F406693

General Info

Members Datasets Scaffolds Average Seq Length
322 146 300 376

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738541297|2738826027
Length 447
Sequence TPATPDAGPPETPPADSAAAAAGHAGATDVASIAAVGAEVAPTMPPVALVDAEVATGVPPVAPINRRKRERPPLAPATRSSPITRAALLAYLFLIIYASWFPFSGWHNQGLSPFIFLETMKMPRYWTLFDAITNVIGYVPLGTLIVYSLYPRIKGIWALLIAAAAGALVSGTMEAVQTFLPTRVSSNLDFYTNAIGCALGGLIGVLTVRRLLDRSQLQRLRREWFAPHASQGLVLLALWPLAQIYPQNFLYGLGQILPILSDWLSQLLDMEVDLAGLIRPDVDLTVEQYWLSETIITACGMVGAGLTLLCLLRKPAPRGLLVCAMIAASVLIKGLATALLFSPENAFVWVTPGAEGGFLIGAIMLAGLTYAPHVAQRRLAVTTLLLGLVIINTTPANPYFVATLQTWVQGKFLNFNGAAQFLSLLWPFFAVWFLWLPSHKLNAAKVS

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221645 Massilia sp. Root351 Isolate Unclassified
3 2643221664 Massilia sp. Root418 Isolate Unclassified
4 2643221684 Massilia sp. Root133 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738541297 Duganella sp. GV083 Isolate Unclassified
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
15 2821131069 Duganella sp. 1224 Isolate Unclassified
16 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
17 2857558681 Duganella sp. R-74565 Isolate Unclassified
18 2919476304 Duganella sp. 3397 Isolate Unclassified
19 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
20 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
21 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
40 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
41 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
57 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
58 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
64 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
65 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
68 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
69 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
70 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
71 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
72 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
75 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
76 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
77 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
78 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
79 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
92 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
104 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
105 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
111 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
112 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
142 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
143 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
144 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
145 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
146 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.17
Metatranscriptomes 0
Isolates 6.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.73
Nodule 0.93
Rhizoplane 2.17
Rhizosphere 74.53
Stem 0
Stem Tuber 0
Unclassified 9.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000654 3300002773 Bacteria 18161
2 JGI25150J39212_1002095 3300002774 Bacteria 5166
3 JGI25153J46596_10008256 3300003215 Bacteria 4999
4 rootL2_10064164 3300003322 Bacteria 4901
5 JGI25161J50226_1001616 3300003374 Bacteria 6542
6 Ga0055526_1000149 3300003771 Bacteria 61682
7 Ga0055537_1000578 3300003773 Bacteria 20349
8 Ga0055524_1000124 3300003775 Bacteria 90282
9 Ga0055524_1001352 3300003775 Bacteria 14281
10 Ga0055524_1005896 3300003775 Bacteria 5399
11 Ga0055534_1000489 3300003784 Bacteria 21927
12 Ga0055528_1000575 3300003790 Bacteria 27746
13 Ga0055531_10006260 3300003794 Bacteria 6789
14 Ga0055543_1002129 3300004625 Bacteria 6850
15 Ga0065165_1005706 3300005262 Bacteria 6850
16 Ga0070658_10100179 3300005327 Bacteria 2394
17 Ga0068855_100005477 3300005563 Bacteria 15488
18 Ga0099826_10002381 3300006948 Bacteria 12104
19 Ga0157376_10164935 3300014969 Bacteria 2012
20 Ga0182006_1000216 3300015261 Bacteria 56213
21 Ga0182005_1000119 3300015265 Bacteria 57192
22 Ga0209436_100806 3300025208 Bacteria 12786
23 Ga0209436_101730 3300025208 Bacteria 7176
24 Ga0209672_103525 3300025228 Bacteria 3206
25 Ga0207425_1000493 3300025245 Bacteria 24717
26 Ga0207425_1000761 3300025245 Bacteria 16694
27 Ga0209129_1000600 3300025258 Bacteria 24491
28 Ga0209565_1000112 3300025263 Bacteria 117209
29 Ga0209565_1002451 3300025263 Bacteria 6682
30 Ga0209565_1004807 3300025263 Bacteria 4041
31 Ga0209673_1000210 3300025273 Bacteria 117276
32 Ga0209673_1007381 3300025273 Bacteria 5084
33 Ga0209130_1000016 3300025284 Bacteria 395540
34 Ga0209130_1002714 3300025284 Bacteria 8411
35 Ga0209130_1003164 3300025284 Bacteria 7277
36 Ga0209675_1000761 3300025291 Bacteria 21640
37 Ga0209564_1000010 3300025295 Bacteria 885399
38 Ga0209564_1000245 3300025295 Bacteria 117378
