F406655
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 322 | 160 | 322 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0297784|Ga0501070_0297784_277_1071 |
| Length | 264 |
| Sequence | MPRDLPAVSAERKNPDAPAVRPPPTADGSPEADSTSEPASHPDRRIRSFVLRQGRTTPAQQRAFDDHWARYGLEFAGAPRDFANVFGRTAPLVVEIGFGNGEQLLHAAMSEPGRDFIGIEVHRPGVGRLLNALADADVANARVYRHDAVEVLECEIAPAALDEVRIYFPDPWPKKRHHKRRLIQPDFVALLASRIAHGGRLHLATDWADYAEHMRNVLDNAAGWRLEAHDAAAADRPGRRIDTHFERRGLKLGHGVRDLIYERT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 59 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 101 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 103 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 104 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 105 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 106 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 107 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 108 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 109 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 110 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 115 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 116 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 117 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 118 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 119 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 120 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 121 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 122 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 123 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 124 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 125 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 155 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 156 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 157 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 158 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.17 |
| Nodule | 0 |
| Rhizoplane | 1.86 |
| Rhizosphere | 91.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070670_100098070 | 3300005331 | Bacteria | 2521 |
| 2 | Ga0070666_10069325 | 3300005335 | Bacteria | 2397 |
| 3 | Ga0068868_100096668 | 3300005338 | Bacteria | 2386 |
| 4 | Ga0068868_100235910 | 3300005338 | Bacteria | 1536 |
| 5 | Ga0070689_100212758 | 3300005340 | Bacteria | 1583 |
| 6 | Ga0070661_100292010 | 3300005344 | Bacteria | 1267 |
| 7 | Ga0070668_100005066 | 3300005347 | Bacteria | 9753 |
| 8 | Ga0070668_100203601 | 3300005347 | Bacteria | 1625 |
| 9 | Ga0070669_100026834 | 3300005353 | Bacteria | 4145 |
| 10 | Ga0070675_100178141 | 3300005354 | Bacteria | 1837 |
| 11 | Ga0070673_100162004 | 3300005364 | Bacteria | 1903 |
| 12 | Ga0070673_100236208 | 3300005364 | Bacteria | 1587 |
| 13 | Ga0070688_100070795 | 3300005365 | Bacteria | 2231 |
| 14 | Ga0070667_100104349 | 3300005367 | Bacteria | 2452 |
| 15 | Ga0070667_100383706 | 3300005367 | Bacteria | 1276 |
| 16 | Ga0070667_100478592 | 3300005367 | Bacteria | 1140 |
| 17 | Ga0070710_10328762 | 3300005437 | Bacteria | 1006 |
| 18 | Ga0070705_100309721 | 3300005440 | Bacteria | 1135 |
| 19 | Ga0070663_100045735 | 3300005455 | Bacteria | 3093 |
| 20 | Ga0070678_100316746 | 3300005456 | Bacteria | 1331 |
| 21 | Ga0070662_100234737 | 3300005457 | Bacteria | 1469 |
| 22 | Ga0070662_100443291 | 3300005457 | Bacteria | 1077 |
| 23 | Ga0068867_100034533 | 3300005459 | Bacteria | 3665 |
| 24 | Ga0068867_100191657 | 3300005459 | Bacteria | 1631 |
| 25 | Ga0068853_100000503 | 3300005539 | Bacteria | 26688 |
| 26 | Ga0068853_100016375 | 3300005539 | Bacteria | 6101 |
| 27 | Ga0068853_100018944 | 3300005539 | Bacteria | 5700 |
| 28 | Ga0068853_100038413 | 3300005539 | Bacteria | 4077 |
| 29 | Ga0068853_100092602 | 3300005539 | Bacteria | 2659 |
| 30 | Ga0068853_100211599 | 3300005539 | Bacteria | 1767 |
| 31 | Ga0068853_100288857 | 3300005539 | Bacteria | 1513 |
| 32 | Ga0068853_100332679 | 3300005539 | Bacteria | 1410 |
| 33 | Ga0068853_100621794 | 3300005539 | Bacteria | 1027 |
| 34 | Ga0070672_100210395 | 3300005543 | Bacteria | 1629 |
| 35 | Ga0070686_100049766 | 3300005544 | Bacteria | 2661 |
| 36 | Ga0070693_100231167 | 3300005547 | Bacteria | 1217 |
| 37 | Ga0070665_100000100 | 3300005548 | Bacteria | 160186 |
| 38 | Ga0070665_100066102 | 3300005548 | Bacteria | 3627 |
| 39 | Ga0070665_100097125 | 3300005548 | Bacteria | 2951 |
| 40 | Ga0070665_100177251 | 3300005548 | Bacteria | 2132 |
| 41 | Ga0070665_100190869 | 3300005548 | Bacteria | 2049 |
| 42 | Ga0068855_100012768 | 3300005563 | Bacteria | 10130 |
| 43 | Ga0068855_100136394 | 3300005563 | Bacteria | 2799 |
| 44 | Ga0068855_100253025 | 3300005563 | Bacteria | 1964 |
| 45 | Ga0070664_100673291 | 3300005564 | Bacteria | 962 |
| 46 | Ga0068857_100087769 | 3300005577 | Bacteria | 2782 |
| 47 | Ga0068857_100150814 | 3300005577 | Bacteria | 2106 |
| 48 | Ga0068854_100193281 | 3300005578 | Bacteria | 1596 |
| 49 | Ga0068854_100572730 | 3300005578 | Bacteria | 961 |
| 50 | Ga0068852_100073312 | 3300005616 | Bacteria | 3011 |
| 51 | Ga0068864_100188087 | 3300005618 | Bacteria | 1891 |
| 52 | Ga0068851_10077985 | 3300005834 | Bacteria | 1725 |
| 53 | Ga0068863_100181274 | 3300005841 | Bacteria | 2021 |
| 54 | Ga0068863_100212415 | 3300005841 | Bacteria | 1863 |
| 55 | Ga0068858_100185580 | 3300005842 | Bacteria | 1964 |
| 56 | Ga0068858_100496562 | 3300005842 | Bacteria | 1179 |
| 57 | Ga0068860_100419075 | 3300005843 | Bacteria | 1327 |
| 58 | Ga0068862_100003393 | 3300005844 | Bacteria | 13736 |
| 59 | Ga0081540_1001867 | 3300005983 | Bacteria | 17644 |
| 60 | Ga0070717_10045744 | 3300006028 | Bacteria | 3579 |
| 61 | Ga0097621_100019448 | 3300006237 | Bacteria | 5212 |
| 62 | Ga0097621_100041426 | 3300006237 | Bacteria | 3707 |
