F406616

General Info

Members Datasets Scaffolds Average Seq Length
322 183 644 296

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0019239|Ga0496112_0019239_4845_5873
Length 342
Sequence MNRRAFLESALAFAAVPAAPSRLPIYTSVEYSMLPKTASTSERFQIAKDAGFERIECPTTSDPGEAQKMKDAAAAAGIQIHSVMNMDHWKYPLSSSDPAVVEKSLAGARVSLHNAKLWGADTILLVPAVVNAETSYRDAYTRSQENIRKLIPLAEELKVVVAIEEVWNKFLLSPLEFARYVDEFQSPWIRAYFDVGNVVLYGYPQDWIRTLGPRIAKLHIKDFSWRKMVAKWVPLGEGDIDWHAIYSALQDVGYKGTATVELPAGDAAYLKEVNRRLNAILENRLDSGASKAGGQPACLRARLCSSGSINRVSGCRGISCCRGRQRAVGARSGHRRISAWGR

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
109 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 1.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 2.8
Rhizosphere 92.55
Stem 0
Stem Tuber 0
Unclassified 19.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0019239 3300048915 Bacteria 6441
2 rootH1_10106076 3300003316 Bacteria 2874
3 rootL2_10173269 3300003322 Bacteria 3905
4 Ga0070683_100000051 3300005329 Bacteria 90543
5 Ga0070683_100105191 3300005329 Bacteria 2660
6 Ga0070666_10039695 3300005335 Bacteria 3139
7 Ga0068868_100042025 3300005338 Bacteria 3565
8 Ga0070671_100164070 3300005355 Unclassified 1878
9 Ga0070709_10000417 3300005434 Bacteria 25808
10 Ga0070709_10023957 3300005434 Bacteria 3591
11 Ga0070714_100149090 3300005435 Bacteria 2106
12 Ga0070713_100000316 3300005436 Bacteria 31614
13 Ga0070713_100091465 3300005436 Unclassified 2617
14 Ga0070713_100125487 3300005436 Bacteria 2257
15 Ga0070710_10004432 3300005437 Bacteria 6642
16 Ga0070711_100031177 3300005439 Bacteria 3537
17 Ga0070694_100004965 3300005444 Bacteria 8016
18 Ga0070694_100131289 3300005444 Bacteria 1810
19 Ga0070708_100005327 3300005445 Bacteria 10199
20 Ga0070708_100055313 3300005445 Bacteria 3528
21 Ga0070708_100060421 3300005445 Bacteria 3383
22 Ga0070708_100173709 3300005445 Unclassified 2013
23 Ga0070681_10011582 3300005458 Bacteria 8729
24 Ga0070681_10141108 3300005458 Bacteria 2339
25 Ga0070706_100003825 3300005467 Bacteria 14709
26 Ga0070706_100120391 3300005467 Bacteria 2446
27 Ga0070706_100439541 3300005467 Unclassified 1214
28 Ga0070707_100312074 3300005468 Bacteria 1528
29 Ga0070698_100001572 3300005471 Bacteria 25363
30 Ga0070698_100027119 3300005471 Bacteria 5957
31 Ga0070698_100028501 3300005471 Bacteria 5799
32 Ga0070698_100438316 3300005471 Bacteria 1242
33 Ga0070699_100011904 3300005518 Bacteria 7510
34 Ga0070699_100012241 3300005518 Bacteria 7401
35 Ga0070699_100025851 3300005518 Bacteria 5060
36 Ga0070699_100393534 3300005518 Bacteria 1252
37 Ga0070679_100035469 3300005530 Unclassified 4949
38 Ga0070684_100000061 3300005535 Bacteria 70520
39 Ga0070684_100314023 3300005535 Bacteria 1439
40 Ga0070684_100525613 3300005535 Unclassified 1097
41 Ga0070697_100001676 3300005536 Bacteria 16914
42 Ga0068853_100307776 3300005539 Unclassified 1466
43 Ga0070695_100001267 3300005545 Bacteria 13912
44 Ga0070696_100001671 3300005546 Bacteria 14538
45 Ga0070693_100000068 3300005547 Bacteria 42338
46 Ga0070665_100007998 3300005548 Bacteria 10709
47 Ga0070665_100377366 3300005548 Bacteria 1425
48 Ga0070704_100002599 3300005549 Bacteria 10183
49 Ga0068855_100028432 3300005563 Bacteria 6689