39 Ga0209564_1013029 3300025295 Bacteria 3566
40 Ga0209758_1001720 3300025297 Bacteria 24474
41 Ga0209050_1000086 3300025298 Bacteria 262009
42 Ga0209256_1000268 3300025299 Bacteria 91897
43 Ga0209256_1001618 3300025299 Bacteria 21976
44 Ga0209256_1002073 3300025299 Bacteria 17627
45 Ga0209257_1006299 3300025304 Bacteria 7744
46 Ga0207655_1004989 3300025728 Bacteria 9194
47 Ga0207667_10000043 3300025949 Bacteria 261426
48 Ga0209281_1016984 3300027111 Bacteria 1485
49 Ga0209282_1000066 3300027666 Bacteria 87072
50 Ga0316177_1060566 3300030731 Bacteria 2543
51 Ga0307408_100001878 3300031548 Bacteria 15299
52 Ga0307408_100006441 3300031548 Bacteria 7781
53 Ga0395899_0004310 3300037312 Bacteria 11107
54 Ga0395900_0004198 3300037418 Bacteria 15292
55 Ga0395901_0001364 3300038443 Bacteria 25549
56 Ga0395901_0025255 3300038443 Bacteria 6099
57 Ga0395901_0255660 3300038443 Bacteria 1824
58 Ga0466972_0000098 3300044658 Bacteria 76807
59 Ga0466965_0009250 3300044683 Bacteria 4578
60 Ga0466968_0000688 3300044735 Bacteria 11662
61 Ga0466959_0011324 3300045049 Bacteria 6406
62 Ga0466959_0041902 3300045049 Bacteria 3379
63 Ga0466959_0064496 3300045049 Bacteria 2659
64 Ga0495617_000471 3300046452 Bacteria 21547
65 Ga0495617_004040 3300046452 Bacteria 5392
66 Ga0495617_026983 3300046452 Bacteria 1934
67 Ga0495627_000378 3300046453 Bacteria 40927
68 Ga0495627_052853 3300046453 Bacteria 1217
69 Ga0495590_0000201 3300046457 Bacteria 33657
70 Ga0495590_0002437 3300046457 Bacteria 7707
71 Ga0495590_0053030 3300046457 Bacteria 1416
72 Ga0495638_0000170 3300046460 Bacteria 101629
73 Ga0495638_0004523 3300046460 Bacteria 10535
74 Ga0495638_0032923 3300046460 Bacteria 3317
75 Ga0495653_0000959 3300046463 Bacteria 22101
76 Ga0495650_0001085 3300046471 Bacteria 29863
77 Ga0495650_0001553 3300046471 Bacteria 21682
78 Ga0495650_0003055 3300046471 Bacteria 12597
79 Ga0495650_0003201 3300046471 Bacteria 12180
80 Ga0495650_0008575 3300046471 Bacteria 5939
81 Ga0495650_0022622 3300046471 Bacteria 3011
82 Ga0495605_0000635 3300046474 Bacteria 26971
83 Ga0495605_0000941 3300046474 Bacteria 19886
84 Ga0495605_0004232 3300046474 Bacteria 8451
85 Ga0495605_0011619 3300046474 Bacteria 4902
86 Ga0495639_0008622 3300046475 Bacteria 4373
87 Ga0495584_0001867 3300046491 Bacteria 12189
88 Ga0495584_0003316 3300046491 Bacteria 8912
89 Ga0495584_0017479 3300046491 Bacteria 3651
90 Ga0495585_0001517 3300046492 Bacteria 18039
91 Ga0495585_0002611 3300046492 Bacteria 12720
92 Ga0495585_0090694 3300046492 Bacteria 1646
93 Ga0495585_0108877 3300046492 Bacteria 1475
94 Ga0495594_0003144 3300046499 Bacteria 8534
95 Ga0495596_0000350 3300046500 Bacteria 29880
96 Ga0495596_0003693 3300046500 Bacteria 7651
97 Ga0495596_0043572 3300046500 Bacteria 1768
98 Ga0495607_0005276 3300046501 Bacteria 9295
99 Ga0495607_0017549 3300046501 Bacteria 4590
100 Ga0495607_0024396 3300046501 Bacteria 3771
101 Ga0495607_0040080 3300046501 Bacteria 2791
102 Ga0495607_0082638 3300046501 Bacteria 1761
103 Ga0495607_0085669 3300046501 Bacteria 1720
104 Ga0495583_0000329 3300046506 Bacteria 75158
105 Ga0495583_0000952 3300046506 Bacteria 33646
106 Ga0495583_0001471 3300046506 Bacteria 23592
107 Ga0495583_0001555 3300046506 Bacteria 22720
108 Ga0495583_0005068 3300046506 Bacteria 9096
109 Ga0495606_0001517 3300046507 Bacteria 30788
110 Ga0495606_0001842 3300046507 Bacteria 26721
111 Ga0495606_0002312 3300046507 Bacteria 22449
112 Ga0495606_0003575 3300046507 Bacteria 16390
113 Ga0495606_0004131 3300046507 Bacteria 14744
114 Ga0495606_0007799 3300046507 Bacteria 9473
115 Ga0495606_0010870 3300046507 Bacteria 7494
116 Ga0495606_0059035 3300046507 Bacteria 2462
117 Ga0495606_0117924 3300046507 Bacteria 1592
118 Ga0495610_0000014 3300046512 Bacteria 444708
119 Ga0495610_0003364 3300046512 Bacteria 12537
120 Ga0495610_0013844 3300046512 Bacteria 4768
121 Ga0495610_0042339 3300046512 Bacteria 2279
122 Ga0495616_0000547 3300046513 Bacteria 28354
123 Ga0495616_0039731 3300046513 Bacteria 2407
124 Ga0495628_0008571 3300046516 Bacteria 8759
125 Ga0495631_0024290 3300046518 Bacteria 2798
126 Ga0495632_0001345 3300046519 Bacteria 20659
127 Ga0495632_0005648 3300046519 Bacteria 8226
128 Ga0495637_0000454 3300046520 Bacteria 29844
129 Ga0495637_0010764 3300046520 Bacteria 4412
130 Ga0495637_0014266 3300046520 Bacteria 3750
131 Ga0495643_0000891 3300046522 Bacteria 31774
132 Ga0495643_0001198 3300046522 Bacteria 25224
133 Ga0495643_0004987 3300046522 Bacteria 9103
134 Ga0495643_0039683 3300046522 Bacteria 2574
135 Ga0495644_0002361 3300046523 Bacteria 7521
136 Ga0495644_0005920 3300046523 Bacteria 4768
137 Ga0495644_0008429 3300046523 Bacteria 3972
138 Ga0495644_0013724 3300046523 Bacteria 3105
139 Ga0495644_0040329 3300046523 Bacteria 1760
140 Ga0495648_0000751 3300046524 Bacteria 34631
141 Ga0495648_0003454 3300046524 Bacteria 13901
142 Ga0495648_0003840 3300046524 Bacteria 13034