| 63 | Ga0097621_100097312 | 3300006237 | Bacteria | 2471 |
| 64 | Ga0097621_100179808 | 3300006237 | Bacteria | 1827 |
| 65 | Ga0097621_100386122 | 3300006237 | Bacteria | 1251 |
| 66 | Ga0097621_100582003 | 3300006237 | Bacteria | 1021 |
| 67 | Ga0068871_100021532 | 3300006358 | Bacteria | 4957 |
| 68 | Ga0068871_100111239 | 3300006358 | Bacteria | 2304 |
| 69 | Ga0068871_100359952 | 3300006358 | Bacteria | 1289 |
| 70 | Ga0068871_100386873 | 3300006358 | Bacteria | 1243 |
| 71 | Ga0068871_100507617 | 3300006358 | Bacteria | 1088 |
| 72 | Ga0068871_100611790 | 3300006358 | Bacteria | 992 |
| 73 | Ga0068865_100001608 | 3300006881 | Bacteria | 13231 |
| 74 | Ga0068865_100024024 | 3300006881 | Bacteria | 3995 |
| 75 | Ga0068865_100164922 | 3300006881 | Bacteria | 1693 |
| 76 | Ga0105240_10353840 | 3300009093 | Bacteria | 1665 |
| 77 | Ga0105245_10620435 | 3300009098 | Bacteria | 1109 |
| 78 | Ga0105247_10065186 | 3300009101 | Bacteria | 2265 |
| 79 | Ga0105242_10006082 | 3300009176 | Bacteria | 9307 |
| 80 | Ga0105242_10252224 | 3300009176 | Bacteria | 1590 |
| 81 | Ga0105248_10000231 | 3300009177 | Bacteria | 64041 |
| 82 | Ga0105248_10061435 | 3300009177 | Bacteria | 4219 |
| 83 | Ga0105248_10264538 | 3300009177 | Bacteria | 1936 |
| 84 | Ga0105237_10001039 | 3300009545 | Bacteria | 37324 |
| 85 | Ga0105237_10224167 | 3300009545 | Bacteria | 1880 |
| 86 | Ga0105237_10370731 | 3300009545 | Bacteria | 1436 |
| 87 | Ga0105237_10439484 | 3300009545 | Bacteria | 1310 |
| 88 | Ga0105238_10002060 | 3300009551 | Bacteria | 20286 |
| 89 | Ga0105249_10024262 | 3300009553 | Bacteria | 5450 |
| 90 | Ga0105249_10258762 | 3300009553 | Bacteria | 1728 |
| 91 | Ga0105239_10027756 | 3300010375 | Bacteria | 6229 |
| 92 | Ga0105239_10044570 | 3300010375 | Bacteria | 4862 |
| 93 | Ga0105239_10189691 | 3300010375 | Bacteria | 2301 |
| 94 | Ga0105239_10490385 | 3300010375 | Bacteria | 1396 |
| 95 | Ga0157373_10565352 | 3300013100 | Bacteria | 826 |
| 96 | Ga0157370_10184289 | 3300013104 | Bacteria | 1939 |
| 97 | Ga0157369_10000318 | 3300013105 | Bacteria | 64959 |
| 98 | Ga0157374_10339429 | 3300013296 | Bacteria | 1491 |
| 99 | Ga0157378_10093713 | 3300013297 | Bacteria | 2734 |
| 100 | Ga0163162_10007714 | 3300013306 | Bacteria | 10484 |
| 101 | Ga0163162_10555933 | 3300013306 | Bacteria | 1276 |
| 102 | Ga0157372_10016942 | 3300013307 | Bacteria | 7823 |
| 103 | Ga0157372_10446239 | 3300013307 | Bacteria | 1508 |
| 104 | Ga0157372_10769156 | 3300013307 | Bacteria | 1119 |
| 105 | Ga0157375_10002588 | 3300013308 | Bacteria | 15711 |
| 106 | Ga0157375_10127533 | 3300013308 | Bacteria | 2661 |
| 107 | Ga0157375_11613212 | 3300013308 | Bacteria | 767 |
| 108 | Ga0157379_10111113 | 3300014968 | Bacteria | 2462 |
| 109 | Ga0157379_10121875 | 3300014968 | Bacteria | 2346 |
| 110 | Ga0157379_10689850 | 3300014968 | Bacteria | 958 |
| 111 | Ga0157376_10031867 | 3300014969 | Bacteria | 4227 |
| 112 | Ga0157376_10076721 | 3300014969 | Bacteria | 2856 |
| 113 | Ga0157376_10192792 | 3300014969 | Bacteria | 1870 |
| 114 | Ga0157376_10416888 | 3300014969 | Bacteria | 1302 |
| 115 | Ga0213876_10181618 | 3300021384 | Bacteria | 1119 |
| 116 | Ga0213876_10265303 | 3300021384 | Bacteria | 913 |
| 117 | Ga0209233_1003991 | 3300025261 | Bacteria | 5112 |
| 118 | Ga0209051_1008714 | 3300025303 | Bacteria | 5336 |
| 119 | Ga0207656_10064747 | 3300025321 | Bacteria | 1612 |
| 120 | Ga0207680_10046702 | 3300025903 | Bacteria | 2561 |
| 121 | Ga0207680_10286906 | 3300025903 | Bacteria | 1145 |
| 122 | Ga0207645_10018212 | 3300025907 | Bacteria | 4626 |
| 123 | Ga0207654_10221807 | 3300025911 | Bacteria | 1255 |
| 124 | Ga0207695_10632209 | 3300025913 | Bacteria | 952 |
| 125 | Ga0207671_10025410 | 3300025914 | Bacteria | 4449 |
| 126 | Ga0207671_10060741 | 3300025914 | Bacteria | 2804 |
| 127 | Ga0207671_10227117 | 3300025914 | Bacteria | 1464 |
| 128 | Ga0207663_10351214 | 3300025916 | Bacteria | 1116 |
| 129 | Ga0207649_10568599 | 3300025920 | Bacteria | 869 |
| 130 | Ga0207681_10004582 | 3300025923 | Bacteria | 8500 |
| 131 | Ga0207694_10002841 | 3300025924 | Bacteria | 13972 |
| 132 | Ga0207650_10210393 | 3300025925 | Bacteria | 1562 |
| 133 | Ga0207659_10146950 | 3300025926 | Bacteria | 1837 |
| 134 | Ga0207706_10318387 | 3300025933 | Bacteria | 1354 |
| 135 | Ga0207706_10406197 | 3300025933 | Bacteria | 1180 |
| 136 | Ga0207706_10546617 | 3300025933 | Bacteria | 997 |
| 137 | Ga0207686_10333395 | 3300025934 | Bacteria | 1137 |
| 138 | Ga0207670_10062710 | 3300025936 | Bacteria | 2541 |
| 139 | Ga0207704_10006764 | 3300025938 | Bacteria | 5372 |
| 140 | Ga0207704_10043584 | 3300025938 | Bacteria | 2651 |
| 141 | Ga0207704_10103686 | 3300025938 | Bacteria | 1903 |
| 142 | Ga0207691_10102696 | 3300025940 | Bacteria | 2550 |
| 143 | Ga0207691_10253821 | 3300025940 | Bacteria | 1517 |
| 144 | Ga0207711_10000539 | 3300025941 | Bacteria | 38710 |
| 145 | Ga0207711_10260898 | 3300025941 | Bacteria | 1592 |
| 146 | Ga0207689_10221876 | 3300025942 | Bacteria | 1562 |
| 147 | Ga0207667_10015626 | 3300025949 | Bacteria | 8611 |
| 148 | Ga0207667_10035987 | 3300025949 | Bacteria | 5309 |
| 149 | Ga0207667_10587214 | 3300025949 | Bacteria | 1124 |
| 150 | Ga0207651_10238834 | 3300025960 | Bacteria | 1480 |
| 151 | Ga0207712_10000649 | 3300025961 | Bacteria | 27151 |
| 152 | Ga0207712_10095637 | 3300025961 | Bacteria | 2197 |
| 153 | Ga0207712_10106038 | 3300025961 | Bacteria | 2098 |
| 154 | Ga0207668_10060012 | 3300025972 | Bacteria | 2668 |
| 155 | Ga0207668_10388722 | 3300025972 | Bacteria | 1176 |
| 156 | Ga0207640_10193516 | 3300025981 | Bacteria | 1535 |
| 157 | Ga0207640_10263521 | 3300025981 | Bacteria | 1344 |
| 158 | Ga0207658_10000033 | 3300025986 | Bacteria | 158540 |
| 159 | Ga0207658_10024920 | 3300025986 | Bacteria | 4186 |