50 Ga0068855_100381000 3300005563 Unclassified 1549
51 Ga0070664_100102427 3300005564 Bacteria 2491
52 Ga0068857_100442407 3300005577 Unclassified 1214
53 Ga0068856_100007620 3300005614 Bacteria 10562
54 Ga0068856_100009808 3300005614 Bacteria 9304
55 Ga0068856_100098924 3300005614 Bacteria 2908
56 Ga0068859_100294487 3300005617 Bacteria 1716
57 Ga0068866_10012364 3300005718 Bacteria 3718
58 Ga0068866_10082896 3300005718 Unclassified 1726
59 Ga0068863_100245137 3300005841 Unclassified 1730
60 Ga0068863_100525097 3300005841 Unclassified 1167
61 Ga0068858_100361552 3300005842 Unclassified 1391
62 Ga0068860_100016889 3300005843 Bacteria 7115
63 Ga0068860_100085506 3300005843 Unclassified 3001
64 Ga0081455_10035996 3300005937 Unclassified 4414
65 Ga0070717_10264136 3300006028 Bacteria 1523
66 Ga0070715_10085726 3300006163 Bacteria 1439
67 Ga0070715_10093621 3300006163 Bacteria 1388
68 Ga0070716_100007938 3300006173 Bacteria 5254
69 Ga0070716_100042815 3300006173 Bacteria 2529
70 Ga0070716_100064147 3300006173 Bacteria 2135
71 Ga0070716_100126683 3300006173 Bacteria 1607
72 Ga0070712_100029123 3300006175 Unclassified 3700
73 Ga0070712_100044403 3300006175 Unclassified 3064
74 Ga0070712_100071650 3300006175 Bacteria 2480
75 Ga0070712_100153244 3300006175 Bacteria 1772
76 Ga0070712_100176655 3300006175 Bacteria 1661
77 Ga0070712_100390696 3300006175 Bacteria 1147
78 Ga0097621_100000256 3300006237 Bacteria 35916
79 Ga0097621_100057715 3300006237 Bacteria 3176
80 Ga0068871_100000923 3300006358 Bacteria 19609
81 Ga0068871_100007056 3300006358 Bacteria 8006
82 Ga0075431_100116261 3300006847 Bacteria 2761
83 Ga0075433_10131948 3300006852 Bacteria 2219
84 Ga0075434_100001119 3300006871 Bacteria 22021
85 Ga0075434_100001926 3300006871 Bacteria 17999
86 Ga0075434_100003766 3300006871 Bacteria 13549
87 Ga0075434_100036287 3300006871 Bacteria 4876
88 Ga0075434_100214573 3300006871 Bacteria 1944
89 Ga0075436_100001245 3300006914 Bacteria 17312
90 Ga0075436_100005421 3300006914 Bacteria 8777
91 Ga0075436_100089869 3300006914 Bacteria 2135
92 Ga0075436_100271701 3300006914 Bacteria 1211
93 Ga0097620_100294465 3300006931 Bacteria 1716
94 Ga0075435_100001019 3300007076 Bacteria 17756
95 Ga0075435_100022811 3300007076 Bacteria 4832
96 Ga0075435_100104692 3300007076 Unclassified 2348
97 Ga0099794_10000115 3300007265 Bacteria 29217
98 Ga0099794_10003722 3300007265 Bacteria 5868
99 Ga0099794_10004577 3300007265 Bacteria 5454
100 Ga0099794_10012622 3300007265 Bacteria 3652
101 Ga0099794_10016708 3300007265 Bacteria 3259
102 Ga0099794_10022467 3300007265 Unclassified 2876
103 Ga0099794_10023379 3300007265 Bacteria 2826
104 Ga0105240_10002365 3300009093 Bacteria 30413
105 Ga0105240_10002638 3300009093 Bacteria 28568
106 Ga0105240_10019042 3300009093 Bacteria 9181
107 Ga0114129_10028846 3300009147 Bacteria 7863
108 Ga0105241_10277507 3300009174 Bacteria 1430
109 Ga0105248_10096754 3300009177 Bacteria 3326
110 Ga0105248_10491262 3300009177 Bacteria 1384
111 Ga0105237_10002199 3300009545 Bacteria 24431
112 Ga0105237_10309117 3300009545 Unclassified 1584
113 Ga0105249_10020347 3300009553 Bacteria 5933
114 Ga0105239_10031868 3300010375 Bacteria 5792
