F406655

General Info

Members Datasets Scaffolds Average Seq Length
322 160 322 233

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0297784|Ga0501070_0297784_277_1071
Length 264
Sequence MPRDLPAVSAERKNPDAPAVRPPPTADGSPEADSTSEPASHPDRRIRSFVLRQGRTTPAQQRAFDDHWARYGLEFAGAPRDFANVFGRTAPLVVEIGFGNGEQLLHAAMSEPGRDFIGIEVHRPGVGRLLNALADADVANARVYRHDAVEVLECEIAPAALDEVRIYFPDPWPKKRHHKRRLIQPDFVALLASRIAHGGRLHLATDWADYAEHMRNVLDNAAGWRLEAHDAAAADRPGRRIDTHFERRGLKLGHGVRDLIYERT

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
104 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
155 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 1.86
Rhizosphere 91.3
Stem 0
Stem Tuber 0
Unclassified 4.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100098070 3300005331 Bacteria 2521
2 Ga0070666_10069325 3300005335 Bacteria 2397
3 Ga0068868_100096668 3300005338 Bacteria 2386
4 Ga0068868_100235910 3300005338 Bacteria 1536
5 Ga0070689_100212758 3300005340 Bacteria 1583
6 Ga0070661_100292010 3300005344 Bacteria 1267
7 Ga0070668_100005066 3300005347 Bacteria 9753
8 Ga0070668_100203601 3300005347 Bacteria 1625
9 Ga0070669_100026834 3300005353 Bacteria 4145
10 Ga0070675_100178141 3300005354 Bacteria 1837
11 Ga0070673_100162004 3300005364 Bacteria 1903
12 Ga0070673_100236208 3300005364 Bacteria 1587
13 Ga0070688_100070795 3300005365 Bacteria 2231
14 Ga0070667_100104349 3300005367 Bacteria 2452
15 Ga0070667_100383706 3300005367 Bacteria 1276
16 Ga0070667_100478592 3300005367 Bacteria 1140
17 Ga0070710_10328762 3300005437 Bacteria 1006
18 Ga0070705_100309721 3300005440 Bacteria 1135
19 Ga0070663_100045735 3300005455 Bacteria 3093
20 Ga0070678_100316746 3300005456 Bacteria 1331
21 Ga0070662_100234737 3300005457 Bacteria 1469
22 Ga0070662_100443291 3300005457 Bacteria 1077
23 Ga0068867_100034533 3300005459 Bacteria 3665
24 Ga0068867_100191657 3300005459 Bacteria 1631
25 Ga0068853_100000503 3300005539 Bacteria 26688
26 Ga0068853_100016375 3300005539 Bacteria 6101
27 Ga0068853_100018944 3300005539 Bacteria 5700
28 Ga0068853_100038413 3300005539 Bacteria 4077
29 Ga0068853_100092602 3300005539 Bacteria 2659
30 Ga0068853_100211599 3300005539 Bacteria 1767
31 Ga0068853_100288857 3300005539 Bacteria 1513
32 Ga0068853_100332679 3300005539 Bacteria 1410
33 Ga0068853_100621794 3300005539 Bacteria 1027
34 Ga0070672_100210395 3300005543 Bacteria 1629
35 Ga0070686_100049766 3300005544 Bacteria 2661
36 Ga0070693_100231167 3300005547 Bacteria 1217
37 Ga0070665_100000100 3300005548 Bacteria 160186
38 Ga0070665_100066102 3300005548 Bacteria 3627
39 Ga0070665_100097125 3300005548 Bacteria 2951
40 Ga0070665_100177251 3300005548 Bacteria 2132
41 Ga0070665_100190869 3300005548 Bacteria 2049
42 Ga0068855_100012768 3300005563 Bacteria 10130
43 Ga0068855_100136394 3300005563 Bacteria 2799
44 Ga0068855_100253025 3300005563 Bacteria 1964
45 Ga0070664_100673291 3300005564 Bacteria 962
46 Ga0068857_100087769 3300005577 Bacteria 2782
47 Ga0068857_100150814 3300005577 Bacteria 2106
48 Ga0068854_100193281 3300005578 Bacteria 1596
49 Ga0068854_100572730 3300005578 Bacteria 961
50 Ga0068852_100073312 3300005616 Bacteria 3011
51 Ga0068864_100188087 3300005618 Bacteria 1891
52 Ga0068851_10077985 3300005834 Bacteria 1725
53 Ga0068863_100181274 3300005841 Bacteria 2021
54 Ga0068863_100212415 3300005841 Bacteria 1863
55 Ga0068858_100185580 3300005842 Bacteria 1964
56 Ga0068858_100496562 3300005842 Bacteria 1179
57 Ga0068860_100419075 3300005843 Bacteria 1327
58 Ga0068862_100003393 3300005844 Bacteria 13736
59 Ga0081540_1001867 3300005983 Bacteria 17644
60 Ga0070717_10045744 3300006028 Bacteria 3579
61 Ga0097621_100019448 3300006237 Bacteria 5212
62 Ga0097621_100041426 3300006237 Bacteria 3707
63 Ga0097621_100097312 3300006237 Bacteria 2471
64 Ga0097621_100179808 3300006237 Bacteria 1827
65 Ga0097621_100386122 3300006237 Bacteria 1251
66 Ga0097621_100582003 3300006237 Bacteria 1021
67 Ga0068871_100021532 3300006358 Bacteria 4957
68 Ga0068871_100111239 3300006358 Bacteria 2304
69 Ga0068871_100359952 3300006358 Bacteria 1289
70 Ga0068871_100386873 3300006358 Bacteria 1243
71 Ga0068871_100507617 3300006358 Bacteria 1088
72 Ga0068871_100611790 3300006358 Bacteria 992
73 Ga0068865_100001608 3300006881 Bacteria 13231
74 Ga0068865_100024024 3300006881 Bacteria 3995
75 Ga0068865_100164922 3300006881 Bacteria 1693
76 Ga0105240_10353840 3300009093 Bacteria 1665
77 Ga0105245_10620435 3300009098 Bacteria 1109
78 Ga0105247_10065186 3300009101 Bacteria 2265
79 Ga0105242_10006082 3300009176 Bacteria 9307
80 Ga0105242_10252224 3300009176 Bacteria 1590
81 Ga0105248_10000231 3300009177 Bacteria 64041
82 Ga0105248_10061435 3300009177 Bacteria 4219