| 160 | Ga0207658_10246158 | 3300025986 | Bacteria | 1517 |
| 161 | Ga0207677_10035189 | 3300026023 | Bacteria | 3250 |
| 162 | Ga0207677_10056240 | 3300026023 | Bacteria | 2694 |
| 163 | Ga0207677_10076253 | 3300026023 | Bacteria | 2386 |
| 164 | Ga0207703_10230046 | 3300026035 | Bacteria | 1662 |
| 165 | Ga0207639_10001434 | 3300026041 | Bacteria | 16078 |
| 166 | Ga0207639_10008013 | 3300026041 | Bacteria | 7218 |
| 167 | Ga0207639_10293503 | 3300026041 | Bacteria | 1434 |
| 168 | Ga0207678_10000140 | 3300026067 | Bacteria | 59288 |
| 169 | Ga0207678_10007343 | 3300026067 | Bacteria | 9761 |
| 170 | Ga0207678_10332421 | 3300026067 | Bacteria | 1308 |
| 171 | Ga0207678_10393060 | 3300026067 | Bacteria | 1200 |
| 172 | Ga0207641_10069357 | 3300026088 | Bacteria | 3026 |
| 173 | Ga0207641_10207147 | 3300026088 | Bacteria | 1811 |
| 174 | Ga0207648_10006166 | 3300026089 | Bacteria | 11947 |
| 175 | Ga0207648_10230947 | 3300026089 | Bacteria | 1646 |
| 176 | Ga0207676_10264204 | 3300026095 | Bacteria | 1555 |
| 177 | Ga0207674_10055775 | 3300026116 | Bacteria | 4016 |
| 178 | Ga0207674_10087027 | 3300026116 | Bacteria | 3118 |
| 179 | Ga0207674_10185671 | 3300026116 | Bacteria | 2030 |
| 180 | Ga0207683_10256605 | 3300026121 | Bacteria | 1596 |
| 181 | Ga0207698_10257623 | 3300026142 | Bacteria | 1601 |
| 182 | Ga0207698_10539349 | 3300026142 | Bacteria | 1141 |
| 183 | Ga0268266_10000017 | 3300028379 | Bacteria | 607272 |
| 184 | Ga0268266_10097706 | 3300028379 | Bacteria | 2583 |
| 185 | Ga0268266_10113067 | 3300028379 | Bacteria | 2407 |
| 186 | Ga0268266_10347875 | 3300028379 | Bacteria | 1392 |
| 187 | Ga0268266_10509144 | 3300028379 | Bacteria | 1150 |
| 188 | Ga0268265_10002513 | 3300028380 | Bacteria | 13735 |
| 189 | Ga0268264_10576660 | 3300028381 | Bacteria | 1106 |
| 190 | Ga0265334_10000261 | 3300028573 | Bacteria | 29770 |
| 191 | Ga0307509_10337383 | 3300031507 | Bacteria | 1236 |
| 192 | Ga0373937_0041404 | 3300036401 | Bacteria | 4201 |
| 193 | Ga0436365_0276746 | 3300039437 | Bacteria | 1805 |
| 194 | Ga0436365_1876107 | 3300039437 | Bacteria | 1294 |
| 195 | Ga0451802_0282031 | 3300041460 | Bacteria | 2719 |
| 196 | Ga0451804_1017626 | 3300041463 | Bacteria | 1209 |
| 197 | Ga0451853_0668608 | 3300041512 | Bacteria | 2666 |
| 198 | Ga0451853_1542807 | 3300041512 | Bacteria | 1070 |
| 199 | Ga0466972_0000761 | 3300044658 | Bacteria | 15355 |
| 200 | Ga0466970_0000395 | 3300044765 | Bacteria | 21174 |
| 201 | Ga0466959_0014794 | 3300045049 | Bacteria | 5679 |
| 202 | Ga0466967_0047410 | 3300045976 | Bacteria | 3746 |
| 203 | Ga0495641_0185788 | 3300046461 | Bacteria | 931 |
| 204 | Ga0495640_0449028 | 3300046533 | Bacteria | 788 |
| 205 | Ga0495649_0208095 | 3300046694 | Bacteria | 1014 |
| 206 | Ga0495674_0527921 | 3300047319 | Bacteria | 942 |
| 207 | Ga0496104_0000023 | 3300048907 | Bacteria | 236818 |
| 208 | Ga0496105_0000019 | 3300048908 | Bacteria | 185293 |
| 209 | Ga0496114_0117595 | 3300048917 | Bacteria | 2283 |
| 210 | Ga0496115_0269851 | 3300048918 | Bacteria | 1398 |
| 211 | Ga0496117_0098225 | 3300048920 | Bacteria | 1862 |
| 212 | Ga0496118_0000081 | 3300048921 | Bacteria | 188525 |
| 213 | Ga0496118_0005866 | 3300048921 | Bacteria | 13763 |
| 214 | Ga0496121_0042229 | 3300048924 | Bacteria | 3971 |
| 215 | Ga0496122_0000362 | 3300048925 | Bacteria | 97690 |
| 216 | Ga0496123_0000317 | 3300048926 | Bacteria | 92079 |
| 217 | Ga0496125_0184775 | 3300048928 | Bacteria | 1384 |
| 218 | Ga0496126_0019434 | 3300048929 | Bacteria | 6690 |
| 219 | Ga0501031_0034083 | 3300049568 | Bacteria | 3322 |
| 220 | Ga0501031_0290737 | 3300049568 | Bacteria | 1059 |
| 221 | Ga0501032_0007788 | 3300049569 | Bacteria | 7811 |
| 222 | Ga0501032_0022398 | 3300049569 | Bacteria | 4379 |
| 223 | Ga0501032_0079484 | 3300049569 | Bacteria | 2183 |
| 224 | Ga0501033_0001488 | 3300049570 | Bacteria | 20749 |
| 225 | Ga0501033_0020962 | 3300049570 | Bacteria | 4935 |
| 226 | Ga0501034_0003799 | 3300049571 | Bacteria | 17035 |
| 227 | Ga0501034_0010499 | 3300049571 | Bacteria | 9643 |
| 228 | Ga0501034_0023971 | 3300049571 | Bacteria | 6210 |
| 229 | Ga0501034_0025887 | 3300049571 | Bacteria | 5974 |
| 230 | Ga0501036_0001031 | 3300049572 | Bacteria | 21035 |
| 231 | Ga0501036_0028506 | 3300049572 | Bacteria | 4718 |
| 232 | Ga0501036_0087286 | 3300049572 | Bacteria | 2637 |
| 233 | Ga0501036_0582194 | 3300049572 | Bacteria | 929 |
| 234 | Ga0501037_0008521 | 3300049573 | Bacteria | 7521 |
| 235 | Ga0501037_0050303 | 3300049573 | Bacteria | 3050 |
| 236 | Ga0501037_0070989 | 3300049573 | Bacteria | 2533 |
| 237 | Ga0501038_0001893 | 3300049574 | Bacteria | 19359 |
| 238 | Ga0501038_0006230 | 3300049574 | Bacteria | 11030 |
| 239 | Ga0501038_0008739 | 3300049574 | Bacteria | 9293 |
| 240 | Ga0501038_0210337 | 3300049574 | Bacteria | 1556 |
| 241 | Ga0501039_0035282 | 3300049575 | Bacteria | 3859 |
| 242 | Ga0501039_0053378 | 3300049575 | Bacteria | 3127 |
| 243 | Ga0501039_0059962 | 3300049575 | Bacteria | 2947 |
| 244 | Ga0501040_0015657 | 3300049576 | Bacteria | 5014 |
| 245 | Ga0501042_0103306 | 3300049578 | Bacteria | 2050 |
| 246 | Ga0501043_0022877 | 3300049579 | Bacteria | 4900 |
| 247 | Ga0501043_0024829 | 3300049579 | Bacteria | 4702 |
| 248 | Ga0501043_0112653 | 3300049579 | Bacteria | 2136 |
| 249 | Ga0501043_0374800 | 3300049579 | Bacteria | 1078 |
| 250 | Ga0501046_0005403 | 3300049580 | Bacteria | 11422 |
| 251 | Ga0501046_0015085 | 3300049580 | Bacteria | 6497 |
| 252 | Ga0501046_0015614 | 3300049580 | Bacteria | 6376 |
| 253 | Ga0501046_0018216 | 3300049580 | Bacteria | 5848 |
| 254 | Ga0501046_0180621 | 3300049580 | Bacteria | 1578 |
| 255 | Ga0501046_0261645 | 3300049580 | Bacteria | 1271 |
| 256 | Ga0501047_0000904 | 3300049581 | Bacteria | 30280 |
| 257 | Ga0501047_0004470 | 3300049581 | Bacteria | 13159 |