115 Ga0157373_10037671 3300013100 Bacteria 3466
116 Ga0157371_10035196 3300013102 Bacteria 3589
117 Ga0157370_10056347 3300013104 Bacteria 3741
118 Ga0157370_10707923 3300013104 Bacteria 919
119 Ga0157369_10053337 3300013105 Bacteria 4371
120 Ga0157369_10069370 3300013105 Bacteria 3787
121 Ga0157369_10357710 3300013105 Bacteria 1516
122 Ga0157374_10007128 3300013296 Bacteria 9522
123 Ga0157374_10020290 3300013296 Bacteria 5895
124 Ga0157374_10277944 3300013296 Unclassified 1653
125 Ga0157374_10354554 3300013296 Unclassified 1458
126 Ga0157378_10001504 3300013297 Bacteria 21099
127 Ga0157378_10013380 3300013297 Bacteria 7170
128 Ga0157378_10654566 3300013297 Unclassified 1066
129 Ga0157372_10136132 3300013307 Bacteria 2829
130 Ga0157372_10367834 3300013307 Bacteria 1675
131 Ga0157375_10138848 3300013308 Bacteria 2556
132 Ga0157380_10167799 3300014326 Bacteria 1914
133 Ga0157379_10011942 3300014968 Bacteria 7588
134 Ga0157379_10021375 3300014968 Bacteria 5727
135 Ga0157379_10355140 3300014968 Bacteria 1342
136 Ga0157376_10000037 3300014969 Bacteria 138129
137 Ga0157376_10356409 3300014969 Bacteria 1402
138 Ga0213874_10001763 3300021377 Unclassified 4548
139 Ga0213876_10009797 3300021384 Bacteria 5155
140 Ga0207426_1034272 3300025302 Bacteria 1630
141 Ga0207653_10004008 3300025885 Bacteria 4631
142 Ga0207647_10068847 3300025904 Bacteria 2141
143 Ga0207685_10070521 3300025905 Bacteria 1415
144 Ga0207699_10003799 3300025906 Bacteria 7204
145 Ga0207699_10013247 3300025906 Bacteria 4216
146 Ga0207684_10010907 3300025910 Bacteria 7968
147 Ga0207684_10023326 3300025910 Bacteria 5283
148 Ga0207707_10028419 3300025912 Bacteria 4888
149 Ga0207695_10020343 3300025913 Bacteria 7606
150 Ga0207695_10022367 3300025913 Bacteria 7178
151 Ga0207695_10030942 3300025913 Bacteria 5884
152 Ga0207671_10005076 3300025914 Bacteria 12297
153 Ga0207671_10280817 3300025914 Unclassified 1313
154 Ga0207693_10031208 3300025915 Unclassified 4210
155 Ga0207693_10228153 3300025915 Bacteria 1462
156 Ga0207693_10302857 3300025915 Unclassified 1252
157 Ga0207663_10024194 3300025916 Bacteria 3496
158 Ga0207660_10243353 3300025917 Bacteria 1418
159 Ga0207652_10041102 3300025921 Unclassified 3929
160 Ga0207646_10001837 3300025922 Bacteria 25647
161 Ga0207646_10264640 3300025922 Unclassified 1554
162 Ga0207687_10010098 3300025927 Bacteria 6173
163 Ga0207687_10517684 3300025927 Unclassified 997
164 Ga0207700_10000324 3300025928 Bacteria 28112
165 Ga0207700_10065873 3300025928 Bacteria 2766
166 Ga0207664_10286723 3300025929 Bacteria 1446
167 Ga0207706_10297185 3300025933 Unclassified 1407
168 Ga0207670_10162082 3300025936 Bacteria 1670
169 Ga0207665_10000103 3300025939 Bacteria 55197
170 Ga0207665_10002955 3300025939 Bacteria 11389
171 Ga0207665_10003590 3300025939 Bacteria 10360
172 Ga0207665_10009604 3300025939 Bacteria 6354
173 Ga0207665_10091903 3300025939 Bacteria 2105
174 Ga0207711_10168371 3300025941 Bacteria 1987
175 Ga0207711_10425067 3300025941 Bacteria 1236
176 Ga0207661_10000046 3300025944 Bacteria 107171
177 Ga0207661_10009930 3300025944 Bacteria 6836
178 Ga0207679_10007059 3300025945 Bacteria 7122
179 Ga0207667_10025285 3300025949 Bacteria 6502