143 Ga0495648_0012266 3300046524 Bacteria 6402
144 Ga0495648_0013963 3300046524 Bacteria 5909
145 Ga0495648_0016118 3300046524 Bacteria 5393
146 Ga0495663_0002083 3300046525 Bacteria 6121
147 Ga0495663_0017087 3300046525 Bacteria 2056
148 Ga0495642_0001627 3300046528 Bacteria 9782
149 Ga0495642_0002398 3300046528 Bacteria 7635
150 Ga0495642_0003881 3300046528 Bacteria 5864
151 Ga0495642_0009654 3300046528 Bacteria 3693
152 Ga0495642_0018748 3300046528 Bacteria 2709
153 Ga0495652_0008103 3300046529 Bacteria 9618
154 Ga0495654_0000245 3300046530 Bacteria 50772
155 Ga0495654_0005009 3300046530 Bacteria 7776
156 Ga0495654_0008873 3300046530 Bacteria 5527
157 Ga0495609_0001172 3300046538 Bacteria 18081
158 Ga0495609_0001326 3300046538 Bacteria 16800
159 Ga0495609_0001862 3300046538 Bacteria 13482
160 Ga0495609_0006270 3300046538 Bacteria 6094
161 Ga0495609_0015240 3300046538 Bacteria 3600
162 Ga0495609_0018925 3300046538 Bacteria 3189
163 Ga0495597_0009791 3300046542 Bacteria 4717
164 Ga0495597_0020826 3300046542 Bacteria 3050
165 Ga0495597_0062954 3300046542 Bacteria 1613
166 Ga0495597_0069316 3300046542 Bacteria 1522
167 Ga0495622_0000440 3300046557 Bacteria 26975
168 Ga0495622_0001964 3300046557 Bacteria 10077
169 Ga0495622_0003120 3300046557 Bacteria 7857
170 Ga0495622_0016164 3300046557 Bacteria 3474
171 Ga0495622_0052533 3300046557 Bacteria 1891
172 Ga0495633_0000663 3300046558 Bacteria 31797
173 Ga0495633_0001228 3300046558 Bacteria 20576
174 Ga0495633_0001987 3300046558 Bacteria 14800
175 Ga0495633_0007406 3300046558 Bacteria 6319
176 Ga0495633_0007942 3300046558 Bacteria 6048
177 Ga0495633_0012358 3300046558 Bacteria 4545
178 Ga0495633_0014720 3300046558 Bacteria 4079
179 Ga0495633_0017117 3300046558 Bacteria 3715
180 Ga0495656_0010312 3300046615 Bacteria 3393
181 Ga0495656_0084126 3300046615 Bacteria 1442
182 Ga0495668_0000188 3300046616 Bacteria 92177
183 Ga0495668_0000944 3300046616 Bacteria 32399
184 Ga0495668_0001593 3300046616 Bacteria 21330
185 Ga0495668_0006127 3300046616 Bacteria 7963
186 Ga0495611_0033043 3300046648 Bacteria 2282
187 Ga0495625_0001377 3300046660 Bacteria 29891
188 Ga0495625_0002229 3300046660 Bacteria 21422
189 Ga0495625_0007078 3300046660 Bacteria 9859
190 Ga0495625_0007549 3300046660 Bacteria 9441
191 Ga0495625_0114063 3300046660 Bacteria 1845
192 Ga0495659_0000345 3300046664 Bacteria 18182
193 Ga0495659_0000524 3300046664 Bacteria 14141
194 Ga0495661_0001576 3300046665 Bacteria 18787
195 Ga0495661_0008346 3300046665 Bacteria 7170
196 Ga0495661_0118610 3300046665 Bacteria 1464
197 Ga0495661_0143671 3300046665 Bacteria 1295
198 Ga0495588_0000172 3300046674 Bacteria 81934
199 Ga0495588_0057140 3300046674 Bacteria 2015
200 Ga0495646_0001961 3300046680 Bacteria 12404
201 Ga0495670_0002602 3300046691 Bacteria 8915
202 Ga0495670_0003908 3300046691 Bacteria 7320
203 Ga0495670_0010573 3300046691 Bacteria 4536
204 Ga0495670_0027794 3300046691 Bacteria 2804
205 Ga0495670_0030660 3300046691 Bacteria 2671
206 Ga0495671_0001130 3300046692 Bacteria 18376
207 Ga0495671_0006115 3300046692 Bacteria 6987
208 Ga0495671_0069378 3300046692 Bacteria 1732
209 Ga0495649_0001795 3300046694 Bacteria 15780
210 Ga0495649_0023650 3300046694 Bacteria 3432
211 Ga0495589_0001840 3300046794 Bacteria 12048
212 Ga0495589_0013151 3300046794 Bacteria 4271
213 Ga0495589_0015806 3300046794 Bacteria 3880
214 Ga0495660_0001060 3300046810 Bacteria 19886
215 Ga0495660_0002065 3300046810 Bacteria 13039
216 Ga0495660_0012516 3300046810 Bacteria 4925
217 Ga0495660_0013326 3300046810 Bacteria 4765
218 Ga0495660_0016882 3300046810 Bacteria 4206
219 Ga0495660_0019280 3300046810 Bacteria 3916
220 Ga0495660_0021945 3300046810 Bacteria 3650
221 Ga0495660_0075702 3300046810 Bacteria 1775
222 Ga0495636_0000487 3300047318 Bacteria 14598
223 Ga0495636_0001239 3300047318 Bacteria 9652
224 Ga0495636_0036851 3300047318 Bacteria 2019
225 Ga0495636_0037440 3300047318 Bacteria 2003
226 Ga0495636_0041612 3300047318 Bacteria 1907
227 Ga0495672_0000019 3300047320 Bacteria 448153
228 Ga0495672_0000653 3300047320 Bacteria 38570
229 Ga0495672_0000859 3300047320 Bacteria 32082
230 Ga0495672_0001040 3300047320 Bacteria 28407
231 Ga0495672_0001685 3300047320 Bacteria 21405
232 Ga0495672_0008878 3300047320 Bacteria 7350
233 Ga0495672_0020386 3300047320 Bacteria 4347
234 Ga0495676_0027224 3300047321 Bacteria 4906
235 Ga0495676_0040236 3300047321 Bacteria 3860
236 Ga0495676_0066536 3300047321 Bacteria 2792
237 Ga0495683_0003705 3300047323 Bacteria 8849
238 Ga0495683_0015513 3300047323 Bacteria 3962
239 Ga0495687_000405 3300047443 Bacteria 53349
240 Ga0495687_000801 3300047443 Bacteria 33906
241 Ga0495687_005076 3300047443 Bacteria 8543
242 Ga0495677_0002298 3300047445 Bacteria 7536
243 Ga0495677_0002950 3300047445 Bacteria 6615
244 Ga0495677_0014443 3300047445 Bacteria 2875
245 Ga0495677_0031148 3300047445 Bacteria 1941
246 Ga0495685_000157 3300047447 Bacteria 23115