83 Ga0105248_10264538 3300009177 Bacteria 1936
84 Ga0105237_10001039 3300009545 Bacteria 37324
85 Ga0105237_10224167 3300009545 Bacteria 1880
86 Ga0105237_10370731 3300009545 Bacteria 1436
87 Ga0105237_10439484 3300009545 Bacteria 1310
88 Ga0105238_10002060 3300009551 Bacteria 20286
89 Ga0105249_10024262 3300009553 Bacteria 5450
90 Ga0105249_10258762 3300009553 Bacteria 1728
91 Ga0105239_10027756 3300010375 Bacteria 6229
92 Ga0105239_10044570 3300010375 Bacteria 4862
93 Ga0105239_10189691 3300010375 Bacteria 2301
94 Ga0105239_10490385 3300010375 Bacteria 1396
95 Ga0157373_10565352 3300013100 Bacteria 826
96 Ga0157370_10184289 3300013104 Bacteria 1939
97 Ga0157369_10000318 3300013105 Bacteria 64959
98 Ga0157374_10339429 3300013296 Bacteria 1491
99 Ga0157378_10093713 3300013297 Bacteria 2734
100 Ga0163162_10007714 3300013306 Bacteria 10484
101 Ga0163162_10555933 3300013306 Bacteria 1276
102 Ga0157372_10016942 3300013307 Bacteria 7823
103 Ga0157372_10446239 3300013307 Bacteria 1508
104 Ga0157372_10769156 3300013307 Bacteria 1119
105 Ga0157375_10002588 3300013308 Bacteria 15711
106 Ga0157375_10127533 3300013308 Bacteria 2661
107 Ga0157375_11613212 3300013308 Bacteria 767
108 Ga0157379_10111113 3300014968 Bacteria 2462
109 Ga0157379_10121875 3300014968 Bacteria 2346
110 Ga0157379_10689850 3300014968 Bacteria 958
111 Ga0157376_10031867 3300014969 Bacteria 4227
112 Ga0157376_10076721 3300014969 Bacteria 2856
113 Ga0157376_10192792 3300014969 Bacteria 1870
114 Ga0157376_10416888 3300014969 Bacteria 1302
115 Ga0213876_10181618 3300021384 Bacteria 1119
116 Ga0213876_10265303 3300021384 Bacteria 913
117 Ga0209233_1003991 3300025261 Bacteria 5112
118 Ga0209051_1008714 3300025303 Bacteria 5336
119 Ga0207656_10064747 3300025321 Bacteria 1612
120 Ga0207680_10046702 3300025903 Bacteria 2561
121 Ga0207680_10286906 3300025903 Bacteria 1145
122 Ga0207645_10018212 3300025907 Bacteria 4626
123 Ga0207654_10221807 3300025911 Bacteria 1255
124 Ga0207695_10632209 3300025913 Bacteria 952
125 Ga0207671_10025410 3300025914 Bacteria 4449
126 Ga0207671_10060741 3300025914 Bacteria 2804
127 Ga0207671_10227117 3300025914 Bacteria 1464
128 Ga0207663_10351214 3300025916 Bacteria 1116
129 Ga0207649_10568599 3300025920 Bacteria 869
130 Ga0207681_10004582 3300025923 Bacteria 8500
131 Ga0207694_10002841 3300025924 Bacteria 13972
132 Ga0207650_10210393 3300025925 Bacteria 1562
133 Ga0207659_10146950 3300025926 Bacteria 1837
134 Ga0207706_10318387 3300025933 Bacteria 1354
135 Ga0207706_10406197 3300025933 Bacteria 1180
136 Ga0207706_10546617 3300025933 Bacteria 997
137 Ga0207686_10333395 3300025934 Bacteria 1137
138 Ga0207670_10062710 3300025936 Bacteria 2541
139 Ga0207704_10006764 3300025938 Bacteria 5372
140 Ga0207704_10043584 3300025938 Bacteria 2651
141 Ga0207704_10103686 3300025938 Bacteria 1903
142 Ga0207691_10102696 3300025940 Bacteria 2550
143 Ga0207691_10253821 3300025940 Bacteria 1517
144 Ga0207711_10000539 3300025941 Bacteria 38710
145 Ga0207711_10260898 3300025941 Bacteria 1592
146 Ga0207689_10221876 3300025942 Bacteria 1562
147 Ga0207667_10015626 3300025949 Bacteria 8611
148 Ga0207667_10035987 3300025949 Bacteria 5309
149 Ga0207667_10587214 3300025949 Bacteria 1124
150 Ga0207651_10238834 3300025960 Bacteria 1480
151 Ga0207712_10000649 3300025961 Bacteria 27151
152 Ga0207712_10095637 3300025961 Bacteria 2197
153 Ga0207712_10106038 3300025961 Bacteria 2098
154 Ga0207668_10060012 3300025972 Bacteria 2668
155 Ga0207668_10388722 3300025972 Bacteria 1176
156 Ga0207640_10193516 3300025981 Bacteria 1535
157 Ga0207640_10263521 3300025981 Bacteria 1344
158 Ga0207658_10000033 3300025986 Bacteria 158540
159 Ga0207658_10024920 3300025986 Bacteria 4186
160 Ga0207658_10246158 3300025986 Bacteria 1517
161 Ga0207677_10035189 3300026023 Bacteria 3250
162 Ga0207677_10056240 3300026023 Bacteria 2694
163 Ga0207677_10076253 3300026023 Bacteria 2386
164 Ga0207703_10230046 3300026035 Bacteria 1662
165 Ga0207639_10001434 3300026041 Bacteria 16078
166 Ga0207639_10008013 3300026041 Bacteria 7218
167 Ga0207639_10293503 3300026041 Bacteria 1434
168 Ga0207678_10000140 3300026067 Bacteria 59288
169 Ga0207678_10007343 3300026067 Bacteria 9761
170 Ga0207678_10332421 3300026067 Bacteria 1308
171 Ga0207678_10393060 3300026067 Bacteria 1200
172 Ga0207641_10069357 3300026088 Bacteria 3026
173 Ga0207641_10207147 3300026088 Bacteria 1811
174 Ga0207648_10006166 3300026089 Bacteria 11947
175 Ga0207648_10230947 3300026089 Bacteria 1646
176 Ga0207676_10264204 3300026095 Bacteria 1555
177 Ga0207674_10055775 3300026116 Bacteria 4016
178 Ga0207674_10087027 3300026116 Bacteria 3118
179 Ga0207674_10185671 3300026116 Bacteria 2030