180 Ga0207667_10106565 3300025949 Bacteria 2891
181 Ga0207658_10153901 3300025986 Unclassified 1877
182 Ga0207677_10010673 3300026023 Bacteria 5205
183 Ga0207703_10299147 3300026035 Unclassified 1467
184 Ga0207639_10035345 3300026041 Bacteria 3697
185 Ga0207708_10248841 3300026075 Bacteria 1432
186 Ga0207702_10017273 3300026078 Bacteria 5971
187 Ga0207702_10030093 3300026078 Bacteria 4523
188 Ga0207702_10072983 3300026078 Bacteria 2958
189 Ga0207641_10016285 3300026088 Bacteria 6088
190 Ga0207641_10151995 3300026088 Bacteria 2097
191 Ga0207641_10355958 3300026088 Bacteria 1396
192 Ga0207698_10514997 3300026142 Bacteria 1166
193 Ga0209588_1001192 3300027671 Bacteria 6722
194 Ga0209588_1001322 3300027671 Bacteria 6440
195 Ga0209588_1001383 3300027671 Bacteria 6317
196 Ga0209588_1006475 3300027671 Bacteria 3404
197 Ga0265354_1003366 3300028016 Unclassified 1798
198 Ga0268266_10272984 3300028379 Bacteria 1570
199 Ga0268264_10068408 3300028381 Unclassified 3001
200 Ga0268264_10074878 3300028381 Unclassified 2877
201 Ga0265318_10089294 3300028577 Bacteria 1135
202 Ga0265770_1000995 3300030878 Bacteria 3917
203 Ga0265770_1002387 3300030878 Bacteria 2551
204 Ga0265760_10004709 3300031090 Unclassified 3907
205 Ga0265760_10010090 3300031090 Bacteria 2694
206 Ga0265332_10137997 3300031238 Unclassified 1022
207 Ga0265328_10040795 3300031239 Bacteria 1710
208 Ga0265320_10013269 3300031240 Bacteria 4745
209 Ga0265340_10009252 3300031247 Bacteria 5291
210 Ga0307510_10077639 3300033180 Bacteria 3255
211 Ga0373953_0049389 3300035117 Unclassified 1697
212 Ga0373955_0157360 3300035172 Bacteria 1339
213 Ga0373935_0287558 3300035692 Bacteria 1159
214 Ga0373927_0000477 3300035695 Bacteria 30769
215 Ga0373927_0001128 3300035695 Bacteria 20226
216 Ga0373927_0033171 3300035695 Bacteria 3362
217 Ga0373947_0000489 3300035725 Bacteria 22810
218 Ga0373937_0128855 3300036401 Unclassified 2362
219 Ga0373925_0001134 3300037068 Bacteria 23644
220 Ga0373925_0278322 3300037068 Bacteria 1347
221 Ga0436364_0725518 3300037853 Unclassified 1873
222 Ga0436364_1079525 3300037853 Bacteria 1540
223 Ga0436365_0146143 3300039437 Bacteria 3300
224 Ga0436365_0751870 3300039437 Bacteria 7272
225 Ga0436363_1474479 3300039450 Bacteria 2396
226 Ga0436362_0265598 3300039453 Unclassified 3664
227 Ga0453683_0001195 3300044673 Bacteria 23385
228 Ga0453683_0025930 3300044673 Bacteria 3722
229 Ga0466966_0053685 3300044684 Bacteria 2556
230 Ga0466963_0303022 3300044694 Unclassified 1124
231 Ga0466964_0033632 3300044706 Bacteria 2043
232 Ga0466957_0097545 3300044842 Bacteria 1849
233 Ga0451576_0041762 3300045051 Bacteria 4847
234 Ga0466967_0162415 3300045976 Bacteria 2098
235 Ga0495651_0067919 3300046462 Unclassified 2718
236 Ga0495651_0170302 3300046462 Bacteria 1551
237 Ga0495580_0001214 3300046472 Bacteria 22691
238 Ga0495580_0055162 3300046472 Bacteria 2801
239 Ga0495582_0000422 3300046473 Bacteria 23091
240 Ga0495582_0173317 3300046473 Bacteria 1228
241 Ga0495664_0000975 3300046477 Bacteria 14732
242 Ga0495664_0056930 3300046477 Bacteria 2326
243 Ga0495594_0135362 3300046499 Bacteria 1396
244 Ga0495606_0063758 3300046507 Bacteria 2348