247 Ga0495685_055838 3300047447 Bacteria 1335
248 Ga0495673_0000012 3300047469 Bacteria 656908
249 Ga0495673_0000604 3300047469 Bacteria 35726
250 Ga0495673_0000925 3300047469 Bacteria 26621
251 Ga0495673_0009315 3300047469 Bacteria 5441
252 Ga0495673_0046294 3300047469 Bacteria 1928
253 Ga0495681_0036901 3300047470 Bacteria 2413
254 Ga0495681_0040243 3300047470 Bacteria 2277
255 Ga0495686_0002160 3300047472 Bacteria 19191
256 Ga0495686_0005894 3300047472 Bacteria 9551
257 Ga0495686_0006674 3300047472 Bacteria 8787
258 Ga0495602_0106881 3300048088 Bacteria 2283
259 Ga0495615_0001342 3300048090 Bacteria 3615
260 Ga0495615_0010498 3300048090 Bacteria 1854
261 Ga0495626_0001243 3300048091 Bacteria 20917
262 Ga0495626_0001440 3300048091 Bacteria 18927
263 Ga0495626_0005810 3300048091 Bacteria 7117
264 Ga0496100_0045257 3300048903 Bacteria 2823
265 Ga0496101_0030178 3300048904 Bacteria 3798
266 Ga0496102_0047863 3300048905 Bacteria 3887
267 Ga0496103_0001711 3300048906 Bacteria 14355
268 Ga0496109_0020358 3300048912 Bacteria 5860
269 Ga0496113_0020764 3300048916 Bacteria 4624
270 Ga0496114_0036089 3300048917 Bacteria 4086
271 Ga0496121_0078653 3300048924 Bacteria 2621
272 Ga0496122_0006856 3300048925 Bacteria 12908
273 Ga0496122_0011140 3300048925 Bacteria 9158
274 Ga0496122_0046444 3300048925 Bacteria 3363
275 Ga0496123_0006778 3300048926 Bacteria 11006
276 Ga0496123_0007415 3300048926 Bacteria 10343
277 Ga0496123_0009556 3300048926 Bacteria 8717
278 Ga0496124_0023414 3300048927 Bacteria 5638
279 Ga0496125_0001086 3300048928 Bacteria 41927
280 Ga0496125_0011120 3300048928 Bacteria 9027
281 Ga0496126_0043986 3300048929 Bacteria 4115
282 Ga0496126_0077535 3300048929 Bacteria 2946
283 Ga0495678_000027 3300049459 Bacteria 222075
284 Ga0495678_001082 3300049459 Bacteria 23004
285 Ga0495678_001837 3300049459 Bacteria 15562
286 Ga0495678_002154 3300049459 Bacteria 13912
287 Ga0495678_007455 3300049459 Bacteria 5668
288 Ga0495678_009616 3300049459 Bacteria 4765
289 Ga0495678_016584 3300049459 Bacteria 3364
290 Ga0495682_0001880 3300049460 Bacteria 10462
291 Ga0495682_0002150 3300049460 Bacteria 9565
292 Ga0495682_0003248 3300049460 Bacteria 7285
293 Ga0495682_0003922 3300049460 Bacteria 6495
294 Ga0501036_0108013 3300049572 Bacteria 2353
295 Ga0501238_000556 3300049671 Bacteria 4310
296 Ga0501249_002201 3300049679 Bacteria 3964
297 Ga0501269_000385 3300049766 Bacteria 10570
298 Ga0500559_0100055 3300053136 Bacteria 1335
299 Ga0500586_000619 3300053145 Bacteria 7214
300 Ga0500586_001058 3300053145 Bacteria 5672

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_052853 Ga0495627_052853_262_1203 308
2 3300046452 Ga0495617_026983 Ga0495617_026983_563_1690 335
3 3300046557 Ga0495622_0052533 Ga0495622_0052533_85_1212 335
4 3300047318 Ga0495636_0036851 Ga0495636_0036851_556_1683 335
5 3300046518 Ga0495631_0024290 Ga0495631_0024290_1526_2653 338
6 3300046522 Ga0495643_0039683 Ga0495643_0039683_1157_2284 338
7 3300046523 Ga0495644_0005920 Ga0495644_0005920_1796_2923 338
8 3300046538 Ga0495609_0001326 Ga0495609_0001326_13858_14985 338
9 3300047469 Ga0495673_0046294 Ga0495673_0046294_676_1803 338
10 3300046492 Ga0495585_0001517 Ga0495585_0001517_7173_8300 340
11 3300047469 Ga0495673_0000604 Ga0495673_0000604_29207_30451 346
12 3300046674 Ga0495588_0057140 Ga0495588_0057140_716_1855 348
13 3300048905 Ga0496102_0047863 Ga0496102_0047863_1966_3111 348
14 3300046692 Ga0495671_0006115 Ga0495671_0006115_5376_6692 350
15 3300049460 Ga0495682_0003922 Ga0495682_0003922_866_1990 350
16 3300037312 Ga0395899_0004310 Ga0395899_0004310_53_1261 351
17 3300038443 Ga0395901_0025255 Ga0395901_0025255_235_1443 351
18 3300046471 Ga0495650_0022622 Ga0495650_0022622_70_1428 351
19 3300025228 Ga0209672_103525 Ga0209672_1035253 352
20 3300046516 Ga0495628_0008571 Ga0495628_0008571_6555_7712 352
21 3300046529 Ga0495652_0008103 Ga0495652_0008103_5269_6426 352
22 3300046680 Ga0495646_0001961 Ga0495646_0001961_4011_5168 352
23 3300048088 Ga0495602_0106881 Ga0495602_0106881_1113_2270 352
24 3300045049 Ga0466959_0011324 Ga0466959_0011324_1023_2186 353
25 3300046471 Ga0495650_0001085 Ga0495650_0001085_23057_24223 353
26 3300046507 Ga0495606_0010870 Ga0495606_0010870_3151_4317 353
27 3300047472 Ga0495686_0002160 Ga0495686_0002160_12422_13612 353
28 3300048924 Ga0496121_0078653 Ga0496121_0078653_421_1623 353
29 3300047472 Ga0495686_0006674 Ga0495686_0006674_2348_3478 354
30 3300046524 Ga0495648_0000751 Ga0495648_0000751_6560_7744 355
31 3300046558 Ga0495633_0000663 Ga0495633_0000663_24214_25398 355
32 3300046660 Ga0495625_0001377 Ga0495625_0001377_6480_7664 355
33 3300031548 Ga0307408_100001878 Ga0307408_1000018787 356
34 3300046453 Ga0495627_000378 Ga0495627_000378_5683_6999 357
35 3300046460 Ga0495638_0000170 Ga0495638_0000170_6427_7611 357
36 3300046506 Ga0495583_0000952 Ga0495583_0000952_25842_27026 357