180 Ga0207683_10256605 3300026121 Bacteria 1596
181 Ga0207698_10257623 3300026142 Bacteria 1601
182 Ga0207698_10539349 3300026142 Bacteria 1141
183 Ga0268266_10000017 3300028379 Bacteria 607272
184 Ga0268266_10097706 3300028379 Bacteria 2583
185 Ga0268266_10113067 3300028379 Bacteria 2407
186 Ga0268266_10347875 3300028379 Bacteria 1392
187 Ga0268266_10509144 3300028379 Bacteria 1150
188 Ga0268265_10002513 3300028380 Bacteria 13735
189 Ga0268264_10576660 3300028381 Bacteria 1106
190 Ga0265334_10000261 3300028573 Bacteria 29770
191 Ga0307509_10337383 3300031507 Bacteria 1236
192 Ga0373937_0041404 3300036401 Bacteria 4201
193 Ga0436365_0276746 3300039437 Bacteria 1805
194 Ga0436365_1876107 3300039437 Bacteria 1294
195 Ga0451802_0282031 3300041460 Bacteria 2719
196 Ga0451804_1017626 3300041463 Bacteria 1209
197 Ga0451853_0668608 3300041512 Bacteria 2666
198 Ga0451853_1542807 3300041512 Bacteria 1070
199 Ga0466972_0000761 3300044658 Bacteria 15355
200 Ga0466970_0000395 3300044765 Bacteria 21174
201 Ga0466959_0014794 3300045049 Bacteria 5679
202 Ga0466967_0047410 3300045976 Bacteria 3746
203 Ga0495641_0185788 3300046461 Bacteria 931
204 Ga0495640_0449028 3300046533 Bacteria 788
205 Ga0495649_0208095 3300046694 Bacteria 1014
206 Ga0495674_0527921 3300047319 Bacteria 942
207 Ga0496104_0000023 3300048907 Bacteria 236818
208 Ga0496105_0000019 3300048908 Bacteria 185293
209 Ga0496114_0117595 3300048917 Bacteria 2283
210 Ga0496115_0269851 3300048918 Bacteria 1398
211 Ga0496117_0098225 3300048920 Bacteria 1862
212 Ga0496118_0000081 3300048921 Bacteria 188525
213 Ga0496118_0005866 3300048921 Bacteria 13763
214 Ga0496121_0042229 3300048924 Bacteria 3971
215 Ga0496122_0000362 3300048925 Bacteria 97690
216 Ga0496123_0000317 3300048926 Bacteria 92079
217 Ga0496125_0184775 3300048928 Bacteria 1384
218 Ga0496126_0019434 3300048929 Bacteria 6690
219 Ga0501031_0034083 3300049568 Bacteria 3322
220 Ga0501031_0290737 3300049568 Bacteria 1059
221 Ga0501032_0007788 3300049569 Bacteria 7811
222 Ga0501032_0022398 3300049569 Bacteria 4379
223 Ga0501032_0079484 3300049569 Bacteria 2183
224 Ga0501033_0001488 3300049570 Bacteria 20749
225 Ga0501033_0020962 3300049570 Bacteria 4935
226 Ga0501034_0003799 3300049571 Bacteria 17035
227 Ga0501034_0010499 3300049571 Bacteria 9643
228 Ga0501034_0023971 3300049571 Bacteria 6210
229 Ga0501034_0025887 3300049571 Bacteria 5974
230 Ga0501036_0001031 3300049572 Bacteria 21035
231 Ga0501036_0028506 3300049572 Bacteria 4718
232 Ga0501036_0087286 3300049572 Bacteria 2637
233 Ga0501036_0582194 3300049572 Bacteria 929
234 Ga0501037_0008521 3300049573 Bacteria 7521
235 Ga0501037_0050303 3300049573 Bacteria 3050
236 Ga0501037_0070989 3300049573 Bacteria 2533
237 Ga0501038_0001893 3300049574 Bacteria 19359
238 Ga0501038_0006230 3300049574 Bacteria 11030
239 Ga0501038_0008739 3300049574 Bacteria 9293
240 Ga0501038_0210337 3300049574 Bacteria 1556
241 Ga0501039_0035282 3300049575 Bacteria 3859
242 Ga0501039_0053378 3300049575 Bacteria 3127
243 Ga0501039_0059962 3300049575 Bacteria 2947
244 Ga0501040_0015657 3300049576 Bacteria 5014
245 Ga0501042_0103306 3300049578 Bacteria 2050
246 Ga0501043_0022877 3300049579 Bacteria 4900
247 Ga0501043_0024829 3300049579 Bacteria 4702
248 Ga0501043_0112653 3300049579 Bacteria 2136
249 Ga0501043_0374800 3300049579 Bacteria 1078
250 Ga0501046_0005403 3300049580 Bacteria 11422
251 Ga0501046_0015085 3300049580 Bacteria 6497
252 Ga0501046_0015614 3300049580 Bacteria 6376
253 Ga0501046_0018216 3300049580 Bacteria 5848
254 Ga0501046_0180621 3300049580 Bacteria 1578
255 Ga0501046_0261645 3300049580 Bacteria 1271
256 Ga0501047_0000904 3300049581 Bacteria 30280
257 Ga0501047_0004470 3300049581 Bacteria 13159
258 Ga0501047_0036905 3300049581 Bacteria 4723
259 Ga0501047_0074571 3300049581 Bacteria 3266
260 Ga0501047_0103817 3300049581 Bacteria 2723
261 Ga0501047_0113311 3300049581 Bacteria 2594
262 Ga0501047_0213150 3300049581 Bacteria 1789
263 Ga0501067_0000426 3300049583 Bacteria 22971
264 Ga0501067_0064403 3300049583 Bacteria 2029
265 Ga0501068_0029374 3300049584 Bacteria 3254
266 Ga0501068_0065274 3300049584 Bacteria 2215
267 Ga0501068_0075842 3300049584 Bacteria 2057
268 Ga0501068_0227633 3300049584 Bacteria 1185
269 Ga0501069_0070019 3300049585 Bacteria 1964
270 Ga0501069_0208726 3300049585 Bacteria 1133
271 Ga0501070_0003914 3300049586 Bacteria 12847
272 Ga0501070_0092284 3300049586 Bacteria 2506
273 Ga0501070_0129752 3300049586 Bacteria 2082
274 Ga0501070_0297784 3300049586 Bacteria 1314
275 Ga0501071_0016556 3300049587 Bacteria 5072
276 Ga0501072_0001604 3300049588 Bacteria 16909
277 Ga0501072_0018078 3300049588 Bacteria 5421