| 258 | Ga0501047_0036905 | 3300049581 | Bacteria | 4723 |
| 259 | Ga0501047_0074571 | 3300049581 | Bacteria | 3266 |
| 260 | Ga0501047_0103817 | 3300049581 | Bacteria | 2723 |
| 261 | Ga0501047_0113311 | 3300049581 | Bacteria | 2594 |
| 262 | Ga0501047_0213150 | 3300049581 | Bacteria | 1789 |
| 263 | Ga0501067_0000426 | 3300049583 | Bacteria | 22971 |
| 264 | Ga0501067_0064403 | 3300049583 | Bacteria | 2029 |
| 265 | Ga0501068_0029374 | 3300049584 | Bacteria | 3254 |
| 266 | Ga0501068_0065274 | 3300049584 | Bacteria | 2215 |
| 267 | Ga0501068_0075842 | 3300049584 | Bacteria | 2057 |
| 268 | Ga0501068_0227633 | 3300049584 | Bacteria | 1185 |
| 269 | Ga0501069_0070019 | 3300049585 | Bacteria | 1964 |
| 270 | Ga0501069_0208726 | 3300049585 | Bacteria | 1133 |
| 271 | Ga0501070_0003914 | 3300049586 | Bacteria | 12847 |
| 272 | Ga0501070_0092284 | 3300049586 | Bacteria | 2506 |
| 273 | Ga0501070_0129752 | 3300049586 | Bacteria | 2082 |
| 274 | Ga0501070_0297784 | 3300049586 | Bacteria | 1314 |
| 275 | Ga0501071_0016556 | 3300049587 | Bacteria | 5072 |
| 276 | Ga0501072_0001604 | 3300049588 | Bacteria | 16909 |
| 277 | Ga0501072_0018078 | 3300049588 | Bacteria | 5421 |
| 278 | Ga0501073_0000757 | 3300049589 | Bacteria | 22907 |
| 279 | Ga0501073_0012304 | 3300049589 | Bacteria | 6243 |
| 280 | Ga0501073_0043825 | 3300049589 | Bacteria | 3154 |
| 281 | Ga0501073_0072681 | 3300049589 | Bacteria | 2395 |
| 282 | Ga0501073_0111496 | 3300049589 | Bacteria | 1897 |
| 283 | Ga0501073_0156595 | 3300049589 | Bacteria | 1578 |
| 284 | Ga0501073_0164365 | 3300049589 | Bacteria | 1537 |
| 285 | Ga0501074_0008447 | 3300049590 | Bacteria | 7464 |
| 286 | Ga0501076_0119177 | 3300049592 | Bacteria | 2137 |
| 287 | Ga0501079_0043243 | 3300049741 | Bacteria | 3477 |
| 288 | Ga0501079_0094358 | 3300049741 | Bacteria | 2318 |
| 289 | Ga0501079_0281183 | 3300049741 | Bacteria | 1301 |
| 290 | Ga0501079_0436187 | 3300049741 | Bacteria | 1028 |
| 291 | Ga0501080_0000997 | 3300049742 | Bacteria | 23230 |
| 292 | Ga0501080_0038235 | 3300049742 | Bacteria | 4481 |
| 293 | Ga0501080_0040437 | 3300049742 | Bacteria | 4349 |
| 294 | Ga0501080_0102099 | 3300049742 | Bacteria | 2661 |
| 295 | Ga0501081_0056165 | 3300049743 | Bacteria | 2720 |
| 296 | Ga0501083_0001097 | 3300049744 | Bacteria | 18095 |
| 297 | Ga0501083_0029251 | 3300049744 | Bacteria | 3791 |
| 298 | Ga0501035_0005934 | 3300049822 | Bacteria | 11496 |
| 299 | Ga0501035_0031301 | 3300049822 | Bacteria | 4845 |
| 300 | Ga0501035_0040327 | 3300049822 | Bacteria | 4220 |
| 301 | Ga0501035_0060013 | 3300049822 | Bacteria | 3386 |
| 302 | Ga0501035_0455144 | 3300049822 | Bacteria | 1058 |
| 303 | Ga0501044_0014392 | 3300049823 | Bacteria | 8543 |
| 304 | Ga0501044_0021034 | 3300049823 | Bacteria | 6965 |
| 305 | Ga0501044_0046973 | 3300049823 | Bacteria | 4468 |
| 306 | Ga0501044_0055626 | 3300049823 | Bacteria | 4063 |
| 307 | Ga0501044_0067673 | 3300049823 | Bacteria | 3638 |
| 308 | Ga0501044_0400802 | 3300049823 | Bacteria | 1284 |
| 309 | Ga0501044_0891882 | 3300049823 | Bacteria | 764 |
| 310 | Ga0501045_0014786 | 3300049824 | Bacteria | 5533 |
| 311 | Ga0500610_0099479 | 3300053079 | Bacteria | 1505 |
| 312 | Ga0500635_0052853 | 3300053080 | Bacteria | 1396 |
| 313 | Ga0500651_0006155 | 3300053093 | Bacteria | 6892 |
| 314 | Ga0500651_0054249 | 3300053093 | Bacteria | 2513 |
| 315 | Ga0500568_0020752 | 3300053139 | Bacteria | 2837 |
| 316 | Ga0501084_0137857 | 3300054114 | Bacteria | 2054 |
| 317 | Ga0501084_0145607 | 3300054114 | Bacteria | 1995 |
| 318 | Ga0501082_0001180 | 3300060353 | Bacteria | 22960 |
| 319 | Ga0501082_0005091 | 3300060353 | Bacteria | 11453 |
| 320 | Ga0501082_0009960 | 3300060353 | Bacteria | 8196 |
| 321 | Ga0501082_0610259 | 3300060353 | Bacteria | 955 |
| 322 | Ga0530510_0752891 | 3300061734 | Bacteria | 743 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053093 | Ga0500651_0054249 | Ga0500651_0054249_1139_1936 | 191 |
| 2 | 3300048921 | Ga0496118_0000081 | Ga0496118_0000081_95445_96155 | 207 |
| 3 | 3300005335 | Ga0070666_10069325 | Ga0070666_100693252 | 209 |
| 4 | 3300005353 | Ga0070669_100026834 | Ga0070669_1000268343 | 209 |
| 5 | 3300005548 | Ga0070665_100066102 | Ga0070665_1000661022 | 209 |
| 6 | 3300025903 | Ga0207680_10046702 | Ga0207680_100467022 | 209 |
| 7 | 3300025923 | Ga0207681_10004582 | Ga0207681_100045826 | 209 |
| 8 | 3300028379 | Ga0268266_10113067 | Ga0268266_101130672 | 209 |
| 9 | 3300013307 | Ga0157372_10446239 | Ga0157372_104462392 | 210 |
| 10 | 3300045049 | Ga0466959_0014794 | Ga0466959_0014794_2124_2828 | 211 |
| 11 | 3300048920 | Ga0496117_0098225 | Ga0496117_0098225_876_1577 | 212 |
| 12 | 3300048921 | Ga0496118_0005866 | Ga0496118_0005866_1557_2258 | 212 |
| 13 | 3300005347 | Ga0070668_100203601 | Ga0070668_1002036012 | 213 |
| 14 | 3300025972 | Ga0207668_10060012 | Ga0207668_100600122 | 213 |
| 15 | 3300005338 | Ga0068868_100096668 | Ga0068868_1000966682 | 214 |
| 16 | 3300005539 | Ga0068853_100621794 | Ga0068853_1006217941 | 214 |
| 17 | 3300009176 | Ga0105242_10006082 | Ga0105242_100060822 | 214 |
| 18 | 3300013306 | Ga0163162_10007714 | Ga0163162_1000771411 | 214 |
| 19 | 3300013308 | Ga0157375_10002588 | Ga0157375_1000258812 | 214 |
| 20 | 3300014969 | Ga0157376_10076721 | Ga0157376_100767212 | 214 |
| 21 | 3300026023 | Ga0207677_10076253 | Ga0207677_100762533 | 214 |
| 22 | 3300036401 | Ga0373937_0041404 | Ga0373937_0041404_1381_2025 | 214 |
| 23 | 3300048907 | Ga0496104_0000023 | Ga0496104_0000023_118358_119002 | 214 |
| 24 | 3300048908 | Ga0496105_0000019 | Ga0496105_0000019_118357_119001 | 214 |
| 25 | 3300005367 | Ga0070667_100478592 | Ga0070667_1004785922 | 215 |
| 26 | 3300005440 | Ga0070705_100309721 | Ga0070705_1003097211 | 215 |
| 27 | 3300005459 | Ga0068867_100191657 | Ga0068867_1001916572 | 215 |