245 Ga0495608_0086427 3300046511 Unclassified 2032
246 Ga0495628_0030458 3300046516 Unclassified 4368
247 Ga0495628_0102272 3300046516 Bacteria 2211
248 Ga0495628_0127295 3300046516 Unclassified 1950
249 Ga0495643_0034931 3300046522 Bacteria 2770
250 Ga0495652_0049370 3300046529 Unclassified 3603
251 Ga0495665_0037476 3300046531 Bacteria 2588
252 Ga0495665_0049273 3300046531 Bacteria 2234
253 Ga0495665_0099482 3300046531 Bacteria 1527
254 Ga0495640_0098340 3300046533 Unclassified 1923
255 Ga0495640_0108156 3300046533 Bacteria 1819
256 Ga0495587_0014972 3300046536 Bacteria 4851
257 Ga0495587_0153340 3300046536 Unclassified 1313
258 Ga0495587_0187753 3300046536 Bacteria 1171
259 Ga0495645_0059992 3300046543 Bacteria 2758
260 Ga0495645_0186969 3300046543 Bacteria 1415
261 Ga0495667_0124692 3300046559 Unclassified 1662
262 Ga0495634_0136375 3300046642 Bacteria 1561
263 Ga0495625_0045135 3300046660 Bacteria 3188
264 Ga0495635_0288473 3300046663 Unclassified 1102
265 Ga0495599_0014222 3300046678 Bacteria 4927
266 Ga0495599_0067810 3300046678 Unclassified 2228
267 Ga0495623_0007694 3300046679 Bacteria 7002
268 Ga0495623_0047535 3300046679 Unclassified 2724
269 Ga0495646_0093482 3300046680 Unclassified 1733
270 Ga0495658_0005682 3300046683 Bacteria 6127
271 Ga0495613_0023869 3300046689 Bacteria 4557
272 Ga0495613_0094732 3300046689 Unclassified 2160
273 Ga0495624_0077763 3300046690 Bacteria 2058
274 Ga0495649_0043065 3300046694 Bacteria 2465
275 Ga0495604_0049035 3300047317 Unclassified 3283
276 Ga0495604_0090308 3300047317 Bacteria 2275
277 Ga0495604_0111427 3300047317 Bacteria 1995
278 Ga0495636_0095301 3300047318 Bacteria 1296
279 Ga0495674_0027099 3300047319 Bacteria 5240
280 Ga0495674_0030973 3300047319 Bacteria 4861
281 Ga0495674_0076609 3300047319 Bacteria 2876
282 Ga0495680_0245877 3300047322 Bacteria 1269
283 Ga0495684_0012821 3300047471 Bacteria 6469
284 Ga0495684_0045335 3300047471 Bacteria 3365
285 Ga0495684_0146463 3300047471 Bacteria 1768
286 Ga0495684_0214571 3300047471 Bacteria 1413
287 Ga0495686_0000035 3300047472 Bacteria 314930
288 Ga0495686_0003747 3300047472 Bacteria 12937
289 Ga0495593_0123022 3300047673 Bacteria 1320
290 Ga0495602_0026733 3300048088 Bacteria 5561
291 Ga0495614_0052045 3300048089 Bacteria 1755
292 Ga0496102_0027794 3300048905 Bacteria 5052
293 Ga0496104_0000049 3300048907 Bacteria 144754
294 Ga0496104_0593317 3300048907 Bacteria 1018
295 Ga0496110_0275185 3300048913 Unclassified 1533
296 Ga0496112_0384070 3300048915 Bacteria 1345
297 Ga0496114_0013056 3300048917 Bacteria 6656
298 Ga0496115_0012289 3300048918 Bacteria 6439
299 Ga0496115_0042899 3300048918 Bacteria 3605
300 Ga0496126_0001109 3300048929 Bacteria 45150
301 nmdc:mga05p37_258712_c1 3300050507 Unclassified 2084
302 nmdc:mga06r32_37659_c1 3300050510 Bacteria 4575
303 nmdc:mga0n895_135131_c1 3300050512 Bacteria 2493
304 nmdc:mga0n895_135_c1 3300050512 Bacteria 44252
305 nmdc:mga0n895_24066_c1 3300050512 Bacteria 5734
306 nmdc:mga0n895_458516_c1 3300050512 Bacteria 1287
307 nmdc:mga0n895_465_c1 3300050512 Bacteria 27165
308 nmdc:mga0n895_62092_c1 3300050512 Bacteria 3691
309 nmdc:mga0n895_68098_c1 3300050512 Unclassified 3526
310 nmdc:mga0rr50_760_c1 3300050513 Bacteria 17335
311 nmdc:mga08x19_117788_c1 3300050514 Bacteria 1777
312 nmdc:mga08x19_12924_c1 3300050514 Bacteria 5039
313 nmdc:mga08x19_13094_c1 3300050514 Bacteria 5009
314 nmdc:mga08x19_29658_c1 3300050514 Unclassified 3432
315 nmdc:mga08x19_75012_c1 3300050514 Unclassified 2210
316 nmdc:mga0a205_11079_c1 3300050515 Bacteria 5690
317 nmdc:mga0a205_150266_c1 3300050515 Unclassified 2229
318 nmdc:mga0a205_20354_c1 3300050515 Bacteria 6258
319 Ga0500651_0000083 3300053093 Bacteria 60234
320 Ga0500595_000012 3300053119 Bacteria 255472
321 Ga0500661_002406 3300055283 Bacteria 3534
322 Ga0501082_0001682 3300060353 Bacteria 19505
323 Ga0496112_0019239
324 rootH1_10106076
325 rootL2_10173269
326 Ga0070683_100000051
327 Ga0070683_100105191
328 Ga0070666_10039695
329 Ga0068868_100042025
330 Ga0070671_100164070
331 Ga0070709_10000417
332 Ga0070709_10023957
333 Ga0070714_100149090
334 Ga0070713_100000316
335 Ga0070713_100091465
336 Ga0070713_100125487
337 Ga0070710_10004432
338 Ga0070711_100031177
339 Ga0070694_100004965
340 Ga0070694_100131289
341 Ga0070708_100005327
342 Ga0070708_100055313
343 Ga0070708_100060421
344 Ga0070708_100173709
345 Ga0070681_10011582
346 Ga0070681_10141108
347 Ga0070706_100003825
348 Ga0070706_100120391
349 Ga0070706_100439541
350 Ga0070707_100312074
351 Ga0070698_100001572
352 Ga0070698_100027119
353 Ga0070698_100028501
354 Ga0070698_100438316
355 Ga0070699_100011904
356 Ga0070699_100012241
357 Ga0070699_100025851
358 Ga0070699_100393534
359 Ga0070679_100035469
360 Ga0070684_100000061
361 Ga0070684_100314023
362 Ga0070684_100525613
363 Ga0070697_100001676
364 Ga0068853_100307776
365 Ga0070695_100001267
366 Ga0070696_100001671
367 Ga0070693_100000068
368 Ga0070665_100007998
369 Ga0070665_100377366
370 Ga0070704_100002599
371 Ga0068855_100028432
372 Ga0068855_100381000
373 Ga0070664_100102427
374 Ga0068857_100442407
375 Ga0068856_100007620
376 Ga0068856_100009808
377 Ga0068856_100098924
378 Ga0068859_100294487
379 Ga0068866_10012364
380 Ga0068866_10082896
381 Ga0068863_100245137
382 Ga0068863_100525097
383 Ga0068858_100361552
384 Ga0068860_100016889
385 Ga0068860_100085506
386 Ga0081455_10035996
387 Ga0070717_10264136
388 Ga0070715_10085726
389 Ga0070715_10093621
390 Ga0070716_100007938
391 Ga0070716_100042815
392 Ga0070716_100064147
393 Ga0070716_100126683
394 Ga0070712_100029123
395 Ga0070712_100044403
396 Ga0070712_100071650
397 Ga0070712_100153244
398 Ga0070712_100176655
399 Ga0070712_100390696
400 Ga0097621_100000256
401 Ga0097621_100057715
402 Ga0068871_100000923
403 Ga0068871_100007056
404 Ga0075431_100116261
405 Ga0075433_10131948
406 Ga0075434_100001119
407 Ga0075434_100001926
408 Ga0075434_100003766
409 Ga0075434_100036287
410 Ga0075434_100214573
411 Ga0075436_100001245
412 Ga0075436_100005421
413 Ga0075436_100089869
414 Ga0075436_100271701
415 Ga0097620_100294465
416 Ga0075435_100001019
417 Ga0075435_100022811
418 Ga0075435_100104692
419 Ga0099794_10000115
420 Ga0099794_10003722
421 Ga0099794_10004577
422 Ga0099794_10012622
423 Ga0099794_10016708
424 Ga0099794_10022467
425 Ga0099794_10023379
426 Ga0105240_10002365
427 Ga0105240_10002638
428 Ga0105240_10019042