278 Ga0501073_0000757 3300049589 Bacteria 22907
279 Ga0501073_0012304 3300049589 Bacteria 6243
280 Ga0501073_0043825 3300049589 Bacteria 3154
281 Ga0501073_0072681 3300049589 Bacteria 2395
282 Ga0501073_0111496 3300049589 Bacteria 1897
283 Ga0501073_0156595 3300049589 Bacteria 1578
284 Ga0501073_0164365 3300049589 Bacteria 1537
285 Ga0501074_0008447 3300049590 Bacteria 7464
286 Ga0501076_0119177 3300049592 Bacteria 2137
287 Ga0501079_0043243 3300049741 Bacteria 3477
288 Ga0501079_0094358 3300049741 Bacteria 2318
289 Ga0501079_0281183 3300049741 Bacteria 1301
290 Ga0501079_0436187 3300049741 Bacteria 1028
291 Ga0501080_0000997 3300049742 Bacteria 23230
292 Ga0501080_0038235 3300049742 Bacteria 4481
293 Ga0501080_0040437 3300049742 Bacteria 4349
294 Ga0501080_0102099 3300049742 Bacteria 2661
295 Ga0501081_0056165 3300049743 Bacteria 2720
296 Ga0501083_0001097 3300049744 Bacteria 18095
297 Ga0501083_0029251 3300049744 Bacteria 3791
298 Ga0501035_0005934 3300049822 Bacteria 11496
299 Ga0501035_0031301 3300049822 Bacteria 4845
300 Ga0501035_0040327 3300049822 Bacteria 4220
301 Ga0501035_0060013 3300049822 Bacteria 3386
302 Ga0501035_0455144 3300049822 Bacteria 1058
303 Ga0501044_0014392 3300049823 Bacteria 8543
304 Ga0501044_0021034 3300049823 Bacteria 6965
305 Ga0501044_0046973 3300049823 Bacteria 4468
306 Ga0501044_0055626 3300049823 Bacteria 4063
307 Ga0501044_0067673 3300049823 Bacteria 3638
308 Ga0501044_0400802 3300049823 Bacteria 1284
309 Ga0501044_0891882 3300049823 Bacteria 764
310 Ga0501045_0014786 3300049824 Bacteria 5533
311 Ga0500610_0099479 3300053079 Bacteria 1505
312 Ga0500635_0052853 3300053080 Bacteria 1396
313 Ga0500651_0006155 3300053093 Bacteria 6892
314 Ga0500651_0054249 3300053093 Bacteria 2513
315 Ga0500568_0020752 3300053139 Bacteria 2837
316 Ga0501084_0137857 3300054114 Bacteria 2054
317 Ga0501084_0145607 3300054114 Bacteria 1995
318 Ga0501082_0001180 3300060353 Bacteria 22960
319 Ga0501082_0005091 3300060353 Bacteria 11453
320 Ga0501082_0009960 3300060353 Bacteria 8196
321 Ga0501082_0610259 3300060353 Bacteria 955
322 Ga0530510_0752891 3300061734 Bacteria 743

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053093 Ga0500651_0054249 Ga0500651_0054249_1139_1936 191
2 3300048921 Ga0496118_0000081 Ga0496118_0000081_95445_96155 207
3 3300005335 Ga0070666_10069325 Ga0070666_100693252 209
4 3300005353 Ga0070669_100026834 Ga0070669_1000268343 209
5 3300005548 Ga0070665_100066102 Ga0070665_1000661022 209
6 3300025903 Ga0207680_10046702 Ga0207680_100467022 209
7 3300025923 Ga0207681_10004582 Ga0207681_100045826 209
8 3300028379 Ga0268266_10113067 Ga0268266_101130672 209
9 3300013307 Ga0157372_10446239 Ga0157372_104462392 210
10 3300045049 Ga0466959_0014794 Ga0466959_0014794_2124_2828 211
11 3300048920 Ga0496117_0098225 Ga0496117_0098225_876_1577 212
12 3300048921 Ga0496118_0005866 Ga0496118_0005866_1557_2258 212
13 3300005347 Ga0070668_100203601 Ga0070668_1002036012 213
14 3300025972 Ga0207668_10060012 Ga0207668_100600122 213
15 3300005338 Ga0068868_100096668 Ga0068868_1000966682 214
16 3300005539 Ga0068853_100621794 Ga0068853_1006217941 214
17 3300009176 Ga0105242_10006082 Ga0105242_100060822 214
18 3300013306 Ga0163162_10007714 Ga0163162_1000771411 214
19 3300013308 Ga0157375_10002588 Ga0157375_1000258812 214
20 3300014969 Ga0157376_10076721 Ga0157376_100767212 214
21 3300026023 Ga0207677_10076253 Ga0207677_100762533 214
22 3300036401 Ga0373937_0041404 Ga0373937_0041404_1381_2025 214
23 3300048907 Ga0496104_0000023 Ga0496104_0000023_118358_119002 214
24 3300048908 Ga0496105_0000019 Ga0496105_0000019_118357_119001 214
25 3300005367 Ga0070667_100478592 Ga0070667_1004785922 215
26 3300005440 Ga0070705_100309721 Ga0070705_1003097211 215
27 3300005459 Ga0068867_100191657 Ga0068867_1001916572 215
28 3300005539 Ga0068853_100016375 Ga0068853_1000163757 215
29 3300005548 Ga0070665_100190869 Ga0070665_1001908692 215
30 3300005564 Ga0070664_100673291 Ga0070664_1006732912 215
31 3300005842 Ga0068858_100496562 Ga0068858_1004965622 215
32 3300014969 Ga0157376_10416888 Ga0157376_104168882 215
33 3300025907 Ga0207645_10018212 Ga0207645_100182125 215
34 3300025940 Ga0207691_10253821 Ga0207691_102538212 215
35 3300025942 Ga0207689_10221876 Ga0207689_102218762 215
36 3300025960 Ga0207651_10238834 Ga0207651_102388342 215
37 3300025972 Ga0207668_10388722 Ga0207668_103887222 215
38 3300026089 Ga0207648_10230947 Ga0207648_102309472 215
39 3300028379 Ga0268266_10097706 Ga0268266_100977062 215
40 3300046461 Ga0495641_0185788 Ga0495641_0185788_201_899 218
41 3300046533 Ga0495640_0449028 Ga0495640_0449028_11_709 218
42 3300053080 Ga0500635_0052853 Ga0500635_0052853_64_762 218
43 3300044658 Ga0466972_0000761 Ga0466972_0000761_13153_13857 219
44 3300044765 Ga0466970_0000395 Ga0466970_0000395_13867_14571 219
45 3300026067 Ga0207678_10393060 Ga0207678_103930601 220
46 3300005437 Ga0070710_10328762 Ga0070710_103287622 221
47 3300005539 Ga0068853_100288857 Ga0068853_1002888572 221
48 3300006237 Ga0097621_100582003 Ga0097621_1005820031 221
49 3300006358 Ga0068871_100359952 Ga0068871_1003599522 221
50 3300006358 Ga0068871_100611790 Ga0068871_1006117902 221
51 3300009545 Ga0105237_10224167 Ga0105237_102241673 221
52 3300009545 Ga0105237_10439484 Ga0105237_104394841 221
53 3300009551 Ga0105238_10002060 Ga0105238_1000206015 221
54 3300009553 Ga0105249_10024262 Ga0105249_100242626 221
55 3300010375 Ga0105239_10490385 Ga0105239_104903852 221
56 3300013100 Ga0157373_10565352 Ga0157373_105653521 221
57 3300013105 Ga0157369_10000318 Ga0157369_1000031813 221
58 3300025911 Ga0207654_10221807 Ga0207654_102218072 221
59 3300025913 Ga0207695_10632209 Ga0207695_106322091 221
60 3300025914 Ga0207671_10025410 Ga0207671_100254101 221
61 3300025916 Ga0207663_10351214 Ga0207663_103512141 221
62 3300025920 Ga0207649_10568599 Ga0207649_105685992 221
63 3300025924 Ga0207694_10002841 Ga0207694_100028411 221
64 3300025961 Ga0207712_10106038 Ga0207712_101060382 221
65 3300026067 Ga0207678_10332421 Ga0207678_103324211 221
66 3300048917 Ga0496114_0117595 Ga0496114_0117595_1015_1722 221
67 3300049574 Ga0501038_0210337 Ga0501038_0210337_224_997 221
68 3300005344 Ga0070661_100292010 Ga0070661_1002920101 223
69 3300049741 Ga0501079_0281183 Ga0501079_0281183_564_1256 223
70 3300005578 Ga0068854_100572730 Ga0068854_1005727302 225
71 3300006028 Ga0070717_10045744 Ga0070717_100457444 225
72 3300009098 Ga0105245_10620435 Ga0105245_106204352 225
73 3300013297 Ga0157378_10093713 Ga0157378_100937132 225
74 3300013308 Ga0157375_11613212 Ga0157375_116132121 225
75 3300014969 Ga0157376_10031867 Ga0157376_100318675 225
76 3300021384 Ga0213876_10181618 Ga0213876_101816182 225
77 3300021384 Ga0213876_10265303 Ga0213876_102653031 225
78 3300039437 Ga0436365_0276746 Ga0436365_0276746_133_855 225
79 3300039437 Ga0436365_1876107 Ga0436365_1876107_394_1086 225
80 3300045976 Ga0466967_0047410 Ga0466967_0047410_2873_3595 225
81 3300049569 Ga0501032_0022398 Ga0501032_0022398_126_830 225
82 3300049571 Ga0501034_0003799 Ga0501034_0003799_2362_3066 225
83 3300049572 Ga0501036_0028506 Ga0501036_0028506_417_1121 225
84 3300049574 Ga0501038_0008739 Ga0501038_0008739_8296_9000 225
85 3300049579 Ga0501043_0374800 Ga0501043_0374800_309_1013 225
86 3300049580 Ga0501046_0180621 Ga0501046_0180621_634_1338 225
87 3300049581 Ga0501047_0000904 Ga0501047_0000904_11897_12601 225
88 3300049583 Ga0501067_0000426 Ga0501067_0000426_12883_13587 225
89 3300049584 Ga0501068_0227633 Ga0501068_0227633_114_818 225
90 3300049586 Ga0501070_0003914 Ga0501070_0003914_2525_3229 225
91 3300049588 Ga0501072_0001604 Ga0501072_0001604_2378_3082 225
92 3300049589 Ga0501073_0000757 Ga0501073_0000757_15206_15910 225
93 3300049590 Ga0501074_0008447 Ga0501074_0008447_279_983 225
94 3300049741 Ga0501079_0436187 Ga0501079_0436187_107_811 225
95 3300049742 Ga0501080_0000997 Ga0501080_0000997_11156_11860 225
96 3300049742 Ga0501080_0102099 Ga0501080_0102099_770_1474 225
97 3300049744 Ga0501083_0001097 Ga0501083_0001097_8596_9300 225
98 3300049822 Ga0501035_0455144 Ga0501035_0455144_34_738 225
99 3300049823 Ga0501044_0400802 Ga0501044_0400802_106_810 225
100 3300053093 Ga0500651_0006155 Ga0500651_0006155_4643_5356 225
101 3300060353 Ga0501082_0005091 Ga0501082_0005091_10355_11059 225
102 3300025261 Ga0209233_1003991 Ga0209233_10039914 226
103 3300028573 Ga0265334_10000261 Ga0265334_100002618 226
104 3300049572 Ga0501036_0087286 Ga0501036_0087286_300_998 226
105 3300049580 Ga0501046_0261645 Ga0501046_0261645_392_1090 226
106 3300049581 Ga0501047_0004470 Ga0501047_0004470_7269_7967 226
107 3300049581 Ga0501047_0103817 Ga0501047_0103817_810_1505 226
108 3300049742 Ga0501080_0040437 Ga0501080_0040437_2852_3550 226
109 3300060353 Ga0501082_0610259 Ga0501082_0610259_62_760 226
110 3300005338 Ga0068868_100235910 Ga0068868_1002359102 227
111 3300005340 Ga0070689_100212758 Ga0070689_1002127582 227
112 3300005354 Ga0070675_100178141 Ga0070675_1001781412 227
113 3300005364 Ga0070673_100162004 Ga0070673_1001620042 227
114 3300005365 Ga0070688_100070795 Ga0070688_1000707952 227
115 3300005459 Ga0068867_100034533 Ga0068867_1000345333 227
116 3300005539 Ga0068853_100092602 Ga0068853_1000926022 227
117 3300005543 Ga0070672_100210395 Ga0070672_1002103952 227
118 3300005544 Ga0070686_100049766 Ga0070686_1000497662 227
119 3300005563 Ga0068855_100253025 Ga0068855_1002530252 227
120 3300005841 Ga0068863_100181274 Ga0068863_1001812742 227
121 3300005841 Ga0068863_100212415 Ga0068863_1002124152 227
122 3300005842 Ga0068858_100185580 Ga0068858_1001855802 227
123 3300005843 Ga0068860_100419075 Ga0068860_1004190752 227
124 3300006237 Ga0097621_100179808 Ga0097621_1001798082 227
125 3300006237 Ga0097621_100386122 Ga0097621_1003861222 227
126 3300006358 Ga0068871_100386873 Ga0068871_1003868731 227
127 3300006881 Ga0068865_100164922 Ga0068865_1001649222 227
128 3300009176 Ga0105242_10252224 Ga0105242_102522241 227
129 3300009177 Ga0105248_10061435 Ga0105248_100614353 227
130 3300013296 Ga0157374_10339429 Ga0157374_103394292 227
131 3300013306 Ga0163162_10555933 Ga0163162_105559332 227
132 3300013308 Ga0157375_10127533 Ga0157375_101275334 227
133 3300014968 Ga0157379_10111113 Ga0157379_101111133 227
134 3300025903 Ga0207680_10286906 Ga0207680_102869062 227
135 3300025926 Ga0207659_10146950 Ga0207659_101469502 227
136 3300025933 Ga0207706_10318387 Ga0207706_103183872 227
137 3300025934 Ga0207686_10333395 Ga0207686_103333952 227
138 3300025936 Ga0207670_10062710 Ga0207670_100627104 227
139 3300025938 Ga0207704_10103686 Ga0207704_101036862 227
140 3300025940 Ga0207691_10102696 Ga0207691_101026962 227
141 3300025941 Ga0207711_10260898 Ga0207711_102608982 227
142 3300025961 Ga0207712_10095637 Ga0207712_100956372 227
143 3300026023 Ga0207677_10035189 Ga0207677_100351893 227
144 3300026035 Ga0207703_10230046 Ga0207703_102300462 227
145 3300026088 Ga0207641_10069357 Ga0207641_100693572 227
146 3300026089 Ga0207648_10006166 Ga0207648_1000616610 227
147 3300026095 Ga0207676_10264204 Ga0207676_102642042 227
148 3300026121 Ga0207683_10256605 Ga0207683_102566052 227
149 3300005367 Ga0070667_100104349 Ga0070667_1001043492 228
150 3300005457 Ga0070662_100443291 Ga0070662_1004432911 228
151 3300005539 Ga0068853_100018944 Ga0068853_1000189444 228
152 3300005539 Ga0068853_100038413 Ga0068853_1000384132 228
153 3300005548 Ga0070665_100000100 Ga0070665_10000010038 228
154 3300005563 Ga0068855_100012768 Ga0068855_1000127688 228
155 3300005577 Ga0068857_100150814 Ga0068857_1001508142 228
156 3300006358 Ga0068871_100507617 Ga0068871_1005076172 228
157 3300009545 Ga0105237_10370731 Ga0105237_103707312 228
158 3300009553 Ga0105249_10258762 Ga0105249_102587622 228
159 3300010375 Ga0105239_10027756 Ga0105239_100277564 228
160 3300010375 Ga0105239_10189691 Ga0105239_101896913 228
161 3300013104 Ga0157370_10184289 Ga0157370_101842892 228
162 3300014968 Ga0157379_10689850 Ga0157379_106898501 228
163 3300025303 Ga0209051_1008714 Ga0209051_10087144 228
164 3300025914 Ga0207671_10227117 Ga0207671_102271172 228
165 3300025933 Ga0207706_10406197 Ga0207706_104061972 228
166 3300025949 Ga0207667_10015626 Ga0207667_100156268 228
167 3300025949 Ga0207667_10035987 Ga0207667_100359874 228
168 3300025981 Ga0207640_10193516 Ga0207640_101935162 228
169 3300025986 Ga0207658_10024920 Ga0207658_100249204 228
170 3300025986 Ga0207658_10246158 Ga0207658_102461582 228
171 3300026041 Ga0207639_10001434 Ga0207639_1000143413 228
172 3300026116 Ga0207674_10055775 Ga0207674_100557754 228
173 3300026116 Ga0207674_10087027 Ga0207674_100870272 228
174 3300028379 Ga0268266_10000017 Ga0268266_10000017110 228
175 3300028379 Ga0268266_10347875 Ga0268266_103478752 228
176 3300041460 Ga0451802_0282031 Ga0451802_0282031_818_1522 228
177 3300041463 Ga0451804_1017626 Ga0451804_1017626_344_1048 228
178 3300047319 Ga0495674_0527921 Ga0495674_0527921_171_923 228
179 3300049568 Ga0501031_0034083 Ga0501031_0034083_979_1677 228
180 3300049569 Ga0501032_0007788 Ga0501032_0007788_1480_2178 228
181 3300049570 Ga0501033_0020962 Ga0501033_0020962_4181_4879 228
182 3300049571 Ga0501034_0025887 Ga0501034_0025887_1325_2023 228
183 3300049572 Ga0501036_0582194 Ga0501036_0582194_85_783 228
184 3300049573 Ga0501037_0008521 Ga0501037_0008521_1211_1909 228
185 3300049574 Ga0501038_0001893 Ga0501038_0001893_14405_15103 228
186 3300049575 Ga0501039_0059962 Ga0501039_0059962_1210_1908 228
187 3300049579 Ga0501043_0022877 Ga0501043_0022877_4146_4844 228
188 3300049580 Ga0501046_0005403 Ga0501046_0005403_5181_5879 228
189 3300049581 Ga0501047_0036905 Ga0501047_0036905_3969_4667 228
190 3300049586 Ga0501070_0092284 Ga0501070_0092284_1490_2188 228
191 3300049589 Ga0501073_0012304 Ga0501073_0012304_1210_1908 228
192 3300049589 Ga0501073_0164365 Ga0501073_0164365_704_1402 228
193 3300049742 Ga0501080_0038235 Ga0501080_0038235_496_1194 228
194 3300049822 Ga0501035_0005934 Ga0501035_0005934_3644_4342 228
195 3300049823 Ga0501044_0046973 Ga0501044_0046973_1027_1725 228
196 3300049823 Ga0501044_0891882 Ga0501044_0891882_32_730 228
197 3300005539 Ga0068853_100000503 Ga0068853_10000050311 229
198 3300005539 Ga0068853_100332679 Ga0068853_1003326792 229
199 3300005547 Ga0070693_100231167 Ga0070693_1002311672 229
200 3300005983 Ga0081540_1001867 Ga0081540_10018674 229
201 3300006237 Ga0097621_100097312 Ga0097621_1000973123 229
202 3300006358 Ga0068871_100111239 Ga0068871_1001112392 229
203 3300009093 Ga0105240_10353840 Ga0105240_103538402 229
204 3300009177 Ga0105248_10000231 Ga0105248_1000023118 229
205 3300009545 Ga0105237_10001039 Ga0105237_1000103910 229
206 3300013307 Ga0157372_10016942 Ga0157372_100169426 229
207 3300025914 Ga0207671_10060741 Ga0207671_100607412 229
208 3300025941 Ga0207711_10000539 Ga0207711_1000053910 229
209 3300025961 Ga0207712_10000649 Ga0207712_100006494 229
210 3300025986 Ga0207658_10000033 Ga0207658_1000003320 229
211 3300026041 Ga0207639_10008013 Ga0207639_100080137 229
212 3300026067 Ga0207678_10000140 Ga0207678_1000014032 229
213 3300026142 Ga0207698_10539349 Ga0207698_105393492 229
214 3300031507 Ga0307509_10337383 Ga0307509_103373832 229
215 3300041512 Ga0451853_1542807 Ga0451853_1542807_323_1045 229
216 3300048918 Ga0496115_0269851 Ga0496115_0269851_402_1118 229
217 3300048924 Ga0496121_0042229 Ga0496121_0042229_1210_1908 229
218 3300048925 Ga0496122_0000362 Ga0496122_0000362_10318_11016 229
219 3300048926 Ga0496123_0000317 Ga0496123_0000317_76058_76756 229
220 3300048929 Ga0496126_0019434 Ga0496126_0019434_4781_5479 229
221 3300049568 Ga0501031_0290737 Ga0501031_0290737_306_995 229
222 3300049569 Ga0501032_0079484 Ga0501032_0079484_588_1277 229
223 3300049570 Ga0501033_0001488 Ga0501033_0001488_19918_20607 229
224 3300049571 Ga0501034_0010499 Ga0501034_0010499_6771_7460 229
225 3300049571 Ga0501034_0023971 Ga0501034_0023971_4894_5583 229
226 3300049572 Ga0501036_0001031 Ga0501036_0001031_162_851 229
227 3300049573 Ga0501037_0070989 Ga0501037_0070989_1338_2027 229
228 3300049574 Ga0501038_0006230 Ga0501038_0006230_1718_2407 229
229 3300049575 Ga0501039_0035282 Ga0501039_0035282_2160_2849 229
230 3300049575 Ga0501039_0053378 Ga0501039_0053378_1945_2634 229
231 3300049576 Ga0501040_0015657 Ga0501040_0015657_1554_2243 229
232 3300049578 Ga0501042_0103306 Ga0501042_0103306_1302_1991 229
233 3300049579 Ga0501043_0024829 Ga0501043_0024829_672_1361 229
234 3300049580 Ga0501046_0015085 Ga0501046_0015085_599_1288 229
235 3300049580 Ga0501046_0015614 Ga0501046_0015614_2146_2835 229
236 3300049581 Ga0501047_0074571 Ga0501047_0074571_152_841 229
237 3300049583 Ga0501067_0064403 Ga0501067_0064403_493_1182 229
238 3300049584 Ga0501068_0029374 Ga0501068_0029374_927_1616 229
239 3300049584 Ga0501068_0065274 Ga0501068_0065274_239_928 229
240 3300049585 Ga0501069_0070019 Ga0501069_0070019_841_1530 229
241 3300049585 Ga0501069_0208726 Ga0501069_0208726_282_971 229
242 3300049586 Ga0501070_0129752 Ga0501070_0129752_258_947 229
243 3300049587 Ga0501071_0016556 Ga0501071_0016556_1485_2174 229
244 3300049588 Ga0501072_0018078 Ga0501072_0018078_2255_2944 229
245 3300049589 Ga0501073_0043825 Ga0501073_0043825_1136_1825 229
246 3300049589 Ga0501073_0156595 Ga0501073_0156595_819_1508 229
247 3300049592 Ga0501076_0119177 Ga0501076_0119177_608_1297 229
248 3300049741 Ga0501079_0043243 Ga0501079_0043243_2752_3441 229
249 3300049741 Ga0501079_0094358 Ga0501079_0094358_1607_2296 229
250 3300049743 Ga0501081_0056165 Ga0501081_0056165_1632_2321 229
251 3300049744 Ga0501083_0029251 Ga0501083_0029251_1533_2222 229
252 3300049822 Ga0501035_0031301 Ga0501035_0031301_1744_2433 229
253 3300049822 Ga0501035_0060013 Ga0501035_0060013_2110_2799 229
254 3300049823 Ga0501044_0055626 Ga0501044_0055626_3342_4031 229
255 3300049823 Ga0501044_0067673 Ga0501044_0067673_970_1659 229
256 3300049824 Ga0501045_0014786 Ga0501045_0014786_1613_2302 229
257 3300054114 Ga0501084_0145607 Ga0501084_0145607_50_739 229
258 3300060353 Ga0501082_0009960 Ga0501082_0009960_1408_2097 229
259 3300061734 Ga0530510_0752891 Ga0530510_0752891_14_703 229
260 3300005331 Ga0070670_100098070 Ga0070670_1000980702 230
261 3300005347 Ga0070668_100005066 Ga0070668_10000506610 230
262 3300005364 Ga0070673_100236208 Ga0070673_1002362081 230
263 3300005367 Ga0070667_100383706 Ga0070667_1003837062 230
264 3300005455 Ga0070663_100045735 Ga0070663_1000457354 230
265 3300005456 Ga0070678_100316746 Ga0070678_1003167462 230
266 3300005457 Ga0070662_100234737 Ga0070662_1002347371 230
267 3300005539 Ga0068853_100211599 Ga0068853_1002115992 230
268 3300005548 Ga0070665_100097125 Ga0070665_1000971254 230
269 3300005548 Ga0070665_100177251 Ga0070665_1001772512 230
270 3300005563 Ga0068855_100136394 Ga0068855_1001363943 230
271 3300005577 Ga0068857_100087769 Ga0068857_1000877692 230
272 3300005578 Ga0068854_100193281 Ga0068854_1001932812 230
273 3300005616 Ga0068852_100073312 Ga0068852_1000733122 230
274 3300005618 Ga0068864_100188087 Ga0068864_1001880872 230
275 3300005834 Ga0068851_10077985 Ga0068851_100779852 230
276 3300005844 Ga0068862_100003393 Ga0068862_10000339310 230
277 3300006237 Ga0097621_100019448 Ga0097621_1000194484 230
278 3300006237 Ga0097621_100041426 Ga0097621_1000414264 230
279 3300006358 Ga0068871_100021532 Ga0068871_1000215324 230
280 3300006881 Ga0068865_100001608 Ga0068865_1000016084 230
281 3300006881 Ga0068865_100024024 Ga0068865_1000240242 230
282 3300009101 Ga0105247_10065186 Ga0105247_100651862 230
283 3300009177 Ga0105248_10264538 Ga0105248_102645382 230
284 3300010375 Ga0105239_10044570 Ga0105239_100445705 230
285 3300013307 Ga0157372_10769156 Ga0157372_107691562 230
286 3300014968 Ga0157379_10121875 Ga0157379_101218752 230
287 3300014969 Ga0157376_10192792 Ga0157376_101927922 230
288 3300025321 Ga0207656_10064747 Ga0207656_100647472 230
289 3300025925 Ga0207650_10210393 Ga0207650_102103932 230
290 3300025933 Ga0207706_10546617 Ga0207706_105466172 230
291 3300025938 Ga0207704_10006764 Ga0207704_100067644 230
292 3300025938 Ga0207704_10043584 Ga0207704_100435842 230
293 3300025949 Ga0207667_10587214 Ga0207667_105872142 230
294 3300025981 Ga0207640_10263521 Ga0207640_102635212 230
295 3300026023 Ga0207677_10056240 Ga0207677_100562404 230
296 3300026041 Ga0207639_10293503 Ga0207639_102935031 230
297 3300026067 Ga0207678_10007343 Ga0207678_100073432 230
298 3300026088 Ga0207641_10207147 Ga0207641_102071472 230
299 3300026116 Ga0207674_10185671 Ga0207674_101856712 230
300 3300026142 Ga0207698_10257623 Ga0207698_102576232 230
301 3300028379 Ga0268266_10509144 Ga0268266_105091442 230
302 3300028380 Ga0268265_10002513 Ga0268265_100025136 230
303 3300028381 Ga0268264_10576660 Ga0268264_105766602 230
304 3300041512 Ga0451853_0668608 Ga0451853_0668608_255_974 230
305 3300046694 Ga0495649_0208095 Ga0495649_0208095_58_786 230
306 3300048928 Ga0496125_0184775 Ga0496125_0184775_383_1120 230
307 3300049573 Ga0501037_0050303 Ga0501037_0050303_826_1530 230
308 3300049579 Ga0501043_0112653 Ga0501043_0112653_1100_1825 230
309 3300049580 Ga0501046_0018216 Ga0501046_0018216_694_1386 230
310 3300049581 Ga0501047_0113311 Ga0501047_0113311_1420_2112 230
311 3300049581 Ga0501047_0213150 Ga0501047_0213150_734_1438 230
312 3300049584 Ga0501068_0075842 Ga0501068_0075842_362_1066 230
313 3300049586 Ga0501070_0297784 Ga0501070_0297784_277_1071 230
314 3300049589 Ga0501073_0072681 Ga0501073_0072681_20_712 230
315 3300049589 Ga0501073_0111496 Ga0501073_0111496_903_1607 230
316 3300049822 Ga0501035_0040327 Ga0501035_0040327_1115_1909 230
317 3300049823 Ga0501044_0014392 Ga0501044_0014392_1956_2750 230
318 3300049823 Ga0501044_0021034 Ga0501044_0021034_213_917 230
319 3300053079 Ga0500610_0099479 Ga0500610_0099479_514_1227 230
320 3300053139 Ga0500568_0020752 Ga0500568_0020752_190_882 230
321 3300054114 Ga0501084_0137857 Ga0501084_0137857_1181_1873 230
322 3300060353 Ga0501082_0001180 Ga0501082_0001180_19796_20488 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

89

259

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.941 29 230
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.9191 29 230
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.9184 29 230
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.8934 29 230
8eg0-assembly1.cif.gz_A cryoem structure of human mettl1-wdr4 in complex with lys-trna and sah 0.8618 39 230
ID Description Score Start End Superfamily
3dxzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9411 29 230 3.40.50.150
3dxzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9184 29 230 3.40.50.150
af_P9WFY9_38_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9107 23 229 3.40.50.150
af_Q55EX4_556_743_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8882 56 229 3.40.50.150
af_Q8II90_111_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8718 57 226 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A656YE72-F1-model_v4 deleted 0.9562 23 230
AF-A0A652ZYK4-F1-model_v4 deleted 0.9557 22 230
AF-A0A132MSZ1-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9549 22 229 GO:0008176
GO:0043527
AF-A0A5E6NLH3-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9531 46 230 GO:0008176
GO:0043527
AF-G5LTJ1-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9526 38 230 GO:0008176
GO:0043527

Feature Viewer

pLDDT pTM Quality
87.28 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map