| 28 | 3300005539 | Ga0068853_100016375 | Ga0068853_1000163757 | 215 |
| 29 | 3300005548 | Ga0070665_100190869 | Ga0070665_1001908692 | 215 |
| 30 | 3300005564 | Ga0070664_100673291 | Ga0070664_1006732912 | 215 |
| 31 | 3300005842 | Ga0068858_100496562 | Ga0068858_1004965622 | 215 |
| 32 | 3300014969 | Ga0157376_10416888 | Ga0157376_104168882 | 215 |
| 33 | 3300025907 | Ga0207645_10018212 | Ga0207645_100182125 | 215 |
| 34 | 3300025940 | Ga0207691_10253821 | Ga0207691_102538212 | 215 |
| 35 | 3300025942 | Ga0207689_10221876 | Ga0207689_102218762 | 215 |
| 36 | 3300025960 | Ga0207651_10238834 | Ga0207651_102388342 | 215 |
| 37 | 3300025972 | Ga0207668_10388722 | Ga0207668_103887222 | 215 |
| 38 | 3300026089 | Ga0207648_10230947 | Ga0207648_102309472 | 215 |
| 39 | 3300028379 | Ga0268266_10097706 | Ga0268266_100977062 | 215 |
| 40 | 3300046461 | Ga0495641_0185788 | Ga0495641_0185788_201_899 | 218 |
| 41 | 3300046533 | Ga0495640_0449028 | Ga0495640_0449028_11_709 | 218 |
| 42 | 3300053080 | Ga0500635_0052853 | Ga0500635_0052853_64_762 | 218 |
| 43 | 3300044658 | Ga0466972_0000761 | Ga0466972_0000761_13153_13857 | 219 |
| 44 | 3300044765 | Ga0466970_0000395 | Ga0466970_0000395_13867_14571 | 219 |
| 45 | 3300026067 | Ga0207678_10393060 | Ga0207678_103930601 | 220 |
| 46 | 3300005437 | Ga0070710_10328762 | Ga0070710_103287622 | 221 |
| 47 | 3300005539 | Ga0068853_100288857 | Ga0068853_1002888572 | 221 |
| 48 | 3300006237 | Ga0097621_100582003 | Ga0097621_1005820031 | 221 |
| 49 | 3300006358 | Ga0068871_100359952 | Ga0068871_1003599522 | 221 |
| 50 | 3300006358 | Ga0068871_100611790 | Ga0068871_1006117902 | 221 |
| 51 | 3300009545 | Ga0105237_10224167 | Ga0105237_102241673 | 221 |
| 52 | 3300009545 | Ga0105237_10439484 | Ga0105237_104394841 | 221 |
| 53 | 3300009551 | Ga0105238_10002060 | Ga0105238_1000206015 | 221 |
| 54 | 3300009553 | Ga0105249_10024262 | Ga0105249_100242626 | 221 |
| 55 | 3300010375 | Ga0105239_10490385 | Ga0105239_104903852 | 221 |
| 56 | 3300013100 | Ga0157373_10565352 | Ga0157373_105653521 | 221 |
| 57 | 3300013105 | Ga0157369_10000318 | Ga0157369_1000031813 | 221 |
| 58 | 3300025911 | Ga0207654_10221807 | Ga0207654_102218072 | 221 |
| 59 | 3300025913 | Ga0207695_10632209 | Ga0207695_106322091 | 221 |
| 60 | 3300025914 | Ga0207671_10025410 | Ga0207671_100254101 | 221 |
| 61 | 3300025916 | Ga0207663_10351214 | Ga0207663_103512141 | 221 |
| 62 | 3300025920 | Ga0207649_10568599 | Ga0207649_105685992 | 221 |
| 63 | 3300025924 | Ga0207694_10002841 | Ga0207694_100028411 | 221 |
| 64 | 3300025961 | Ga0207712_10106038 | Ga0207712_101060382 | 221 |
| 65 | 3300026067 | Ga0207678_10332421 | Ga0207678_103324211 | 221 |
| 66 | 3300048917 | Ga0496114_0117595 | Ga0496114_0117595_1015_1722 | 221 |
| 67 | 3300049574 | Ga0501038_0210337 | Ga0501038_0210337_224_997 | 221 |
| 68 | 3300005344 | Ga0070661_100292010 | Ga0070661_1002920101 | 223 |
| 69 | 3300049741 | Ga0501079_0281183 | Ga0501079_0281183_564_1256 | 223 |
| 70 | 3300005578 | Ga0068854_100572730 | Ga0068854_1005727302 | 225 |
| 71 | 3300006028 | Ga0070717_10045744 | Ga0070717_100457444 | 225 |
| 72 | 3300009098 | Ga0105245_10620435 | Ga0105245_106204352 | 225 |
| 73 | 3300013297 | Ga0157378_10093713 | Ga0157378_100937132 | 225 |
| 74 | 3300013308 | Ga0157375_11613212 | Ga0157375_116132121 | 225 |
| 75 | 3300014969 | Ga0157376_10031867 | Ga0157376_100318675 | 225 |
| 76 | 3300021384 | Ga0213876_10181618 | Ga0213876_101816182 | 225 |
| 77 | 3300021384 | Ga0213876_10265303 | Ga0213876_102653031 | 225 |
| 78 | 3300039437 | Ga0436365_0276746 | Ga0436365_0276746_133_855 | 225 |
| 79 | 3300039437 | Ga0436365_1876107 | Ga0436365_1876107_394_1086 | 225 |
| 80 | 3300045976 | Ga0466967_0047410 | Ga0466967_0047410_2873_3595 | 225 |
| 81 | 3300049569 | Ga0501032_0022398 | Ga0501032_0022398_126_830 | 225 |
| 82 | 3300049571 | Ga0501034_0003799 | Ga0501034_0003799_2362_3066 | 225 |
| 83 | 3300049572 | Ga0501036_0028506 | Ga0501036_0028506_417_1121 | 225 |
| 84 | 3300049574 | Ga0501038_0008739 | Ga0501038_0008739_8296_9000 | 225 |
| 85 | 3300049579 | Ga0501043_0374800 | Ga0501043_0374800_309_1013 | 225 |
| 86 | 3300049580 | Ga0501046_0180621 | Ga0501046_0180621_634_1338 | 225 |
| 87 | 3300049581 | Ga0501047_0000904 | Ga0501047_0000904_11897_12601 | 225 |
| 88 | 3300049583 | Ga0501067_0000426 | Ga0501067_0000426_12883_13587 | 225 |
| 89 | 3300049584 | Ga0501068_0227633 | Ga0501068_0227633_114_818 | 225 |
| 90 | 3300049586 | Ga0501070_0003914 | Ga0501070_0003914_2525_3229 | 225 |
| 91 | 3300049588 | Ga0501072_0001604 | Ga0501072_0001604_2378_3082 | 225 |
| 92 | 3300049589 | Ga0501073_0000757 | Ga0501073_0000757_15206_15910 | 225 |
| 93 | 3300049590 | Ga0501074_0008447 | Ga0501074_0008447_279_983 | 225 |
| 94 | 3300049741 | Ga0501079_0436187 | Ga0501079_0436187_107_811 | 225 |
| 95 | 3300049742 | Ga0501080_0000997 | Ga0501080_0000997_11156_11860 | 225 |
| 96 | 3300049742 | Ga0501080_0102099 | Ga0501080_0102099_770_1474 | 225 |
| 97 | 3300049744 | Ga0501083_0001097 | Ga0501083_0001097_8596_9300 | 225 |
| 98 | 3300049822 | Ga0501035_0455144 | Ga0501035_0455144_34_738 | 225 |
| 99 | 3300049823 | Ga0501044_0400802 | Ga0501044_0400802_106_810 | 225 |
| 100 | 3300053093 | Ga0500651_0006155 | Ga0500651_0006155_4643_5356 | 225 |
| 101 | 3300060353 | Ga0501082_0005091 | Ga0501082_0005091_10355_11059 | 225 |
| 102 | 3300025261 | Ga0209233_1003991 | Ga0209233_10039914 | 226 |
| 103 | 3300028573 | Ga0265334_10000261 | Ga0265334_100002618 | 226 |
| 104 | 3300049572 | Ga0501036_0087286 | Ga0501036_0087286_300_998 | 226 |
| 105 | 3300049580 | Ga0501046_0261645 | Ga0501046_0261645_392_1090 | 226 |
| 106 | 3300049581 | Ga0501047_0004470 | Ga0501047_0004470_7269_7967 | 226 |
| 107 | 3300049581 | Ga0501047_0103817 | Ga0501047_0103817_810_1505 | 226 |