37 3300046523 Ga0495644_0040329 Ga0495644_0040329_558_1685 357
38 3300046528 Ga0495642_0001627 Ga0495642_0001627_2305_3489 357
39 3300046538 Ga0495609_0018925 Ga0495609_0018925_590_1774 357
40 3300046557 Ga0495622_0001964 Ga0495622_0001964_6620_7804 357
41 3300046691 Ga0495670_0010573 Ga0495670_0010573_2379_3506 357
42 3300048917 Ga0496114_0036089 Ga0496114_0036089_737_1891 357
43 3300048929 Ga0496126_0077535 Ga0496126_0077535_161_1315 357
44 3300049459 Ga0495678_007455 Ga0495678_007455_2119_3303 357
45 3300049459 Ga0495678_016584 Ga0495678_016584_1107_2291 357
46 3300005563 Ga0068855_100005477 Ga0068855_10000547711 358
47 3300025949 Ga0207667_10000043 Ga0207667_10000043243 358
48 3300048928 Ga0496125_0001086 Ga0496125_0001086_4499_5653 358
49 3300046452 Ga0495617_000471 Ga0495617_000471_14742_16097 360
50 3300046506 Ga0495583_0005068 Ga0495583_0005068_4740_5900 360
51 3300046507 Ga0495606_0117924 Ga0495606_0117924_26_1126 360
52 3300046512 Ga0495610_0000014 Ga0495610_0000014_438083_439297 360
53 3300046524 Ga0495648_0012266 Ga0495648_0012266_4041_5255 360
54 3300046524 Ga0495648_0016118 Ga0495648_0016118_540_1895 360
55 3300046615 Ga0495656_0084126 Ga0495656_0084126_350_1432 360
56 3300046810 Ga0495660_0002065 Ga0495660_0002065_5414_6514 360
57 3300047318 Ga0495636_0037440 Ga0495636_0037440_446_1606 360
58 3300048925 Ga0496122_0046444 Ga0496122_0046444_1292_2530 360
59 3300048926 Ga0496123_0006778 Ga0496123_0006778_5477_6715 360
60 3300014969 Ga0157376_10164935 Ga0157376_101649352 361
61 3300015261 Ga0182006_1000216 Ga0182006_10002167 361
62 3300015265 Ga0182005_1000119 Ga0182005_10001197 361
63 3300027111 Ga0209281_1016984 Ga0209281_10169841 361
64 3300046457 Ga0495590_0002437 Ga0495590_0002437_5736_6821 361
65 3300046463 Ga0495653_0000959 Ga0495653_0000959_15372_16622 361
66 3300046507 Ga0495606_0059035 Ga0495606_0059035_606_1691 361
67 3300047447 Ga0495685_055838 Ga0495685_055838_176_1261 361
68 3300003775 Ga0055524_1005896 Ga0055524_10058963 362
69 3300025263 Ga0209565_1000112 Ga0209565_100011279 362
70 3300025273 Ga0209673_1000210 Ga0209673_10002108 362
71 3300025291 Ga0209675_1000761 Ga0209675_10007618 362
72 3300025295 Ga0209564_1000245 Ga0209564_10002457 362
73 3300025295 Ga0209564_1013029 Ga0209564_10130294 362
74 3300025299 Ga0209256_1001618 Ga0209256_100161816 362
75 3300046475 Ga0495639_0008622 Ga0495639_0008622_2324_3508 362
76 iso_pu_bacteria 2643221645 2644251729 362
77 iso_pu_bacteria 2643221664 2644356085 362
78 iso_pu_bacteria 2738541300 2738842341 362
79 iso_pu_bacteria 2738543018 2739273095 362
80 iso_pu_bacteria 2738543030 2739342139 362
81 3300046491 Ga0495584_0017479 Ga0495584_0017479_1966_3093 363
82 3300046506 Ga0495583_0001471 Ga0495583_0001471_5614_6741 363
83 3300046558 Ga0495633_0007942 Ga0495633_0007942_2933_4057 363
84 3300047321 Ga0495676_0027224 Ga0495676_0027224_2535_3662 363
85 3300047470 Ga0495681_0036901 Ga0495681_0036901_690_1817 363
86 3300048091 Ga0495626_0005810 Ga0495626_0005810_4035_5162 363
87 3300048906 Ga0496103_0001711 Ga0496103_0001711_5976_7157 363
88 3300049459 Ga0495678_009616 Ga0495678_009616_2169_3356 364
89 3300044658 Ga0466972_0000098 Ga0466972_0000098_48604_49749 365
90 3300044683 Ga0466965_0009250 Ga0466965_0009250_1657_2802 365
91 3300044735 Ga0466968_0000688 Ga0466968_0000688_9465_10613 365
92 3300046492 Ga0495585_0090694 Ga0495585_0090694_314_1441 365
93 3300046499 Ga0495594_0003144 Ga0495594_0003144_3840_4967 365
94 3300046525 Ga0495663_0002083 Ga0495663_0002083_2993_4120 365
95 3300046542 Ga0495597_0009791 Ga0495597_0009791_2444_3571 365
96 3300046557 Ga0495622_0016164 Ga0495622_0016164_1986_3113 365
97 3300046691 Ga0495670_0003908 Ga0495670_0003908_2096_3223 365
98 3300047318 Ga0495636_0001239 Ga0495636_0001239_2956_4083 365
99 3300047321 Ga0495676_0040236 Ga0495676_0040236_1729_2856 365
100 3300047470 Ga0495681_0040243 Ga0495681_0040243_157_1284 365
101 3300048929 Ga0496126_0043986 Ga0496126_0043986_1505_2779 365
102 3300049459 Ga0495678_000027 Ga0495678_000027_215337_216653 365
103 3300038443 Ga0395901_0255660 Ga0395901_0255660_160_1311 366
104 3300046507 Ga0495606_0004131 Ga0495606_0004131_7964_9214 366
105 3300046507 Ga0495606_0007799 Ga0495606_0007799_5342_6442 366
106 3300046530 Ga0495654_0008873 Ga0495654_0008873_3187_4287 366
107 3300046660 Ga0495625_0007078 Ga0495625_0007078_737_1837 366
108 3300046664 Ga0495659_0000345 Ga0495659_0000345_11441_12541 366
109 3300046665 Ga0495661_0118610 Ga0495661_0118610_215_1429 366
110 3300046692 Ga0495671_0001130 Ga0495671_0001130_5773_6873 366
111 3300046810 Ga0495660_0016882 Ga0495660_0016882_2314_3513 366
112 3300047320 Ga0495672_0000859 Ga0495672_0000859_25340_26440 366
113 iso_pu_bacteria 2738541280 2738742645 366
114 3300003771 Ga0055526_1000149 Ga0055526_100014913 367
115 3300025295 Ga0209564_1000010 Ga0209564_1000010777 367
116 3300046457 Ga0495590_0000201 Ga0495590_0000201_6595_7794 367
117 3300046616 Ga0495668_0000944 Ga0495668_0000944_6626_7825 367
118 iso_pu_bacteria 2643221556 2643801150 367
119 iso_pu_bacteria 2643221684 2644471858 367
120 iso_pu_bacteria 2808606418 2809146549 367
121 iso_pu_bacteria 8047673197 8047675455 367
122 3300046507 Ga0495606_0001842 Ga0495606_0001842_6592_7758 368
123 3300046507 Ga0495606_0003575 Ga0495606_0003575_11955_13088 368
124 3300046528 Ga0495642_0018748 Ga0495642_0018748_22_1143 368
125 3300046616 Ga0495668_0001593 Ga0495668_0001593_14540_15895 368
126 3300053145 Ga0500586_001058 Ga0500586_001058_2500_3855 368
127 iso_pu_bacteria 2928130867 2928134726 368
128 3300003773 Ga0055537_1000578 Ga0055537_10005786 369
129 3300003784 Ga0055534_1000489 Ga0055534_100048917 369
130 3300003790 Ga0055528_1000575 Ga0055528_10005756 369
131 3300025284 Ga0209130_1000016 Ga0209130_1000016341 369
132 3300046500 Ga0495596_0000350 Ga0495596_0000350_23277_24401 369
133 3300046501 Ga0495607_0017549 Ga0495607_0017549_2320_3444 369
134 3300046523 Ga0495644_0008429 Ga0495644_0008429_1649_2773 369
135 3300046558 Ga0495633_0007406 Ga0495633_0007406_4658_5782 369
136 3300046616 Ga0495668_0000188 Ga0495668_0000188_85775_86899 369
137 3300046691 Ga0495670_0030660 Ga0495670_0030660_1518_2642 369
138 3300047445 Ga0495677_0014443 Ga0495677_0014443_995_2119 369
139 3300047472 Ga0495686_0005894 Ga0495686_0005894_3150_4274 369
140 3300048090 Ga0495615_0010498 Ga0495615_0010498_405_1529 369
141 3300003322 rootL2_10064164 rootL2_100641644 370
142 3300005327 Ga0070658_10100179 Ga0070658_101001793 370
143 3300037418 Ga0395900_0004198 Ga0395900_0004198_8879_10006 370
144 3300038443 Ga0395901_0001364 Ga0395901_0001364_18945_20072 370
145 3300045049 Ga0466959_0041902 Ga0466959_0041902_1477_2604 370
146 3300045049 Ga0466959_0064496 Ga0466959_0064496_1356_2480 370
147 3300046457 Ga0495590_0053030 Ga0495590_0053030_268_1395 370
148 3300046460 Ga0495638_0004523 Ga0495638_0004523_3948_5075 370
149 3300046460 Ga0495638_0032923 Ga0495638_0032923_182_1309 370
150 3300046471 Ga0495650_0001553 Ga0495650_0001553_5677_6804 370
151 3300046474 Ga0495605_0000941 Ga0495605_0000941_13275_14402 370
152 3300046474 Ga0495605_0004232 Ga0495605_0004232_1871_2998 370
153 3300046474 Ga0495605_0011619 Ga0495605_0011619_1223_2350 370
154 3300046491 Ga0495584_0001867 Ga0495584_0001867_9242_10369 370
155 3300046491 Ga0495584_0003316 Ga0495584_0003316_2342_3469 370
156 3300046492 Ga0495585_0108877 Ga0495585_0108877_212_1339 370
157 3300046500 Ga0495596_0003693 Ga0495596_0003693_4488_5615 370
158 3300046500 Ga0495596_0043572 Ga0495596_0043572_449_1576 370
159 3300046501 Ga0495607_0005276 Ga0495607_0005276_2484_3611 370
160 3300046501 Ga0495607_0040080 Ga0495607_0040080_755_1882 370
161 3300046501 Ga0495607_0082638 Ga0495607_0082638_321_1448 370
162 3300046501 Ga0495607_0085669 Ga0495607_0085669_160_1287 370
163 3300046506 Ga0495583_0001555 Ga0495583_0001555_5358_6485 370
164 3300046512 Ga0495610_0042339 Ga0495610_0042339_1049_2176 370
165 3300046513 Ga0495616_0000547 Ga0495616_0000547_5434_6594 370
166 3300046513 Ga0495616_0039731 Ga0495616_0039731_760_1887 370
167 3300046519 Ga0495632_0001345 Ga0495632_0001345_5645_6772 370
168 3300046519 Ga0495632_0005648 Ga0495632_0005648_5348_6475 370
169 3300046520 Ga0495637_0014266 Ga0495637_0014266_1119_2264 370
170 3300046522 Ga0495643_0001198 Ga0495643_0001198_15815_16975 370
171 3300046522 Ga0495643_0004987 Ga0495643_0004987_2365_3492 370
172 3300046523 Ga0495644_0002361 Ga0495644_0002361_4723_5850 370
173 3300046523 Ga0495644_0013724 Ga0495644_0013724_270_1397 370
174 3300046524 Ga0495648_0003454 Ga0495648_0003454_7419_8546 370
175 3300046524 Ga0495648_0003840 Ga0495648_0003840_6132_7259 370
176 3300046524 Ga0495648_0013963 Ga0495648_0013963_2014_3141 370
177 3300046525 Ga0495663_0017087 Ga0495663_0017087_249_1439 370
178 3300046528 Ga0495642_0002398 Ga0495642_0002398_786_1928 370
179 3300046528 Ga0495642_0003881 Ga0495642_0003881_1041_2168 370
180 3300046538 Ga0495609_0001172 Ga0495609_0001172_11363_12490 370
181 3300046538 Ga0495609_0001862 Ga0495609_0001862_11038_12165 370
182 3300046538 Ga0495609_0006270 Ga0495609_0006270_2679_3806 370
183 3300046538 Ga0495609_0015240 Ga0495609_0015240_2359_3486 370
184 3300046542 Ga0495597_0020826 Ga0495597_0020826_1035_2162 370
185 3300046542 Ga0495597_0062954 Ga0495597_0062954_74_1219 370
186 3300046558 Ga0495633_0014720 Ga0495633_0014720_583_1725 370
187 3300046558 Ga0495633_0017117 Ga0495633_0017117_1461_2588 370
188 3300046615 Ga0495656_0010312 Ga0495656_0010312_636_1763 370
189 3300046648 Ga0495611_0033043 Ga0495611_0033043_954_2081 370
190 3300046660 Ga0495625_0007549 Ga0495625_0007549_3971_5098 370
191 3300046664 Ga0495659_0000524 Ga0495659_0000524_1198_2325 370
192 3300046665 Ga0495661_0001576 Ga0495661_0001576_2240_3367 370
193 3300046665 Ga0495661_0008346 Ga0495661_0008346_5698_6825 370
194 3300046665 Ga0495661_0143671 Ga0495661_0143671_122_1249 370
195 3300046674 Ga0495588_0000172 Ga0495588_0000172_75126_76253 370
196 3300046691 Ga0495670_0002602 Ga0495670_0002602_6128_7255 370
197 3300046691 Ga0495670_0027794 Ga0495670_0027794_10_1137 370
198 3300046694 Ga0495649_0023650 Ga0495649_0023650_984_2111 370
199 3300046794 Ga0495589_0001840 Ga0495589_0001840_5485_6612 370
200 3300046794 Ga0495589_0013151 Ga0495589_0013151_226_1353 370
201 3300046794 Ga0495589_0015806 Ga0495589_0015806_2305_3432 370
202 3300046810 Ga0495660_0001060 Ga0495660_0001060_5485_6612 370
203 3300046810 Ga0495660_0013326 Ga0495660_0013326_3570_4697 370
204 3300046810 Ga0495660_0075702 Ga0495660_0075702_343_1470 370
205 3300047318 Ga0495636_0000487 Ga0495636_0000487_1916_3043 370
206 3300047320 Ga0495672_0000653 Ga0495672_0000653_34120_35247 370
207 3300047320 Ga0495672_0001685 Ga0495672_0001685_5765_6892 370
208 3300047320 Ga0495672_0008878 Ga0495672_0008878_4472_5599 370
209 3300047320 Ga0495672_0020386 Ga0495672_0020386_1322_2449 370
210 3300047321 Ga0495676_0066536 Ga0495676_0066536_469_1596 370
211 3300047323 Ga0495683_0003705 Ga0495683_0003705_2377_3504 370
212 3300047443 Ga0495687_000405 Ga0495687_000405_5472_6599 370
213 3300047443 Ga0495687_000801 Ga0495687_000801_27320_28447 370
214 3300047443 Ga0495687_005076 Ga0495687_005076_2052_3179 370
215 3300047445 Ga0495677_0002298 Ga0495677_0002298_1700_2827 370
216 3300047445 Ga0495677_0002950 Ga0495677_0002950_1378_2505 370
217 3300047445 Ga0495677_0031148 Ga0495677_0031148_98_1225 370
218 3300047447 Ga0495685_000157 Ga0495685_000157_16624_17751 370
219 3300047469 Ga0495673_0009315 Ga0495673_0009315_44_1171 370
220 3300048091 Ga0495626_0001243 Ga0495626_0001243_8424_9569 370
221 3300048091 Ga0495626_0001440 Ga0495626_0001440_12374_13501 370
222 3300048903 Ga0496100_0045257 Ga0496100_0045257_166_1293 370
223 3300048904 Ga0496101_0030178 Ga0496101_0030178_1416_2543 370
224 3300048912 Ga0496109_0020358 Ga0496109_0020358_1267_2394 370
225 3300048916 Ga0496113_0020764 Ga0496113_0020764_3466_4593 370
226 3300048925 Ga0496122_0006856 Ga0496122_0006856_3003_4130 370
227 3300048925 Ga0496122_0011140 Ga0496122_0011140_2365_3492 370
228 3300048926 Ga0496123_0007415 Ga0496123_0007415_3686_4813 370
229 3300048926 Ga0496123_0009556 Ga0496123_0009556_2133_3260 370
230 3300048927 Ga0496124_0023414 Ga0496124_0023414_908_2053 370
231 3300048928 Ga0496125_0011120 Ga0496125_0011120_5557_6684 370
232 3300049459 Ga0495678_002154 Ga0495678_002154_7421_8548 370
233 3300049460 Ga0495682_0001880 Ga0495682_0001880_3971_5098 370
234 3300049460 Ga0495682_0002150 Ga0495682_0002150_8210_9337 370
235 3300049460 Ga0495682_0003248 Ga0495682_0003248_5387_6514 370
236 3300049572 Ga0501036_0108013 Ga0501036_0108013_109_1236 370
237 3300046506 Ga0495583_0000329 Ga0495583_0000329_5685_6836 371
238 3300046507 Ga0495606_0001517 Ga0495606_0001517_24200_25387 371
239 3300046520 Ga0495637_0010764 Ga0495637_0010764_3143_4318 371
240 3300046542 Ga0495597_0069316 Ga0495597_0069316_121_1251 371
241 3300048090 Ga0495615_0001342 Ga0495615_0001342_719_1849 371
242 3300046452 Ga0495617_004040 Ga0495617_004040_2083_3258 372
243 3300046471 Ga0495650_0008575 Ga0495650_0008575_144_1280 372
244 3300046507 Ga0495606_0002312 Ga0495606_0002312_17152_18354 372
245 3300046512 Ga0495610_0013844 Ga0495610_0013844_182_1384 372
246 3300047318 Ga0495636_0041612 Ga0495636_0041612_550_1725 372
247 3300049459 Ga0495678_001837 Ga0495678_001837_12290_13426 372
248 3300003775 Ga0055524_1000124 Ga0055524_10001246 373
249 3300006948 Ga0099826_10002381 Ga0099826_100023817 373
250 3300025263 Ga0209565_1002451 Ga0209565_10024512 373
251 3300025299 Ga0209256_1000268 Ga0209256_100026877 373
252 3300027666 Ga0209282_1000066 Ga0209282_10000667 373
253 3300046528 Ga0495642_0009654 Ga0495642_0009654_1185_2342 373
254 3300046557 Ga0495622_0000440 Ga0495622_0000440_5472_6782 373
255 3300049671 Ga0501238_000556 Ga0501238_000556_859_2004 373
256 iso_pu_bacteria 2738541297 2738826027 373
257 iso_pu_bacteria 2738541357 2739149824 373
258 iso_pu_bacteria 2738543003 2739191743 373
259 iso_pu_bacteria 2738543026 2739318220 373
260 iso_pu_bacteria 2738543029 2739336461 373
261 iso_pu_bacteria 2821131069 2821136362 373
262 3300046557 Ga0495622_0003120 Ga0495622_0003120_1204_2385 374
263 3300046660 Ga0495625_0114063 Ga0495625_0114063_136_1347 374
264 3300046810 Ga0495660_0012516 Ga0495660_0012516_261_1469 374
265 3300025263 Ga0209565_1004807 Ga0209565_10048074 375
266 3300030731 Ga0316177_1060566 Ga0316177_10605663 375
267 3300046616 Ga0495668_0006127 Ga0495668_0006127_5362_6558 375
268 3300047469 Ga0495673_0000012 Ga0495673_0000012_650065_651333 375
269 3300046471 Ga0495650_0003055 Ga0495650_0003055_5415_6599 376
270 3300046471 Ga0495650_0003201 Ga0495650_0003201_5552_6907 376
271 3300046474 Ga0495605_0000635 Ga0495605_0000635_20347_21576 376