429 Ga0114129_10028846
430 Ga0105241_10277507
431 Ga0105248_10096754
432 Ga0105248_10491262
433 Ga0105237_10002199
434 Ga0105237_10309117
435 Ga0105249_10020347
436 Ga0105239_10031868
437 Ga0157373_10037671
438 Ga0157371_10035196
439 Ga0157370_10056347
440 Ga0157370_10707923
441 Ga0157369_10053337
442 Ga0157369_10069370
443 Ga0157369_10357710
444 Ga0157374_10007128
445 Ga0157374_10020290
446 Ga0157374_10277944
447 Ga0157374_10354554
448 Ga0157378_10001504
449 Ga0157378_10013380
450 Ga0157378_10654566
451 Ga0157372_10136132
452 Ga0157372_10367834
453 Ga0157375_10138848
454 Ga0157380_10167799
455 Ga0157379_10011942
456 Ga0157379_10021375
457 Ga0157379_10355140
458 Ga0157376_10000037
459 Ga0157376_10356409
460 Ga0213874_10001763
461 Ga0213876_10009797
462 Ga0207426_1034272
463 Ga0207653_10004008
464 Ga0207647_10068847
465 Ga0207685_10070521
466 Ga0207699_10003799
467 Ga0207699_10013247
468 Ga0207684_10010907
469 Ga0207684_10023326
470 Ga0207707_10028419
471 Ga0207695_10020343
472 Ga0207695_10022367
473 Ga0207695_10030942
474 Ga0207671_10005076
475 Ga0207671_10280817
476 Ga0207693_10031208
477 Ga0207693_10228153
478 Ga0207693_10302857
479 Ga0207663_10024194
480 Ga0207660_10243353
481 Ga0207652_10041102
482 Ga0207646_10001837
483 Ga0207646_10264640
484 Ga0207687_10010098
485 Ga0207687_10517684
486 Ga0207700_10000324
487 Ga0207700_10065873
488 Ga0207664_10286723
489 Ga0207706_10297185
490 Ga0207670_10162082
491 Ga0207665_10000103
492 Ga0207665_10002955
493 Ga0207665_10003590
494 Ga0207665_10009604
495 Ga0207665_10091903
496 Ga0207711_10168371
497 Ga0207711_10425067
498 Ga0207661_10000046
499 Ga0207661_10009930
500 Ga0207679_10007059
501 Ga0207667_10025285
502 Ga0207667_10106565
503 Ga0207658_10153901
504 Ga0207677_10010673
505 Ga0207703_10299147
506 Ga0207639_10035345
507 Ga0207708_10248841
508 Ga0207702_10017273
509 Ga0207702_10030093
510 Ga0207702_10072983
511 Ga0207641_10016285
512 Ga0207641_10151995
513 Ga0207641_10355958
514 Ga0207698_10514997
515 Ga0209588_1001192
516 Ga0209588_1001322
517 Ga0209588_1001383
518 Ga0209588_1006475
519 Ga0265354_1003366
520 Ga0268266_10272984
521 Ga0268264_10068408
522 Ga0268264_10074878
523 Ga0265318_10089294
524 Ga0265770_1000995
525 Ga0265770_1002387
526 Ga0265760_10004709
527 Ga0265760_10010090
528 Ga0265332_10137997
529 Ga0265328_10040795
530 Ga0265320_10013269
531 Ga0265340_10009252
532 Ga0307510_10077639
533 Ga0373953_0049389
534 Ga0373955_0157360
535 Ga0373935_0287558
536 Ga0373927_0000477
537 Ga0373927_0001128
538 Ga0373927_0033171
539 Ga0373947_0000489
540 Ga0373937_0128855
541 Ga0373925_0001134
542 Ga0373925_0278322
543 Ga0436364_0725518
544 Ga0436364_1079525
545 Ga0436365_0146143
546 Ga0436365_0751870
547 Ga0436363_1474479
548 Ga0436362_0265598
549 Ga0453683_0001195
550 Ga0453683_0025930
551 Ga0466966_0053685
552 Ga0466963_0303022
553 Ga0466964_0033632
554 Ga0466957_0097545
555 Ga0451576_0041762
556 Ga0466967_0162415
557 Ga0495651_0067919
558 Ga0495651_0170302
559 Ga0495580_0001214
560 Ga0495580_0055162
561 Ga0495582_0000422
562 Ga0495582_0173317
563 Ga0495664_0000975
564 Ga0495664_0056930
565 Ga0495594_0135362
566 Ga0495606_0063758
567 Ga0495608_0086427
568 Ga0495628_0030458
569 Ga0495628_0102272
570 Ga0495628_0127295
571 Ga0495643_0034931
572 Ga0495652_0049370
573 Ga0495665_0037476
574 Ga0495665_0049273
575 Ga0495665_0099482
576 Ga0495640_0098340
577 Ga0495640_0108156
578 Ga0495587_0014972
579 Ga0495587_0153340
580 Ga0495587_0187753
581 Ga0495645_0059992
582 Ga0495645_0186969
583 Ga0495667_0124692
584 Ga0495634_0136375
585 Ga0495625_0045135
586 Ga0495635_0288473
587 Ga0495599_0014222
588 Ga0495599_0067810
589 Ga0495623_0007694
590 Ga0495623_0047535
591 Ga0495646_0093482
592 Ga0495658_0005682
593 Ga0495613_0023869
594 Ga0495613_0094732
595 Ga0495624_0077763
596 Ga0495649_0043065
597 Ga0495604_0049035
598 Ga0495604_0090308
599 Ga0495604_0111427
600 Ga0495636_0095301
601 Ga0495674_0027099
602 Ga0495674_0030973
603 Ga0495674_0076609
604 Ga0495680_0245877
605 Ga0495684_0012821
606 Ga0495684_0045335
607 Ga0495684_0146463
608 Ga0495684_0214571
609 Ga0495686_0000035
610 Ga0495686_0003747
611 Ga0495593_0123022
612 Ga0495602_0026733
613 Ga0495614_0052045
614 Ga0496102_0027794
615 Ga0496104_0000049
616 Ga0496104_0593317
617 Ga0496110_0275185
618 Ga0496112_0384070
619 Ga0496114_0013056
620 Ga0496115_0012289
621 Ga0496115_0042899
622 Ga0496126_0001109
623 nmdc:mga05p37_258712_c1
624 nmdc:mga06r32_37659_c1
625 nmdc:mga0n895_135131_c1
626 nmdc:mga0n895_135_c1
627 nmdc:mga0n895_24066_c1
628 nmdc:mga0n895_458516_c1
629 nmdc:mga0n895_465_c1
630 nmdc:mga0n895_62092_c1
631 nmdc:mga0n895_68098_c1
632 nmdc:mga0rr50_760_c1
633 nmdc:mga08x19_117788_c1
634 nmdc:mga08x19_12924_c1
635 nmdc:mga08x19_13094_c1
636 nmdc:mga08x19_29658_c1
637 nmdc:mga08x19_75012_c1
638 nmdc:mga0a205_11079_c1
639 nmdc:mga0a205_150266_c1
640 nmdc:mga0a205_20354_c1
641 Ga0500651_0000083
642 Ga0500595_000012
643 Ga0500661_002406
644 Ga0501082_0001682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

44

280

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqk-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ and sulfate 0.8534 30 295
3cqj-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ 0.849 30 295
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.8264 30 291
2zvr-assembly1.cif.gz_B crystal structure of a d-tagatose 3-epimerase-related protein from thermotoga maritima 0.8243 30 292
3cqk-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ and sulfate 0.8214 30 295
ID Description Score Start End Superfamily
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.839 30 291 3.20.20.150
af_Q59009_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8317 30 292 3.20.20.150
5h1wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8278 30 292 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.827 30 291 3.20.20.150
af_Q59009_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8257 30 292 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V8TZH8-F1-model_v4 Xylose isomerase 0.9905 38 295 GO:0016853
AF-A0A2V8TZH8-F1-model_v4 Xylose isomerase 0.9866 38 295 GO:0016853
AF-A0A2V9IX19-F1-model_v4 Xylose isomerase 0.9706 67 294 GO:0016853
AF-A0A3D1ADN0-F1-model_v4 Xylose isomerase 0.9694 107 229 GO:0016853
AF-A0A3N5UL74-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9577 38 217 GO:0016853

Map