| 108 | 3300049742 | Ga0501080_0040437 | Ga0501080_0040437_2852_3550 | 226 |
| 109 | 3300060353 | Ga0501082_0610259 | Ga0501082_0610259_62_760 | 226 |
| 110 | 3300005338 | Ga0068868_100235910 | Ga0068868_1002359102 | 227 |
| 111 | 3300005340 | Ga0070689_100212758 | Ga0070689_1002127582 | 227 |
| 112 | 3300005354 | Ga0070675_100178141 | Ga0070675_1001781412 | 227 |
| 113 | 3300005364 | Ga0070673_100162004 | Ga0070673_1001620042 | 227 |
| 114 | 3300005365 | Ga0070688_100070795 | Ga0070688_1000707952 | 227 |
| 115 | 3300005459 | Ga0068867_100034533 | Ga0068867_1000345333 | 227 |
| 116 | 3300005539 | Ga0068853_100092602 | Ga0068853_1000926022 | 227 |
| 117 | 3300005543 | Ga0070672_100210395 | Ga0070672_1002103952 | 227 |
| 118 | 3300005544 | Ga0070686_100049766 | Ga0070686_1000497662 | 227 |
| 119 | 3300005563 | Ga0068855_100253025 | Ga0068855_1002530252 | 227 |
| 120 | 3300005841 | Ga0068863_100181274 | Ga0068863_1001812742 | 227 |
| 121 | 3300005841 | Ga0068863_100212415 | Ga0068863_1002124152 | 227 |
| 122 | 3300005842 | Ga0068858_100185580 | Ga0068858_1001855802 | 227 |
| 123 | 3300005843 | Ga0068860_100419075 | Ga0068860_1004190752 | 227 |
| 124 | 3300006237 | Ga0097621_100179808 | Ga0097621_1001798082 | 227 |
| 125 | 3300006237 | Ga0097621_100386122 | Ga0097621_1003861222 | 227 |
| 126 | 3300006358 | Ga0068871_100386873 | Ga0068871_1003868731 | 227 |
| 127 | 3300006881 | Ga0068865_100164922 | Ga0068865_1001649222 | 227 |
| 128 | 3300009176 | Ga0105242_10252224 | Ga0105242_102522241 | 227 |
| 129 | 3300009177 | Ga0105248_10061435 | Ga0105248_100614353 | 227 |
| 130 | 3300013296 | Ga0157374_10339429 | Ga0157374_103394292 | 227 |
| 131 | 3300013306 | Ga0163162_10555933 | Ga0163162_105559332 | 227 |
| 132 | 3300013308 | Ga0157375_10127533 | Ga0157375_101275334 | 227 |
| 133 | 3300014968 | Ga0157379_10111113 | Ga0157379_101111133 | 227 |
| 134 | 3300025903 | Ga0207680_10286906 | Ga0207680_102869062 | 227 |
| 135 | 3300025926 | Ga0207659_10146950 | Ga0207659_101469502 | 227 |
| 136 | 3300025933 | Ga0207706_10318387 | Ga0207706_103183872 | 227 |
| 137 | 3300025934 | Ga0207686_10333395 | Ga0207686_103333952 | 227 |
| 138 | 3300025936 | Ga0207670_10062710 | Ga0207670_100627104 | 227 |
| 139 | 3300025938 | Ga0207704_10103686 | Ga0207704_101036862 | 227 |
| 140 | 3300025940 | Ga0207691_10102696 | Ga0207691_101026962 | 227 |
| 141 | 3300025941 | Ga0207711_10260898 | Ga0207711_102608982 | 227 |
| 142 | 3300025961 | Ga0207712_10095637 | Ga0207712_100956372 | 227 |
| 143 | 3300026023 | Ga0207677_10035189 | Ga0207677_100351893 | 227 |
| 144 | 3300026035 | Ga0207703_10230046 | Ga0207703_102300462 | 227 |
| 145 | 3300026088 | Ga0207641_10069357 | Ga0207641_100693572 | 227 |
| 146 | 3300026089 | Ga0207648_10006166 | Ga0207648_1000616610 | 227 |
| 147 | 3300026095 | Ga0207676_10264204 | Ga0207676_102642042 | 227 |
| 148 | 3300026121 | Ga0207683_10256605 | Ga0207683_102566052 | 227 |
| 149 | 3300005367 | Ga0070667_100104349 | Ga0070667_1001043492 | 228 |
| 150 | 3300005457 | Ga0070662_100443291 | Ga0070662_1004432911 | 228 |
| 151 | 3300005539 | Ga0068853_100018944 | Ga0068853_1000189444 | 228 |
| 152 | 3300005539 | Ga0068853_100038413 | Ga0068853_1000384132 | 228 |
| 153 | 3300005548 | Ga0070665_100000100 | Ga0070665_10000010038 | 228 |
| 154 | 3300005563 | Ga0068855_100012768 | Ga0068855_1000127688 | 228 |
| 155 | 3300005577 | Ga0068857_100150814 | Ga0068857_1001508142 | 228 |
| 156 | 3300006358 | Ga0068871_100507617 | Ga0068871_1005076172 | 228 |
| 157 | 3300009545 | Ga0105237_10370731 | Ga0105237_103707312 | 228 |
| 158 | 3300009553 | Ga0105249_10258762 | Ga0105249_102587622 | 228 |
| 159 | 3300010375 | Ga0105239_10027756 | Ga0105239_100277564 | 228 |
| 160 | 3300010375 | Ga0105239_10189691 | Ga0105239_101896913 | 228 |
| 161 | 3300013104 | Ga0157370_10184289 | Ga0157370_101842892 | 228 |
| 162 | 3300014968 | Ga0157379_10689850 | Ga0157379_106898501 | 228 |
| 163 | 3300025303 | Ga0209051_1008714 | Ga0209051_10087144 | 228 |
| 164 | 3300025914 | Ga0207671_10227117 | Ga0207671_102271172 | 228 |
| 165 | 3300025933 | Ga0207706_10406197 | Ga0207706_104061972 | 228 |
| 166 | 3300025949 | Ga0207667_10015626 | Ga0207667_100156268 | 228 |
| 167 | 3300025949 | Ga0207667_10035987 | Ga0207667_100359874 | 228 |
| 168 | 3300025981 | Ga0207640_10193516 | Ga0207640_101935162 | 228 |
| 169 | 3300025986 | Ga0207658_10024920 | Ga0207658_100249204 | 228 |
| 170 | 3300025986 | Ga0207658_10246158 | Ga0207658_102461582 | 228 |
| 171 | 3300026041 | Ga0207639_10001434 | Ga0207639_1000143413 | 228 |
| 172 | 3300026116 | Ga0207674_10055775 | Ga0207674_100557754 | 228 |
| 173 | 3300026116 | Ga0207674_10087027 | Ga0207674_100870272 | 228 |
| 174 | 3300028379 | Ga0268266_10000017 | Ga0268266_10000017110 | 228 |
| 175 | 3300028379 | Ga0268266_10347875 | Ga0268266_103478752 | 228 |
| 176 | 3300041460 | Ga0451802_0282031 | Ga0451802_0282031_818_1522 | 228 |
| 177 | 3300041463 | Ga0451804_1017626 | Ga0451804_1017626_344_1048 | 228 |
| 178 | 3300047319 | Ga0495674_0527921 | Ga0495674_0527921_171_923 | 228 |
| 179 | 3300049568 | Ga0501031_0034083 | Ga0501031_0034083_979_1677 | 228 |
| 180 | 3300049569 | Ga0501032_0007788 | Ga0501032_0007788_1480_2178 | 228 |
| 181 | 3300049570 | Ga0501033_0020962 | Ga0501033_0020962_4181_4879 | 228 |
| 182 | 3300049571 | Ga0501034_0025887 | Ga0501034_0025887_1325_2023 | 228 |
| 183 | 3300049572 | Ga0501036_0582194 | Ga0501036_0582194_85_783 | 228 |
| 184 | 3300049573 | Ga0501037_0008521 | Ga0501037_0008521_1211_1909 | 228 |
| 185 | 3300049574 | Ga0501038_0001893 | Ga0501038_0001893_14405_15103 | 228 |
| 186 | 3300049575 | Ga0501039_0059962 | Ga0501039_0059962_1210_1908 | 228 |
| 187 | 3300049579 | Ga0501043_0022877 | Ga0501043_0022877_4146_4844 | 228 |
| 188 | 3300049580 | Ga0501046_0005403 | Ga0501046_0005403_5181_5879 | 228 |
