0207641_10457115
583 Ga0207641_11073975
584 Ga0207641_11595054
585 Ga0207648_10058580
586 Ga0207648_10092846
587 Ga0207648_10349743
588 Ga0207648_10712891
589 Ga0207676_10212720
590 Ga0207676_10250663
591 Ga0207676_10786314
592 Ga0207676_11783816
593 Ga0207674_10002367
594 Ga0207674_10063709
595 Ga0207674_10495476
596 Ga0207674_10664793
597 Ga0207675_100698914
598 Ga0207675_100912258
599 Ga0207683_11527260
600 Ga0207698_10827595
601 Ga0268266_10048331
602 Ga0268265_10129176
603 Ga0268264_10034849
604 Ga0268264_10049462
605 Ga0268264_10128504
606 Ga0268264_10285199
607 Ga0268264_10847703
608 Ga0268264_11168685
609 Ga0307405_10819884
610 Ga0307405_12087869
611 Ga0307410_11087280
612 Ga0307406_11106301
613 Ga0307409_101837295
614 Ga0307416_100210832
615 Ga0307416_101436882
616 Ga0307411_10434335
617 Ga0373961_0166111
618 Ga0373937_0751765
619 Ga0439439_0163846
620 Ga0451787_629879
621 Ga0439457_166341
622 Ga0439434_0085623
623 Ga0495651_0843971
624 Ga0496113_0662048
625 Ga0496113_0716868
626 Ga0501295_032250
627 Ga0501202_027397
628 Ga0501202_088299
629 Ga0501217_269593
630 Ga0501227_253623
631 Ga0501235_032929
632 Ga0501221_019529
633 nmdc:mga05p37_260963_c1
634 nmdc:mga05p37_275469_c1
635 nmdc:mga05p37_31051_c1
636 nmdc:mga09592_443821_c1
637 nmdc:mga06r32_354270_c1
638 nmdc:mga06r32_849878_c1
639 nmdc:mga0rr50_1205394_c1
640 nmdc:mga0rr50_1523328_c1
641 nmdc:mga0rr50_42909_c1
642 nmdc:mga08x19_1324051_c1
643 nmdc:mga0a205_100811_c1
644 nmdc:mga0a205_802335_c1
645 Ga0495655_0070267
646 Ga0530510_0375058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tjx-assembly1.cif.gz_F yeast atp synthase f1 region state 1binding(a-d) with 10 mm atp 0.7493 1 42
7uwb-assembly1.cif.gz_B citrus v-atpase state 2, highest-resolution class 0.7212 3 42
7tjx-assembly1.cif.gz_D yeast atp synthase f1 region state 1binding(a-d) with 10 mm atp 0.716 1 42
3fks-assembly2.cif.gz_N yeast f1 atpase in the absence of bound nucleotides 0.711 1 42
7tjx-assembly1.cif.gz_E yeast atp synthase f1 region state 1binding(a-d) with 10 mm atp 0.7031 1 43
ID Description Score Start End Superfamily
af_K7KBX4_379_692_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7647 3 40 1.10.510.10
4l1nA00 Mainly Beta;Beta Barrel;Lipocalin;Uncharacterised protein PF15525, DUF4652 0.7591 22 43 2.40.128.660
4c47C01 Mainly Beta;Sandwich;Immunoglobulin-like;Lipoprotein YajI-like 0.7557 10 41 2.60.40.1620
4gy5B02 Mainly Beta;Roll;SH3 type barrels.; 0.6986 2 41 2.30.30.1150
3tw7B03 Alpha Beta;Roll;pyruvate carboxylase f1077a mutant fold;pyruvate carboxylase f1077a mutant domain 0.6941 4 40 3.10.600.10
ID Description Score Start End GO Terms
AF-A0A352F3F4-F1-model_v4 Uncharacterized protein 0.9469 1 86
AF-A0A2V8MIL0-F1-model_v4 Uncharacterized protein 0.9448 1 117
AF-A0A7W1GAB4-F1-model_v4 Uncharacterized protein 0.941 1 117
AF-A0A2V8MIL0-F1-model_v4 Uncharacterized protein 0.937 1 117
AF-A0A2V8N089-F1-model_v4 Uncharacterized protein 0.9353 3 117

Map