272 3300046492 Ga0495585_0002611 Ga0495585_0002611_11232_12587 376
273 3300046501 Ga0495607_0024396 Ga0495607_0024396_1368_2609 376
274 3300046520 Ga0495637_0000454 Ga0495637_0000454_23195_24475 376
275 3300046530 Ga0495654_0000245 Ga0495654_0000245_5370_6650 376
276 3300046530 Ga0495654_0005009 Ga0495654_0005009_3041_4396 376
277 3300046558 Ga0495633_0012358 Ga0495633_0012358_2072_3313 376
278 3300046660 Ga0495625_0002229 Ga0495625_0002229_5505_6689 376
279 3300046692 Ga0495671_0069378 Ga0495671_0069378_81_1436 376
280 3300046810 Ga0495660_0021945 Ga0495660_0021945_2189_3544 376
281 3300047323 Ga0495683_0015513 Ga0495683_0015513_1606_2961 376
282 3300047469 Ga0495673_0000925 Ga0495673_0000925_5439_6794 376
283 iso_pu_bacteria 2857558681 2857563432 376
284 iso_pu_bacteria 2857547612 2857552876 377
285 iso_pu_bacteria 2919476304 2919476310 377
286 iso_pu_bacteria 2932410948 2932415548 377
287 iso_pu_bacteria 2932416698 2932421538 377
288 3300046558 Ga0495633_0001228 Ga0495633_0001228_5665_6837 378
289 3300046810 Ga0495660_0019280 Ga0495660_0019280_1484_2752 378
290 3300003374 JGI25161J50226_1001616 JGI25161J50226_10016161 379
291 3300004625 Ga0055543_1002129 Ga0055543_10021296 379
292 3300005262 Ga0065165_1005706 Ga0065165_10057062 379
293 3300025208 Ga0209436_101730 Ga0209436_1017307 379
294 3300025284 Ga0209130_1003164 Ga0209130_10031647 379
295 3300031548 Ga0307408_100006441 Ga0307408_1000064417 379
296 3300046512 Ga0495610_0003364 Ga0495610_0003364_1252_2457 379
297 3300046522 Ga0495643_0000891 Ga0495643_0000891_20513_21718 379
298 3300046558 Ga0495633_0001987 Ga0495633_0001987_5520_6695 379
299 3300046694 Ga0495649_0001795 Ga0495649_0001795_3780_4985 379
300 3300047320 Ga0495672_0001040 Ga0495672_0001040_17047_18252 379
301 3300049459 Ga0495678_001082 Ga0495678_001082_11743_12948 379
302 3300049679 Ga0501249_002201 Ga0501249_002201_1254_2444 379
303 3300049766 Ga0501269_000385 Ga0501269_000385_3878_5068 379
304 3300053136 Ga0500559_0100055 Ga0500559_0100055_75_1250 379
305 3300053145 Ga0500586_000619 Ga0500586_000619_5475_6650 379
306 3300002773 JGI25152J39213_1000654 JGI25152J39213_10006546 380
307 3300002774 JGI25150J39212_1002095 JGI25150J39212_10020954 380
308 3300003215 JGI25153J46596_10008256 JGI25153J46596_100082564 380
309 3300003775 Ga0055524_1001352 Ga0055524_10013524 380
310 3300003794 Ga0055531_10006260 Ga0055531_100062606 380
311 3300025208 Ga0209436_100806 Ga0209436_10080610 380
312 3300025245 Ga0207425_1000493 Ga0207425_100049320 380
313 3300025245 Ga0207425_1000761 Ga0207425_10007617 380
314 3300025258 Ga0209129_1000600 Ga0209129_100060020 380
315 3300025273 Ga0209673_1007381 Ga0209673_10073815 380
316 3300025284 Ga0209130_1002714 Ga0209130_10027144 380
317 3300025297 Ga0209758_1001720 Ga0209758_100172020 380
318 3300025298 Ga0209050_1000086 Ga0209050_1000086227 380
319 3300025299 Ga0209256_1002073 Ga0209256_100207314 380
320 3300025304 Ga0209257_1006299 Ga0209257_10062993 380
321 3300025728 Ga0207655_1004989 Ga0207655_10049896 380
322 3300047320 Ga0495672_0000019 Ga0495672_0000019_436819_438015 380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04892

VanZ

VanZ like family

87

208

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uc3-assembly1.cif.gz_B translocator protein 18 kda (tspo) from rhodobacter sphaeroides wild type 0.325 220 363
2vzb-assembly1.cif.gz_A a dodecameric thioferritin in the bacterial domain, characterization of the bacterioferritin-related protein from bacteroides fragilis 0.3194 204 380
4uc3-assembly1.cif.gz_B translocator protein 18 kda (tspo) from rhodobacter sphaeroides wild type 0.3144 220 363
2vzb-assembly1.cif.gz_A a dodecameric thioferritin in the bacterial domain, characterization of the bacterioferritin-related protein from bacteroides fragilis 0.3124 204 380
7tai-assembly1.cif.gz_A structure of steap2 in complex with ligands 0.2689 186 377
ID Description Score Start End Superfamily
af_O13689_1_162_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.6479 14 152 1.20.1270.60
af_A0A1D8PF60_1_177_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5714 14 166 1.20.1270.60
af_I1JZ21_16_139_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5209 13 151 1.10.10.1740
af_I1JZ21_16_139_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5016 13 151 1.10.10.1740
af_O13689_1_162_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.492 14 152 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A498F991-F1-model_v4 deleted 0.9791 8 134
AF-A0A6L3MJ90-F1-model_v4 Teicoplanin resistance protein VanZ 0.9629 8 137 GO:0016020
AF-A0A3D3PMS6-F1-model_v4 Uncharacterized protein 0.9488 215 367 GO:0016020
AF-A0A6M3ZZV4-F1-model_v4 VanZ-like domain-containing protein 0.9415 16 368 GO:0016020
AF-A0A7W2IIX0-F1-model_v4 VanZ family protein 0.9412 8 368 GO:0016020

Feature Viewer

pLDDT pTM Quality
81.15 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map