| 189 | 3300049581 | Ga0501047_0036905 | Ga0501047_0036905_3969_4667 | 228 |
| 190 | 3300049586 | Ga0501070_0092284 | Ga0501070_0092284_1490_2188 | 228 |
| 191 | 3300049589 | Ga0501073_0012304 | Ga0501073_0012304_1210_1908 | 228 |
| 192 | 3300049589 | Ga0501073_0164365 | Ga0501073_0164365_704_1402 | 228 |
| 193 | 3300049742 | Ga0501080_0038235 | Ga0501080_0038235_496_1194 | 228 |
| 194 | 3300049822 | Ga0501035_0005934 | Ga0501035_0005934_3644_4342 | 228 |
| 195 | 3300049823 | Ga0501044_0046973 | Ga0501044_0046973_1027_1725 | 228 |
| 196 | 3300049823 | Ga0501044_0891882 | Ga0501044_0891882_32_730 | 228 |
| 197 | 3300005539 | Ga0068853_100000503 | Ga0068853_10000050311 | 229 |
| 198 | 3300005539 | Ga0068853_100332679 | Ga0068853_1003326792 | 229 |
| 199 | 3300005547 | Ga0070693_100231167 | Ga0070693_1002311672 | 229 |
| 200 | 3300005983 | Ga0081540_1001867 | Ga0081540_10018674 | 229 |
| 201 | 3300006237 | Ga0097621_100097312 | Ga0097621_1000973123 | 229 |
| 202 | 3300006358 | Ga0068871_100111239 | Ga0068871_1001112392 | 229 |
| 203 | 3300009093 | Ga0105240_10353840 | Ga0105240_103538402 | 229 |
| 204 | 3300009177 | Ga0105248_10000231 | Ga0105248_1000023118 | 229 |
| 205 | 3300009545 | Ga0105237_10001039 | Ga0105237_1000103910 | 229 |
| 206 | 3300013307 | Ga0157372_10016942 | Ga0157372_100169426 | 229 |
| 207 | 3300025914 | Ga0207671_10060741 | Ga0207671_100607412 | 229 |
| 208 | 3300025941 | Ga0207711_10000539 | Ga0207711_1000053910 | 229 |
| 209 | 3300025961 | Ga0207712_10000649 | Ga0207712_100006494 | 229 |
| 210 | 3300025986 | Ga0207658_10000033 | Ga0207658_1000003320 | 229 |
| 211 | 3300026041 | Ga0207639_10008013 | Ga0207639_100080137 | 229 |
| 212 | 3300026067 | Ga0207678_10000140 | Ga0207678_1000014032 | 229 |
| 213 | 3300026142 | Ga0207698_10539349 | Ga0207698_105393492 | 229 |
| 214 | 3300031507 | Ga0307509_10337383 | Ga0307509_103373832 | 229 |
| 215 | 3300041512 | Ga0451853_1542807 | Ga0451853_1542807_323_1045 | 229 |
| 216 | 3300048918 | Ga0496115_0269851 | Ga0496115_0269851_402_1118 | 229 |
| 217 | 3300048924 | Ga0496121_0042229 | Ga0496121_0042229_1210_1908 | 229 |
| 218 | 3300048925 | Ga0496122_0000362 | Ga0496122_0000362_10318_11016 | 229 |
| 219 | 3300048926 | Ga0496123_0000317 | Ga0496123_0000317_76058_76756 | 229 |
| 220 | 3300048929 | Ga0496126_0019434 | Ga0496126_0019434_4781_5479 | 229 |
| 221 | 3300049568 | Ga0501031_0290737 | Ga0501031_0290737_306_995 | 229 |
| 222 | 3300049569 | Ga0501032_0079484 | Ga0501032_0079484_588_1277 | 229 |
| 223 | 3300049570 | Ga0501033_0001488 | Ga0501033_0001488_19918_20607 | 229 |
| 224 | 3300049571 | Ga0501034_0010499 | Ga0501034_0010499_6771_7460 | 229 |
| 225 | 3300049571 | Ga0501034_0023971 | Ga0501034_0023971_4894_5583 | 229 |
| 226 | 3300049572 | Ga0501036_0001031 | Ga0501036_0001031_162_851 | 229 |
| 227 | 3300049573 | Ga0501037_0070989 | Ga0501037_0070989_1338_2027 | 229 |
| 228 | 3300049574 | Ga0501038_0006230 | Ga0501038_0006230_1718_2407 | 229 |
| 229 | 3300049575 | Ga0501039_0035282 | Ga0501039_0035282_2160_2849 | 229 |
| 230 | 3300049575 | Ga0501039_0053378 | Ga0501039_0053378_1945_2634 | 229 |
| 231 | 3300049576 | Ga0501040_0015657 | Ga0501040_0015657_1554_2243 | 229 |
| 232 | 3300049578 | Ga0501042_0103306 | Ga0501042_0103306_1302_1991 | 229 |
| 233 | 3300049579 | Ga0501043_0024829 | Ga0501043_0024829_672_1361 | 229 |
| 234 | 3300049580 | Ga0501046_0015085 | Ga0501046_0015085_599_1288 | 229 |
| 235 | 3300049580 | Ga0501046_0015614 | Ga0501046_0015614_2146_2835 | 229 |
| 236 | 3300049581 | Ga0501047_0074571 | Ga0501047_0074571_152_841 | 229 |
| 237 | 3300049583 | Ga0501067_0064403 | Ga0501067_0064403_493_1182 | 229 |
| 238 | 3300049584 | Ga0501068_0029374 | Ga0501068_0029374_927_1616 | 229 |
| 239 | 3300049584 | Ga0501068_0065274 | Ga0501068_0065274_239_928 | 229 |
| 240 | 3300049585 | Ga0501069_0070019 | Ga0501069_0070019_841_1530 | 229 |
| 241 | 3300049585 | Ga0501069_0208726 | Ga0501069_0208726_282_971 | 229 |
| 242 | 3300049586 | Ga0501070_0129752 | Ga0501070_0129752_258_947 | 229 |
| 243 | 3300049587 | Ga0501071_0016556 | Ga0501071_0016556_1485_2174 | 229 |
| 244 | 3300049588 | Ga0501072_0018078 | Ga0501072_0018078_2255_2944 | 229 |
| 245 | 3300049589 | Ga0501073_0043825 | Ga0501073_0043825_1136_1825 | 229 |
| 246 | 3300049589 | Ga0501073_0156595 | Ga0501073_0156595_819_1508 | 229 |
| 247 | 3300049592 | Ga0501076_0119177 | Ga0501076_0119177_608_1297 | 229 |
| 248 | 3300049741 | Ga0501079_0043243 | Ga0501079_0043243_2752_3441 | 229 |
| 249 | 3300049741 | Ga0501079_0094358 | Ga0501079_0094358_1607_2296 | 229 |
| 250 | 3300049743 | Ga0501081_0056165 | Ga0501081_0056165_1632_2321 | 229 |
| 251 | 3300049744 | Ga0501083_0029251 | Ga0501083_0029251_1533_2222 | 229 |
| 252 | 3300049822 | Ga0501035_0031301 | Ga0501035_0031301_1744_2433 | 229 |
| 253 | 3300049822 | Ga0501035_0060013 | Ga0501035_0060013_2110_2799 | 229 |
| 254 | 3300049823 | Ga0501044_0055626 | Ga0501044_0055626_3342_4031 | 229 |
| 255 | 3300049823 | Ga0501044_0067673 | Ga0501044_0067673_970_1659 | 229 |
| 256 | 3300049824 | Ga0501045_0014786 | Ga0501045_0014786_1613_2302 | 229 |
| 257 | 3300054114 | Ga0501084_0145607 | Ga0501084_0145607_50_739 | 229 |
| 258 | 3300060353 | Ga0501082_0009960 | Ga0501082_0009960_1408_2097 | 229 |
| 259 | 3300061734 | Ga0530510_0752891 | Ga0530510_0752891_14_703 | 229 |
| 260 | 3300005331 | Ga0070670_100098070 | Ga0070670_1000980702 | 230 |
| 261 | 3300005347 | Ga0070668_100005066 | Ga0070668_10000506610 | 230 |
| 262 | 3300005364 | Ga0070673_100236208 | Ga0070673_1002362081 | 230 |
| 263 | 3300005367 | Ga0070667_100383706 | Ga0070667_1003837062 | 230 |
| 264 | 3300005455 | Ga0070663_100045735 | Ga0070663_1000457354 | 230 |
| 265 | 3300005456 | Ga0070678_100316746 | Ga0070678_1003167462 | 230 |
| 266 | 3300005457 | Ga0070662_100234737 | Ga0070662_1002347371 | 230 |
| 267 | 3300005539 | Ga0068853_100211599 | Ga0068853_1002115992 | 230 |
| 268 | 3300005548 | Ga0070665_100097125 | Ga0070665_1000971254 | 230 |
| 269 | 3300005548 | Ga0070665_100177251 | Ga0070665_1001772512 | 230 |
| 270 | 3300005563 | Ga0068855_100136394 | Ga0068855_1001363943 | 230 |
| 271 | 3300005577 | Ga0068857_100087769 | Ga0068857_1000877692 | 230 |
| 272 | 3300005578 | Ga0068854_100193281 | Ga0068854_1001932812 | 230 |
| 273 | 3300005616 | Ga0068852_100073312 | Ga0068852_1000733122 | 230 |
| 274 | 3300005618 | Ga0068864_100188087 | Ga0068864_1001880872 | 230 |
| 275 | 3300005834 | Ga0068851_10077985 | Ga0068851_100779852 | 230 |
| 276 | 3300005844 | Ga0068862_100003393 | Ga0068862_10000339310 | 230 |
| 277 | 3300006237 | Ga0097621_100019448 | Ga0097621_1000194484 | 230 |
| 278 | 3300006237 | Ga0097621_100041426 | Ga0097621_1000414264 | 230 |
| 279 | 3300006358 | Ga0068871_100021532 | Ga0068871_1000215324 | 230 |
| 280 | 3300006881 | Ga0068865_100001608 | Ga0068865_1000016084 | 230 |
| 281 | 3300006881 | Ga0068865_100024024 | Ga0068865_1000240242 | 230 |
| 282 | 3300009101 | Ga0105247_10065186 | Ga0105247_100651862 | 230 |
| 283 | 3300009177 | Ga0105248_10264538 | Ga0105248_102645382 | 230 |
| 284 | 3300010375 | Ga0105239_10044570 | Ga0105239_100445705 | 230 |
| 285 | 3300013307 | Ga0157372_10769156 | Ga0157372_107691562 | 230 |
| 286 | 3300014968 | Ga0157379_10121875 | Ga0157379_101218752 | 230 |
| 287 | 3300014969 | Ga0157376_10192792 | Ga0157376_101927922 | 230 |
| 288 | 3300025321 | Ga0207656_10064747 | Ga0207656_100647472 | 230 |
| 289 | 3300025925 | Ga0207650_10210393 | Ga0207650_102103932 | 230 |
| 290 | 3300025933 | Ga0207706_10546617 | Ga0207706_105466172 | 230 |
| 291 | 3300025938 | Ga0207704_10006764 | Ga0207704_100067644 | 230 |
| 292 | 3300025938 | Ga0207704_10043584 | Ga0207704_100435842 | 230 |
| 293 | 3300025949 | Ga0207667_10587214 | Ga0207667_105872142 | 230 |
| 294 | 3300025981 | Ga0207640_10263521 | Ga0207640_102635212 | 230 |
| 295 | 3300026023 | Ga0207677_10056240 | Ga0207677_100562404 | 230 |
| 296 | 3300026041 | Ga0207639_10293503 | Ga0207639_102935031 | 230 |
| 297 | 3300026067 | Ga0207678_10007343 | Ga0207678_100073432 | 230 |
| 298 | 3300026088 | Ga0207641_10207147 | Ga0207641_102071472 | 230 |
| 299 | 3300026116 | Ga0207674_10185671 | Ga0207674_101856712 | 230 |
| 300 | 3300026142 | Ga0207698_10257623 | Ga0207698_102576232 | 230 |
| 301 | 3300028379 | Ga0268266_10509144 | Ga0268266_105091442 | 230 |
| 302 | 3300028380 | Ga0268265_10002513 | Ga0268265_100025136 | 230 |
| 303 | 3300028381 | Ga0268264_10576660 | Ga0268264_105766602 | 230 |
| 304 | 3300041512 | Ga0451853_0668608 | Ga0451853_0668608_255_974 | 230 |
| 305 | 3300046694 | Ga0495649_0208095 | Ga0495649_0208095_58_786 | 230 |
| 306 | 3300048928 | Ga0496125_0184775 | Ga0496125_0184775_383_1120 | 230 |
| 307 | 3300049573 | Ga0501037_0050303 | Ga0501037_0050303_826_1530 | 230 |
| 308 | 3300049579 | Ga0501043_0112653 | Ga0501043_0112653_1100_1825 | 230 |
| 309 | 3300049580 | Ga0501046_0018216 | Ga0501046_0018216_694_1386 | 230 |
| 310 | 3300049581 | Ga0501047_0113311 | Ga0501047_0113311_1420_2112 | 230 |
| 311 | 3300049581 | Ga0501047_0213150 | Ga0501047_0213150_734_1438 | 230 |
| 312 | 3300049584 | Ga0501068_0075842 | Ga0501068_0075842_362_1066 | 230 |
| 313 | 3300049586 | Ga0501070_0297784 | Ga0501070_0297784_277_1071 | 230 |
| 314 | 3300049589 | Ga0501073_0072681 | Ga0501073_0072681_20_712 | 230 |
| 315 | 3300049589 | Ga0501073_0111496 | Ga0501073_0111496_903_1607 | 230 |
| 316 | 3300049822 | Ga0501035_0040327 | Ga0501035_0040327_1115_1909 | 230 |
| 317 | 3300049823 | Ga0501044_0014392 | Ga0501044_0014392_1956_2750 | 230 |
| 318 | 3300049823 | Ga0501044_0021034 | Ga0501044_0021034_213_917 | 230 |
| 319 | 3300053079 | Ga0500610_0099479 | Ga0500610_0099479_514_1227 | 230 |
| 320 | 3300053139 | Ga0500568_0020752 | Ga0500568_0020752_190_882 | 230 |
| 321 | 3300054114 | Ga0501084_0137857 | Ga0501084_0137857_1181_1873 | 230 |
| 322 | 3300060353 | Ga0501082_0001180 | Ga0501082_0001180_19796_20488 | 230 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dxz-assembly1.cif.gz_A | crystal structure of ectrmb in complex with sah | 0.941 | 29 | 230 |
| 3dxy-assembly1.cif.gz_A | crystal structure of ectrmb in complex with sam | 0.9191 | 29 | 230 |
| 3dxz-assembly1.cif.gz_A | crystal structure of ectrmb in complex with sah | 0.9184 | 29 | 230 |
| 3dxy-assembly1.cif.gz_A | crystal structure of ectrmb in complex with sam | 0.8934 | 29 | 230 |
| 8eg0-assembly1.cif.gz_A | cryoem structure of human mettl1-wdr4 in complex with lys-trna and sah | 0.8618 | 39 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dxzA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9411 | 29 | 230 | 3.40.50.150 |
| 3dxzA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9184 | 29 | 230 | 3.40.50.150 |
| af_P9WFY9_38_258_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9107 | 23 | 229 | 3.40.50.150 |
| af_Q55EX4_556_743_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8882 | 56 | 229 | 3.40.50.150 |
| af_Q8II90_111_290_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8718 | 57 | 226 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656YE72-F1-model_v4 | deleted | 0.9562 | 23 | 230 |
|
| AF-A0A652ZYK4-F1-model_v4 | deleted | 0.9557 | 22 | 230 |
|
| AF-A0A132MSZ1-F1-model_v4 | tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) | 0.9549 | 22 | 229 |
GO:0008176
GO:0043527 |
| AF-A0A5E6NLH3-F1-model_v4 | tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) | 0.9531 | 46 | 230 |
GO:0008176
GO:0043527 |
| AF-G5LTJ1-F1-model_v4 | tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) | 0.9526 | 38 | 230 |
GO:0008176
GO:0043527 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar