F406419

General Info

Members Datasets Scaffolds Average Seq Length
322 246 322 189

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10105103|Ga0105240_101051033
Length 213
Sequence MATQITEMSVERTAIEGLLICTLKQARDERGSVREFFRASSYAEALPGVAGWRQINVTESGHGTVRGLHGEDMVKLVSCIAGRAFGAYLDARPDSASYGEVVTVQLSPGVQVLVPAGVCNGFQSLSPEGTQYLYCFTAEWQPGMAGVAYTPLDEGLGIEWPLPIDPDDPASISAKDAAAPRFSEQRQPGQRADGSERIGDPPSGRFDQASAKG

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
142 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
143 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
147 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
243 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 6.52
Rhizosphere 91.3
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10009460 3300002067 Bacteria 3129
2 Ga0070658_10071518 3300005327 Bacteria 2841
3 Ga0070683_100001990 3300005329 Bacteria 16022
4 Ga0070690_100422658 3300005330 Bacteria 983
5 Ga0068869_100067973 3300005334 Bacteria 2630
6 Ga0070666_10111288 3300005335 Bacteria 1894
7 Ga0070682_100147129 3300005337 Bacteria 1612
8 Ga0068868_100147655 3300005338 Bacteria 1934
9 Ga0070660_100061536 3300005339 Bacteria 2915
10 Ga0070689_100114137 3300005340 Bacteria 2152
11 Ga0070691_10098332 3300005341 Bacteria 1451
12 Ga0070687_100014382 3300005343 Bacteria 3555
13 Ga0070661_100073333 3300005344 Bacteria 2520
14 Ga0070692_10047139 3300005345 Bacteria 2230
15 Ga0070668_100002350 3300005347 Bacteria 13899
16 Ga0070668_100625149 3300005347 Bacteria 944
17 Ga0070671_100064915 3300005355 Bacteria 3041
18 Ga0070674_100072157 3300005356 Bacteria 2444
19 Ga0070674_100394318 3300005356 Bacteria 1129
20 Ga0070688_100163135 3300005365 Bacteria 1532
21 Ga0070659_100009179 3300005366 Bacteria 7256
22 Ga0070659_100839448 3300005366 Unclassified 800
23 Ga0070709_10003782 3300005434 Bacteria 8136
24 Ga0070714_100000012 3300005435 Bacteria 226258
25 Ga0070714_100657837 3300005435 Bacteria 1009
26 Ga0070713_100101600 3300005436 Bacteria 2491
27 Ga0070711_100047999 3300005439 Bacteria 2917
28 Ga0070700_100000004 3300005441 Bacteria 245987
29 Ga0070700_100037396 3300005441 Bacteria 2951
30 Ga0070700_100093050 3300005441 Bacteria 1971
31 Ga0070694_100120672 3300005444 Bacteria 1881
32 Ga0070663_100015984 3300005455 Bacteria 4859
33 Ga0070678_100022457 3300005456 Bacteria 4182
34 Ga0070678_100239398 3300005456 Bacteria 1517
35 Ga0070681_10140607 3300005458 Bacteria 2344
36 Ga0068867_100048732 3300005459 Bacteria 3118
37 Ga0070707_100466207 3300005468 Bacteria 1224
38 Ga0070679_100450807 3300005530 Unclassified 1231
39 Ga0070684_100019282 3300005535 Bacteria 5639
40 Ga0068853_100272228 3300005539 Bacteria 1560
41 Ga0070686_100021267 3300005544 Bacteria 3854
42 Ga0070686_100644369 3300005544 Bacteria 839
43 Ga0070695_100074967 3300005545 Bacteria 2224
44 Ga0070696_100858564 3300005546 Bacteria 751
45 Ga0068855_100032990 3300005563 Bacteria 6181
46 Ga0070664_100036258 3300005564 Bacteria 4143
47 Ga0070664_100145496 3300005564 Bacteria 2090
48 Ga0068854_100092132 3300005578 Bacteria 2257
49 Ga0068856_100076963 3300005614 Bacteria 3305
50 Ga0068856_100160290 3300005614 Bacteria 2260
51 Ga0070702_100097507 3300005615 Bacteria 1796
52 Ga0068859_100154921 3300005617 Bacteria 2368
53 Ga0068864_100327767 3300005618 Bacteria 1439
54 Ga0068866_10090186 3300005718 Bacteria 1667
55 Ga0068861_100042584 3300005719 Bacteria 3404
56 Ga0068861_100352295 3300005719 Bacteria 1292
57 Ga0068860_100177185 3300005843 Bacteria 2060
58 Ga0081455_10004489 3300005937 Bacteria 15615
59 Ga0081455_10043930 3300005937 Bacteria 3904
60 Ga0081540_1000660 3300005983 Bacteria 32489
61 Ga0070715_10102569 3300006163 Bacteria 1337
62 Ga0070716_100038787 3300006173 Bacteria 2640
63 Ga0075431_100132633 3300006847 Bacteria 2569
64 Ga0075433_10006735 3300006852 Bacteria 9103
65 Ga0075434_100034366 3300006871 Bacteria 5006
66 Ga0075434_100164389 3300006871 Bacteria 2239
67 Ga0075434_100482990 3300006871 Bacteria 1260
68 Ga0068865_100092949 3300006881 Bacteria 2192
69 Ga0075436_100036144 3300006914 Bacteria 3409
70 Ga0097620_100154922 3300006931 Bacteria 2368
71 Ga0075435_100055299 3300007076 Bacteria 3205
72 Ga0075435_100097382 3300007076 Bacteria 2434
73 Ga0075435_100122947 3300007076 Bacteria 2167
74 Ga0105251_10123713 3300009011 Bacteria 1174
75 Ga0105240_10105103 3300009093 Bacteria 3428
76 Ga0105240_10256403 3300009093 Bacteria 2020
77 Ga0105240_10304960 3300009093 Bacteria 1821
78 Ga0111539_10009383 3300009094 Bacteria 12352
79 Ga0105245_10004607 3300009098 Bacteria 12175
80 Ga0105245_10050481 3300009098 Bacteria 3728
81 Ga0105245_10528743 3300009098 Bacteria 1199
82 Ga0105245_10607117 3300009098 Bacteria 1121
83 Ga0105247_10013995 3300009101 Bacteria 4812
84 Ga0114129_11098264 3300009147 Bacteria 996
85 Ga0114129_11768165 3300009147 Bacteria 753
86 Ga0105243_10016143 3300009148 Bacteria 5648
87 Ga0105241_10099076 3300009174 Bacteria 2314
88 Ga0105242_10026710 3300009176 Bacteria 4577
89 Ga0105242_10033209 3300009176 Bacteria 4131
90 Ga0105248_10112125 3300009177 Bacteria 3076
91 Ga0105248_10177807 3300009177 Bacteria 2398
92 Ga0105237_10191864 3300009545 Bacteria 2043
93 Ga0105237_11300181 3300009545 Bacteria 734
94 Ga0105238_10017998 3300009551 Bacteria 7183
95 Ga0105249_10002302 3300009553 Bacteria 16593
96 Ga0105249_10479439 3300009553 Bacteria 1287
97 Ga0105246_10009429 3300011119 Bacteria 6015
98 Ga0157371_10072277 3300013102 Bacteria 2443
99 Ga0157369_10040599 3300013105 Bacteria 5079
100 Ga0157374_11026778 3300013296 Bacteria 844
101 Ga0157378_10093806 3300013297 Bacteria 2733
102 Ga0163162_10233036 3300013306 Bacteria 1972
103 Ga0157372_10324488 3300013307 Bacteria 1793
104 Ga0163163_10122961 3300014325 Bacteria 2630
105 Ga0157380_10087551 3300014326 Bacteria 2561
106 Ga0157377_10044101 3300014745 Bacteria 2485
107 Ga0157379_10249975 3300014968 Bacteria 1609
108 Ga0157376_10043935 3300014969 Bacteria 3670
109 Ga0163161_10518548 3300017792 Bacteria 973
110 Ga0197907_10286187 3300020069 Bacteria 2150
111 Ga0206353_11130394 3300020082 Bacteria 1261
112 Ga0213876_10442626 3300021384 Bacteria 691
113 Ga0207692_10019489 3300025898 Bacteria 3067
114 Ga0207642_10186674 3300025899 Bacteria 1134
115 Ga0207688_10001305 3300025901 Bacteria 12940
116 Ga0207680_10017574 3300025903 Bacteria 3782
117 Ga0207647_10015790 3300025904 Bacteria 5167
118 Ga0207685_10212495 3300025905 Bacteria 915
119 Ga0207705_10356069 3300025909 Bacteria 1128
120 Ga0207684_10578730 3300025910 Bacteria 960
121 Ga0207707_10226031 3300025912 Bacteria 1629
122 Ga0207707_10468321 3300025912 Bacteria 1077
123 Ga0207695_10073437 3300025913 Bacteria 3485
124 Ga0207671_10086532 3300025914 Bacteria 2356
125 Ga0207693_10013072 3300025915 Bacteria 6698
126 Ga0207663_10091553 3300025916 Bacteria 2019
127 Ga0207662_10018967 3300025918 Bacteria 3908
128 Ga0207657_10128907 3300025919 Bacteria 2075
129 Ga0207649_10050241 3300025920 Bacteria 2579
130 Ga0207649_10419799 3300025920 Bacteria 1004
131 Ga0207646_10388320 3300025922 Bacteria 1261
132 Ga0207694_10488633 3300025924 Bacteria 1030
133 Ga0207687_10010071 3300025927 Bacteria 6182
134 Ga0207700_10343224 3300025928 Bacteria 1299
135 Ga0207664_10000003 3300025929 Bacteria 510966
136 Ga0207664_10666652 3300025929 Bacteria 935
137 Ga0207644_10085433 3300025931 Bacteria 2341
138 Ga0207690_10250425 3300025932 Bacteria 1368
139 Ga0207690_10392570 3300025932 Unclassified 1105
140 Ga0207706_10033577 3300025933 Bacteria 4566
141 Ga0207686_10064847 3300025934 Bacteria 2327
142 Ga0207670_10084162 3300025936 Bacteria 2233
143 Ga0207669_10012960 3300025937 Bacteria 4122
144 Ga0207704_10111286 3300025938 Bacteria 1852
145 Ga0207665_10002467 3300025939 Bacteria 12474
146 Ga0207711_10117384 3300025941 Bacteria 2373
147 Ga0207689_10035999 3300025942 Bacteria 4109
148 Ga0207661_10049579 3300025944 Bacteria 3342
149 Ga0207679_10026479 3300025945 Bacteria 3999
150 Ga0207712_10012145 3300025961 Bacteria 5503
151 Ga0207712_10337081 3300025961 Bacteria 1249
152 Ga0207668_10064595 3300025972 Bacteria 2587
153 Ga0207677_10352125 3300026023 Bacteria 1234
154 Ga0207703_10303361 3300026035 Bacteria 1457
155 Ga0207639_10515738 3300026041 Bacteria 1094
156 Ga0207678_10002267 3300026067 Bacteria 17409
157 Ga0207708_10000008 3300026075 Bacteria 245837
158 Ga0207708_10046902 3300026075 Bacteria 3291
159 Ga0207708_10103934 3300026075 Bacteria 2200
160 Ga0207702_10131794 3300026078 Bacteria 2250
161 Ga0207702_10151373 3300026078 Bacteria 2110
162 Ga0207676_10697169 3300026095 Bacteria 983
163 Ga0207675_100018131 3300026118 Bacteria 6564
164 Ga0207675_100527451 3300026118 Bacteria 1178
165 Ga0207683_10037081 3300026121 Bacteria 4245
166 Ga0207683_10895440 3300026121 Bacteria 824
167 Ga0207428_10270191 3300027907 Bacteria 1264
168 Ga0265334_10031966 3300028573 Bacteria 2101
169 Ga0265338_10001989 3300028800 Bacteria 31798
170 Ga0265325_10001348 3300031241 Bacteria 17400
171 Ga0265339_10002930 3300031249 Bacteria 12066
172 Ga0265331_10054644 3300031250 Bacteria 1901
173 Ga0265316_10115404 3300031344 Bacteria 2030
174 Ga0265313_10002074 3300031595 Bacteria 17940
175 Ga0265314_10019534 3300031711 Bacteria 5249
176 Ga0265314_10032958 3300031711 Bacteria 3805
177 Ga0307510_10153180 3300033180 Bacteria 1919
178 Ga0373959_0015996 3300034820 Bacteria 1385
179 Ga0373938_0005251 3300034957 Bacteria 2196
180 Ga0373928_0003405 3300035084 Bacteria 3030
181 Ga0373940_0017358 3300035088 Bacteria 1794
182 Ga0373949_0004348 3300035090 Bacteria 3250
183 Ga0373951_0007365 3300035091 Bacteria 2500
184 Ga0373952_0025247 3300035092 Bacteria 1282
185 Ga0373939_0014044 3300035114 Bacteria 2071
186 Ga0373941_0016245 3300035115 Bacteria 2020
187 Ga0373960_0037526 3300035121 Bacteria 1385
188 Ga0373943_0099276 3300035170 Bacteria 1520
189 Ga0373946_0126881 3300035171 Bacteria 1170
190 Ga0373942_0039679 3300035207 Bacteria 1281
191 Ga0373961_0046093 3300035241 Bacteria 1277
192 Ga0373931_0027181 3300035691 Bacteria 2918
193 Ga0373933_0152554 3300035724 Bacteria 1464
194 Ga0373947_0037996 3300035725 Bacteria 2858
195 Ga0373937_0065594 3300036401 Bacteria 3343
196 Ga0373937_0264517 3300036401 Bacteria 1622
197 Ga0373925_0213273 3300037068 Bacteria 1538
198 Ga0373925_0969339 3300037068 Bacteria 700
199 Ga0436365_1792898 3300039437 Bacteria 871
200 Ga0466966_0073554 3300044684 Bacteria 2137
201 Ga0466966_0144763 3300044684 Bacteria 1451
202 Ga0466961_0155231 3300044693 Bacteria 1428
203 Ga0466963_0050671 3300044694 Bacteria 2748
204 Ga0466963_0139811 3300044694 Bacteria 1677
205 Ga0466963_0160898 3300044694 Bacteria 1562
206 Ga0466971_0155932 3300044719 Bacteria 1067
207 Ga0466970_0031082 3300044765 Bacteria 2819
208 Ga0466959_0050903 3300045049 Bacteria 3040
209 Ga0466958_0147790 3300045836 Bacteria 1482
210 Ga0466967_0041372 3300045976 Bacteria 3973
211 Ga0466967_0161329 3300045976 Bacteria 2104
212 Ga0495629_0473283 3300046459 Bacteria 847
213 Ga0495641_0424858 3300046461 Bacteria 604
214 Ga0495580_0111422 3300046472 Bacteria 1901
215 Ga0495582_0217093 3300046473 Unclassified 1094
216 Ga0495608_0705659 3300046511 Unclassified 600
217 Ga0495618_0451348 3300046514 Unclassified 780
218 Ga0495630_0131113 3300046517 Bacteria 1904
219 Ga0495630_0141846 3300046517 Bacteria 1827
220 Ga0495666_0095771 3300046526 Bacteria 1400
221 Ga0495666_0128104 3300046526 Bacteria 1187
222 Ga0495586_0059048 3300046535 Bacteria 2084
223 Ga0495586_0064896 3300046535 Bacteria 1990
224 Ga0495667_0018470 3300046559 Bacteria 4711
225 Ga0495634_0140187 3300046642 Bacteria 1536
226 Ga0495635_0194450 3300046663 Bacteria 1377
227 Ga0495657_0338697 3300046675 Bacteria 892
228 Ga0495647_0068702 3300046681 Bacteria 1414
229 Ga0495658_0061794 3300046683 Bacteria 2152
230 Ga0495658_0601833 3300046683 Bacteria 704
231 Ga0495669_0014015 3300046684 Bacteria 3425
232 Ga0495613_0011088 3300046689 Bacteria 6691
233 Ga0495613_0690040 3300046689 Unclassified 673
234 Ga0495624_0051258 3300046690 Bacteria 2613
235 Ga0495589_0177783 3300046794 Bacteria 1010
236 Ga0495674_0789209 3300047319 Unclassified 739
237 Ga0495672_0203101 3300047320 Bacteria 990
238 Ga0495676_0074648 3300047321 Bacteria 2596
239 Ga0495680_0779302 3300047322 Bacteria 626
240 Ga0495614_0471166 3300048089 Bacteria 596
241 Ga0496102_0041075 3300048905 Bacteria 4188
242 Ga0496102_0276537 3300048905 Bacteria 1583
243 Ga0496103_0110727 3300048906 Bacteria 1744
244 Ga0496104_0030953 3300048907 Bacteria 4974
245 Ga0496105_0010181 3300048908 Bacteria 7389
246 Ga0496106_0026786 3300048909 Bacteria 4293
247 Ga0496106_0365165 3300048909 Bacteria 1160
248 Ga0496107_0110778 3300048910 Bacteria 2017
249 Ga0496108_0012463 3300048911 Bacteria 6922
250 Ga0496108_0260822 3300048911 Bacteria 1508
251 Ga0496109_0010316 3300048912 Bacteria 7978
252 Ga0496109_0370343 3300048912 Bacteria 1353
253 Ga0496109_0436361 3300048912 Bacteria 1237
254 Ga0496110_0273507 3300048913 Bacteria 1538
255 Ga0496111_0025316 3300048914 Bacteria 4187
256 Ga0496112_0097969 3300048915 Bacteria 2902
257 Ga0496113_0092957 3300048916 Bacteria 2327
258 Ga0496113_0130642 3300048916 Bacteria 1970
259 Ga0496114_0010358 3300048917 Bacteria 7418
260 Ga0496114_0091794 3300048917 Bacteria 2579
261 Ga0496114_0159419 3300048917 Bacteria 1961
262 Ga0496121_0018389 3300048924 Bacteria 7049
263 Ga0496126_0000072 3300048929 Bacteria 238130
264 Ga0501031_0019034 3300049568 Bacteria 4471
265 Ga0501031_0065065 3300049568 Bacteria 2375
266 Ga0501032_0013885 3300049569 Bacteria 5714
267 Ga0501032_0469397 3300049569 Bacteria 805
268 Ga0501033_0027452 3300049570 Bacteria 4280
269 Ga0501033_0090143 3300049570 Bacteria 2243
270 Ga0501033_0147563 3300049570 Bacteria 1698
271 Ga0501034_0068697 3300049571 Bacteria 3554
272 Ga0501037_0023995 3300049573 Bacteria 4509
273 Ga0501037_0281356 3300049573 Bacteria 1159
274 Ga0501038_0001226 3300049574 Bacteria 23248
275 Ga0501038_0034631 3300049574 Bacteria 4439
276 Ga0501038_0269844 3300049574 Bacteria 1342
277 Ga0501039_0168936 3300049575 Bacteria 1719
278 Ga0501040_0004826 3300049576 Bacteria 8737
279 Ga0501041_0124035 3300049577 Bacteria 1606
280 Ga0501042_0019610 3300049578 Bacteria 4699
281 Ga0501043_0041109 3300049579 Bacteria 3633
282 Ga0501043_0277905 3300049579 Bacteria 1284
283 Ga0501046_0065030 3300049580 Bacteria 2846
284 Ga0501047_0002035 3300049581 Bacteria 19329
285 Ga0501048_0000749 3300049582 Bacteria 23801
286 Ga0501068_0072099 3300049584 Bacteria 2109
287 Ga0501070_0007815 3300049586 Bacteria 9066
288 Ga0501070_0154051 3300049586 Bacteria 1896
289 Ga0501070_0267027 3300049586 Bacteria 1398
290 Ga0501071_0040804 3300049587 Bacteria 3322
291 Ga0501071_0337300 3300049587 Bacteria 1146
292 Ga0501072_0018015 3300049588 Bacteria 5430
293 Ga0501072_0078708 3300049588 Bacteria 2610
294 Ga0501073_0134718 3300049589 Bacteria 1712
295 Ga0501074_0054379 3300049590 Bacteria 2887
296 Ga0501075_0104424 3300049591 Bacteria 2153
297 Ga0501076_0035708 3300049592 Bacteria 3889
298 Ga0501076_0439840 3300049592 Bacteria 1073
299 Ga0501077_0006202 3300049593 Bacteria 7304
300 Ga0501079_0013579 3300049741 Bacteria 6213
301 Ga0501080_0090803 3300049742 Bacteria 2837
302 Ga0501080_0556366 3300049742 Bacteria 1021
303 Ga0501081_0031106 3300049743 Bacteria 3617
304 Ga0501035_0007201 3300049822 Bacteria 10411
305 Ga0501035_0071608 3300049822 Bacteria 3069
306 Ga0501035_0244837 3300049822 Bacteria 1524
307 Ga0501044_0184058 3300049823 Bacteria 2055
308 Ga0501044_0390186 3300049823 Bacteria 1306
309 Ga0501044_0914134 3300049823 Bacteria 752
310 nmdc:mga06r32_123942_c1 3300050510 Bacteria 2550
311 nmdc:mga08y16_22989_c1 3300050511 Bacteria 6581
312 nmdc:mga0n895_307558_c1 3300050512 Bacteria 1607
313 nmdc:mga0n895_96805_c1 3300050512 Bacteria 2956
314 nmdc:mga0rr50_58171_c1 3300050513 Bacteria 2896
315 nmdc:mga0rr50_68097_c1 3300050513 Bacteria 2706
316 nmdc:mga0a205_20627_c1 3300050515 Bacteria 6223
317 Ga0495612_0058076 3300053078 Bacteria 1599
318 Ga0500566_0325219 3300053094 Unclassified 714
319 Ga0500559_0011178 3300053136 Bacteria 3839
320 Ga0501082_0038172 3300060353 Bacteria 4143
321 Ga0466962_0432909 3300061719 Bacteria 661
322 Ga0530510_0064427 3300061734 Bacteria 2654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0473283 Ga0495629_0473283_146_697 159
2 3300049573 Ga0501037_0281356 Ga0501037_0281356_611_1147 166
3 3300044694 Ga0466963_0160898 Ga0466963_0160898_973_1491 167
4 3300045976 Ga0466967_0041372 Ga0466967_0041372_2491_3009 167
5 3300044684 Ga0466966_0144763 Ga0466966_0144763_837_1370 170
6 3300044719 Ga0466971_0155932 Ga0466971_0155932_461_994 170
7 3300005327 Ga0070658_10071518 Ga0070658_100715181 174
8 3300046684 Ga0495669_0014015 Ga0495669_0014015_1320_1862 174
9 3300049574 Ga0501038_0269844 Ga0501038_0269844_721_1284 175
10 3300049586 Ga0501070_0267027 Ga0501070_0267027_31_594 175
11 3300049588 Ga0501072_0078708 Ga0501072_0078708_1723_2256 175
12 3300049822 Ga0501035_0244837 Ga0501035_0244837_210_773 175
13 3300046461 Ga0495641_0424858 Ga0495641_0424858_11_562 176
14 3300046683 Ga0495658_0601833 Ga0495658_0601833_36_587 176
15 3300047322 Ga0495680_0779302 Ga0495680_0779302_40_591 176
16 3300048089 Ga0495614_0471166 Ga0495614_0471166_10_561 176
17 3300005344 Ga0070661_100073333 Ga0070661_1000733332 177
18 3300005366 Ga0070659_100839448 Ga0070659_1008394481 177
19 3300005530 Ga0070679_100450807 Ga0070679_1004508072 177
20 3300009098 Ga0105245_10607117 Ga0105245_106071172 177
21 3300025920 Ga0207649_10050241 Ga0207649_100502414 177
22 3300025932 Ga0207690_10392570 Ga0207690_103925702 177
23 3300046473 Ga0495582_0217093 Ga0495582_0217093_111_659 177
24 3300046514 Ga0495618_0451348 Ga0495618_0451348_74_622 177
25 3300046517 Ga0495630_0131113 Ga0495630_0131113_694_1242 177
26 3300046535 Ga0495586_0064896 Ga0495586_0064896_434_982 177
27 3300046642 Ga0495634_0140187 Ga0495634_0140187_867_1415 177
28 3300046681 Ga0495647_0068702 Ga0495647_0068702_734_1282 177
29 3300046683 Ga0495658_0061794 Ga0495658_0061794_1107_1655 177
30 3300046689 Ga0495613_0011088 Ga0495613_0011088_2816_3364 177
31 3300049742 Ga0501080_0556366 Ga0501080_0556366_138_677 177
32 3300053094 Ga0500566_0325219 Ga0500566_0325219_121_669 177
33 3300005441 Ga0070700_100000004 Ga0070700_100000004162 178
34 3300005937 Ga0081455_10043930 Ga0081455_100439304 178
35 3300026075 Ga0207708_10000008 Ga0207708_1000000868 178
36 3300033180 Ga0307510_10153180 Ga0307510_101531803 178
37 3300046794 Ga0495589_0177783 Ga0495589_0177783_95_646 178
38 3300048909 Ga0496106_0365165 Ga0496106_0365165_116_667 178
39 3300049570 Ga0501033_0147563 Ga0501033_0147563_502_1080 178
40 3300049822 Ga0501035_0071608 Ga0501035_0071608_1632_2210 178
41 3300049823 Ga0501044_0184058 Ga0501044_0184058_1080_1658 178
42 3300005436 Ga0070713_100101600 Ga0070713_1001016002 179
43 3300005937 Ga0081455_10004489 Ga0081455_1000448911 179
44 3300013296 Ga0157374_11026778 Ga0157374_110267782 179
45 3300025928 Ga0207700_10343224 Ga0207700_103432242 179
46 3300047320 Ga0495672_0203101 Ga0495672_0203101_283_837 179
47 3300049587 Ga0501071_0337300 Ga0501071_0337300_21_566 179
48 3300053136 Ga0500559_0011178 Ga0500559_0011178_1975_2529 179
49 3300005544 Ga0070686_100644369 Ga0070686_1006443692 180
50 3300005545 Ga0070695_100074967 Ga0070695_1000749672 180
51 3300005614 Ga0068856_100160290 Ga0068856_1001602902 180
52 3300006871 Ga0075434_100034366 Ga0075434_1000343662 180
53 3300007076 Ga0075435_100055299 Ga0075435_1000552993 180
54 3300009098 Ga0105245_10004607 Ga0105245_100046073 180
55 3300009176 Ga0105242_10026710 Ga0105242_100267102 180
56 3300025927 Ga0207687_10010071 Ga0207687_100100713 180
57 3300025934 Ga0207686_10064847 Ga0207686_100648472 180
58 3300026078 Ga0207702_10151373 Ga0207702_101513732 180
59 3300035092 Ga0373952_0025247 Ga0373952_0025247_699_1253 180
60 3300048905 Ga0496102_0276537 Ga0496102_0276537_714_1295 180
61 3300048911 Ga0496108_0260822 Ga0496108_0260822_198_755 180
62 3300048913 Ga0496110_0273507 Ga0496110_0273507_674_1231 180
63 3300050512 nmdc:mga0n895_96805_c1 nmdc:mga0n895_96805_c1_1080_1661 180
64 3300005435 Ga0070714_100657837 Ga0070714_1006578371 181
65 3300005468 Ga0070707_100466207 Ga0070707_1004662072 181
66 3300006847 Ga0075431_100132633 Ga0075431_1001326331 181
67 3300006871 Ga0075434_100482990 Ga0075434_1004829901 181
68 3300007076 Ga0075435_100122947 Ga0075435_1001229471 181
69 3300009094 Ga0111539_10009383 Ga0111539_100093838 181
70 3300009147 Ga0114129_11768165 Ga0114129_117681651 181
71 3300025909 Ga0207705_10356069 Ga0207705_103560692 181
72 3300025922 Ga0207646_10388320 Ga0207646_103883202 181
73 3300036401 Ga0373937_0065594 Ga0373937_0065594_1642_2202 181
74 3300044694 Ga0466963_0050671 Ga0466963_0050671_317_877 181
75 3300045976 Ga0466967_0161329 Ga0466967_0161329_825_1385 181
76 3300046511 Ga0495608_0705659 Ga0495608_0705659_10_570 181
77 3300046526 Ga0495666_0095771 Ga0495666_0095771_698_1267 181
78 3300046559 Ga0495667_0018470 Ga0495667_0018470_1787_2347 181
79 3300046675 Ga0495657_0338697 Ga0495657_0338697_254_814 181
80 3300046689 Ga0495613_0690040 Ga0495613_0690040_67_627 181
81 3300048905 Ga0496102_0041075 Ga0496102_0041075_3107_3682 181
82 3300048924 Ga0496121_0018389 Ga0496121_0018389_924_1499 181
83 3300048929 Ga0496126_0000072 Ga0496126_0000072_167929_168501 181
84 3300049568 Ga0501031_0019034 Ga0501031_0019034_628_1191 181
85 3300049569 Ga0501032_0469397 Ga0501032_0469397_228_794 181
86 3300049570 Ga0501033_0027452 Ga0501033_0027452_1292_1855 181
87 3300049574 Ga0501038_0034631 Ga0501038_0034631_2622_3185 181
88 3300049575 Ga0501039_0168936 Ga0501039_0168936_717_1280 181
89 3300049576 Ga0501040_0004826 Ga0501040_0004826_4012_4575 181
90 3300049577 Ga0501041_0124035 Ga0501041_0124035_844_1407 181
91 3300049578 Ga0501042_0019610 Ga0501042_0019610_1867_2430 181
92 3300049579 Ga0501043_0277905 Ga0501043_0277905_246_812 181
93 3300049580 Ga0501046_0065030 Ga0501046_0065030_252_815 181
94 3300049584 Ga0501068_0072099 Ga0501068_0072099_352_915 181
95 3300049587 Ga0501071_0040804 Ga0501071_0040804_752_1315 181
96 3300049588 Ga0501072_0018015 Ga0501072_0018015_228_791 181
97 3300049590 Ga0501074_0054379 Ga0501074_0054379_806_1369 181
98 3300049591 Ga0501075_0104424 Ga0501075_0104424_406_969 181
99 3300049592 Ga0501076_0035708 Ga0501076_0035708_1288_1851 181
100 3300049593 Ga0501077_0006202 Ga0501077_0006202_3999_4562 181
101 3300049741 Ga0501079_0013579 Ga0501079_0013579_4186_4749 181
102 3300049742 Ga0501080_0090803 Ga0501080_0090803_172_735 181
103 3300049743 Ga0501081_0031106 Ga0501081_0031106_489_1052 181
104 3300049823 Ga0501044_0914134 Ga0501044_0914134_79_642 181
105 3300050510 nmdc:mga06r32_123942_c1 nmdc:mga06r32_123942_c1_22_582 181
106 3300050511 nmdc:mga08y16_22989_c1 nmdc:mga08y16_22989_c1_4565_5125 181
107 3300050513 nmdc:mga0rr50_68097_c1 nmdc:mga0rr50_68097_c1_114_698 181
108 3300060353 Ga0501082_0038172 Ga0501082_0038172_2512_3075 181
109 3300061734 Ga0530510_0064427 Ga0530510_0064427_1980_2543 181
110 3300005329 Ga0070683_100001990 Ga0070683_10000199010 182
111 3300005458 Ga0070681_10140607 Ga0070681_101406073 182
112 3300005535 Ga0070684_100019282 Ga0070684_1000192825 182
113 3300005564 Ga0070664_100036258 Ga0070664_1000362582 182
114 3300005719 Ga0068861_100352295 Ga0068861_1003522952 182
115 3300009093 Ga0105240_10304960 Ga0105240_103049604 182
116 3300009147 Ga0114129_11098264 Ga0114129_110982641 182
117 3300020069 Ga0197907_10286187 Ga0197907_102861872 182
118 3300021384 Ga0213876_10442626 Ga0213876_104426261 182
119 3300025912 Ga0207707_10226031 Ga0207707_102260312 182
120 3300025944 Ga0207661_10049579 Ga0207661_100495794 182
121 3300025945 Ga0207679_10026479 Ga0207679_100264792 182
122 3300039437 Ga0436365_1792898 Ga0436365_1792898_41_646 182
123 3300044684 Ga0466966_0073554 Ga0466966_0073554_576_1139 182
124 3300044693 Ga0466961_0155231 Ga0466961_0155231_470_1033 182
125 3300044765 Ga0466970_0031082 Ga0466970_0031082_504_1067 182
126 3300045049 Ga0466959_0050903 Ga0466959_0050903_421_984 182
127 3300045836 Ga0466958_0147790 Ga0466958_0147790_572_1138 182
128 3300049592 Ga0501076_0439840 Ga0501076_0439840_287_910 182
129 3300035170 Ga0373943_0099276 Ga0373943_0099276_682_1272 183
130 3300035171 Ga0373946_0126881 Ga0373946_0126881_425_1015 183
131 3300035724 Ga0373933_0152554 Ga0373933_0152554_670_1260 183
132 3300035725 Ga0373947_0037996 Ga0373947_0037996_314_904 183
133 3300036401 Ga0373937_0264517 Ga0373937_0264517_254_844 183
134 3300037068 Ga0373925_0213273 Ga0373925_0213273_603_1193 183
135 3300046472 Ga0495580_0111422 Ga0495580_0111422_30_620 183
136 3300046517 Ga0495630_0141846 Ga0495630_0141846_767_1357 183
137 3300046526 Ga0495666_0128104 Ga0495666_0128104_477_1067 183
138 3300046535 Ga0495586_0059048 Ga0495586_0059048_1363_1953 183
139 3300046663 Ga0495635_0194450 Ga0495635_0194450_690_1280 183
140 3300046690 Ga0495624_0051258 Ga0495624_0051258_571_1161 183
141 3300047319 Ga0495674_0789209 Ga0495674_0789209_25_615 183
142 3300048912 Ga0496109_0370343 Ga0496109_0370343_583_1143 183
143 3300053078 Ga0495612_0058076 Ga0495612_0058076_897_1487 183
144 3300005347 Ga0070668_100625149 Ga0070668_1006251491 184
145 3300005356 Ga0070674_100394318 Ga0070674_1003943182 184
146 3300005441 Ga0070700_100093050 Ga0070700_1000930503 184
147 3300009098 Ga0105245_10050481 Ga0105245_100504813 184
148 3300009177 Ga0105248_10177807 Ga0105248_101778073 184
149 3300009553 Ga0105249_10479439 Ga0105249_104794392 184
150 3300025912 Ga0207707_10468321 Ga0207707_104683212 184
151 3300025941 Ga0207711_10117384 Ga0207711_101173843 184
152 3300025961 Ga0207712_10337081 Ga0207712_103370812 184
153 3300026075 Ga0207708_10103934 Ga0207708_101039342 184
154 3300026118 Ga0207675_100527451 Ga0207675_1005274512 184
155 3300048912 Ga0496109_0436361 Ga0496109_0436361_237_830 184
156 3300049586 Ga0501070_0154051 Ga0501070_0154051_91_669 184
157 3300002067 JGI24735J21928_10009460 JGI24735J21928_100094603 185
158 3300005330 Ga0070690_100422658 Ga0070690_1004226582 185
159 3300005334 Ga0068869_100067973 Ga0068869_1000679732 185
160 3300005335 Ga0070666_10111288 Ga0070666_101112881 185
161 3300005337 Ga0070682_100147129 Ga0070682_1001471292 185
162 3300005338 Ga0068868_100147655 Ga0068868_1001476552 185
163 3300005339 Ga0070660_100061536 Ga0070660_1000615362 185
164 3300005340 Ga0070689_100114137 Ga0070689_1001141372 185
165 3300005341 Ga0070691_10098332 Ga0070691_100983321 185
166 3300005343 Ga0070687_100014382 Ga0070687_1000143824 185
167 3300005345 Ga0070692_10047139 Ga0070692_100471392 185
168 3300005347 Ga0070668_100002350 Ga0070668_1000023502 185
169 3300005355 Ga0070671_100064915 Ga0070671_1000649153 185
170 3300005356 Ga0070674_100072157 Ga0070674_1000721572 185
171 3300005365 Ga0070688_100163135 Ga0070688_1001631352 185
172 3300005366 Ga0070659_100009179 Ga0070659_1000091792 185
173 3300005434 Ga0070709_10003782 Ga0070709_100037826 185
174 3300005435 Ga0070714_100000012 Ga0070714_100000012168 185
175 3300005439 Ga0070711_100047999 Ga0070711_1000479991 185
176 3300005441 Ga0070700_100037396 Ga0070700_1000373962 185
177 3300005444 Ga0070694_100120672 Ga0070694_1001206722 185
178 3300005455 Ga0070663_100015984 Ga0070663_1000159843 185
179 3300005456 Ga0070678_100022457 Ga0070678_1000224572 185
180 3300005456 Ga0070678_100239398 Ga0070678_1002393982 185
181 3300005459 Ga0068867_100048732 Ga0068867_1000487323 185
182 3300005539 Ga0068853_100272228 Ga0068853_1002722282 185
183 3300005544 Ga0070686_100021267 Ga0070686_1000212672 185
184 3300005546 Ga0070696_100858564 Ga0070696_1008585641 185
185 3300005563 Ga0068855_100032990 Ga0068855_1000329905 185
186 3300005564 Ga0070664_100145496 Ga0070664_1001454962 185
187 3300005578 Ga0068854_100092132 Ga0068854_1000921322 185
188 3300005614 Ga0068856_100076963 Ga0068856_1000769634 185
189 3300005615 Ga0070702_100097507 Ga0070702_1000975072 185
190 3300005617 Ga0068859_100154921 Ga0068859_1001549212 185
191 3300005618 Ga0068864_100327767 Ga0068864_1003277671 185
192 3300005718 Ga0068866_10090186 Ga0068866_100901861 185
193 3300005719 Ga0068861_100042584 Ga0068861_1000425842 185
194 3300005843 Ga0068860_100177185 Ga0068860_1001771852 185
195 3300005983 Ga0081540_1000660 Ga0081540_100066021 185
196 3300006163 Ga0070715_10102569 Ga0070715_101025692 185
197 3300006173 Ga0070716_100038787 Ga0070716_1000387871 185
198 3300006852 Ga0075433_10006735 Ga0075433_100067352 185
199 3300006871 Ga0075434_100164389 Ga0075434_1001643892 185
200 3300006881 Ga0068865_100092949 Ga0068865_1000929493 185
201 3300006914 Ga0075436_100036144 Ga0075436_1000361444 185
202 3300006931 Ga0097620_100154922 Ga0097620_1001549222 185
203 3300007076 Ga0075435_100097382 Ga0075435_1000973823 185
204 3300009011 Ga0105251_10123713 Ga0105251_101237132 185
205 3300009093 Ga0105240_10105103 Ga0105240_101051033 185
206 3300009093 Ga0105240_10256403 Ga0105240_102564032 185
207 3300009098 Ga0105245_10528743 Ga0105245_105287432 185
208 3300009101 Ga0105247_10013995 Ga0105247_100139952 185
209 3300009148 Ga0105243_10016143 Ga0105243_100161433 185
210 3300009174 Ga0105241_10099076 Ga0105241_100990762 185
211 3300009176 Ga0105242_10033209 Ga0105242_100332092 185
212 3300009177 Ga0105248_10112125 Ga0105248_101121254 185
213 3300009545 Ga0105237_10191864 Ga0105237_101918642 185
214 3300009545 Ga0105237_11300181 Ga0105237_113001811 185
215 3300009551 Ga0105238_10017998 Ga0105238_100179986 185
216 3300009553 Ga0105249_10002302 Ga0105249_100023029 185
217 3300011119 Ga0105246_10009429 Ga0105246_100094294 185
218 3300013102 Ga0157371_10072277 Ga0157371_100722773 185
219 3300013105 Ga0157369_10040599 Ga0157369_100405994 185
220 3300013297 Ga0157378_10093806 Ga0157378_100938062 185
221 3300013306 Ga0163162_10233036 Ga0163162_102330363 185
222 3300013307 Ga0157372_10324488 Ga0157372_103244881 185
223 3300014325 Ga0163163_10122961 Ga0163163_101229613 185
224 3300014326 Ga0157380_10087551 Ga0157380_100875513 185
225 3300014745 Ga0157377_10044101 Ga0157377_100441013 185
226 3300014968 Ga0157379_10249975 Ga0157379_102499752 185
227 3300014969 Ga0157376_10043935 Ga0157376_100439354 185
228 3300017792 Ga0163161_10518548 Ga0163161_105185481 185
229 3300020082 Ga0206353_11130394 Ga0206353_111303942 185
230 3300025898 Ga0207692_10019489 Ga0207692_100194892 185
231 3300025899 Ga0207642_10186674 Ga0207642_101866742 185
232 3300025901 Ga0207688_10001305 Ga0207688_100013052 185
233 3300025903 Ga0207680_10017574 Ga0207680_100175742 185
234 3300025904 Ga0207647_10015790 Ga0207647_100157902 185
235 3300025905 Ga0207685_10212495 Ga0207685_102124952 185
236 3300025910 Ga0207684_10578730 Ga0207684_105787301 185
237 3300025913 Ga0207695_10073437 Ga0207695_100734372 185
238 3300025914 Ga0207671_10086532 Ga0207671_100865322 185
239 3300025915 Ga0207693_10013072 Ga0207693_100130724 185
240 3300025916 Ga0207663_10091553 Ga0207663_100915531 185
241 3300025918 Ga0207662_10018967 Ga0207662_100189672 185
242 3300025919 Ga0207657_10128907 Ga0207657_101289072 185
243 3300025920 Ga0207649_10419799 Ga0207649_104197992 185
244 3300025924 Ga0207694_10488633 Ga0207694_104886331 185
245 3300025929 Ga0207664_10000003 Ga0207664_1000000340 185
246 3300025929 Ga0207664_10666652 Ga0207664_106666522 185
247 3300025931 Ga0207644_10085433 Ga0207644_100854332 185
248 3300025932 Ga0207690_10250425 Ga0207690_102504252 185
249 3300025933 Ga0207706_10033577 Ga0207706_100335774 185
250 3300025936 Ga0207670_10084162 Ga0207670_100841622 185
251 3300025937 Ga0207669_10012960 Ga0207669_100129604 185
252 3300025938 Ga0207704_10111286 Ga0207704_101112862 185
253 3300025939 Ga0207665_10002467 Ga0207665_100024673 185
254 3300025942 Ga0207689_10035999 Ga0207689_100359992 185
255 3300025961 Ga0207712_10012145 Ga0207712_100121455 185
256 3300025972 Ga0207668_10064595 Ga0207668_100645952 185
257 3300026023 Ga0207677_10352125 Ga0207677_103521252 185
258 3300026035 Ga0207703_10303361 Ga0207703_103033612 185
259 3300026041 Ga0207639_10515738 Ga0207639_105157381 185
260 3300026067 Ga0207678_10002267 Ga0207678_1000226711 185
261 3300026075 Ga0207708_10046902 Ga0207708_100469023 185
262 3300026078 Ga0207702_10131794 Ga0207702_101317942 185
263 3300026095 Ga0207676_10697169 Ga0207676_106971692 185
264 3300026118 Ga0207675_100018131 Ga0207675_1000181313 185
265 3300026121 Ga0207683_10037081 Ga0207683_100370811 185
266 3300026121 Ga0207683_10895440 Ga0207683_108954402 185
267 3300027907 Ga0207428_10270191 Ga0207428_102701912 185
268 3300028573 Ga0265334_10031966 Ga0265334_100319662 185
269 3300028800 Ga0265338_10001989 Ga0265338_1000198915 185
270 3300031241 Ga0265325_10001348 Ga0265325_100013484 185
271 3300031249 Ga0265339_10002930 Ga0265339_1000293011 185
272 3300031250 Ga0265331_10054644 Ga0265331_100546442 185
273 3300031344 Ga0265316_10115404 Ga0265316_101154042 185
274 3300031595 Ga0265313_10002074 Ga0265313_100020745 185
275 3300031711 Ga0265314_10019534 Ga0265314_100195343 185
276 3300031711 Ga0265314_10032958 Ga0265314_100329583 185
277 3300034820 Ga0373959_0015996 Ga0373959_0015996_110_679 185
278 3300034957 Ga0373938_0005251 Ga0373938_0005251_1013_1582 185
279 3300035084 Ga0373928_0003405 Ga0373928_0003405_91_660 185
280 3300035088 Ga0373940_0017358 Ga0373940_0017358_375_944 185
281 3300035090 Ga0373949_0004348 Ga0373949_0004348_2372_2941 185
282 3300035091 Ga0373951_0007365 Ga0373951_0007365_760_1329 185
283 3300035114 Ga0373939_0014044 Ga0373939_0014044_579_1148 185
284 3300035115 Ga0373941_0016245 Ga0373941_0016245_57_626 185
285 3300035121 Ga0373960_0037526 Ga0373960_0037526_213_782 185
286 3300035207 Ga0373942_0039679 Ga0373942_0039679_255_824 185
287 3300035241 Ga0373961_0046093 Ga0373961_0046093_110_679 185
288 3300035691 Ga0373931_0027181 Ga0373931_0027181_1202_1771 185
289 3300037068 Ga0373925_0969339 Ga0373925_0969339_94_663 185
290 3300044694 Ga0466963_0139811 Ga0466963_0139811_1028_1618 185
291 3300047321 Ga0495676_0074648 Ga0495676_0074648_1520_2089 185
292 3300048906 Ga0496103_0110727 Ga0496103_0110727_211_780 185
293 3300048907 Ga0496104_0030953 Ga0496104_0030953_899_1468 185
294 3300048908 Ga0496105_0010181 Ga0496105_0010181_4447_5016 185
295 3300048909 Ga0496106_0026786 Ga0496106_0026786_2317_2886 185
296 3300048910 Ga0496107_0110778 Ga0496107_0110778_160_729 185
297 3300048911 Ga0496108_0012463 Ga0496108_0012463_4000_4569 185
298 3300048912 Ga0496109_0010316 Ga0496109_0010316_515_1084 185
299 3300048914 Ga0496111_0025316 Ga0496111_0025316_2875_3444 185
300 3300048915 Ga0496112_0097969 Ga0496112_0097969_792_1361 185
301 3300048916 Ga0496113_0092957 Ga0496113_0092957_635_1300 185
302 3300048916 Ga0496113_0130642 Ga0496113_0130642_1230_1799 185
303 3300048917 Ga0496114_0010358 Ga0496114_0010358_1227_1814 185
304 3300048917 Ga0496114_0091794 Ga0496114_0091794_1962_2531 185
305 3300048917 Ga0496114_0159419 Ga0496114_0159419_1339_1917 185
306 3300049568 Ga0501031_0065065 Ga0501031_0065065_1635_2273 185
307 3300049569 Ga0501032_0013885 Ga0501032_0013885_484_1062 185
308 3300049570 Ga0501033_0090143 Ga0501033_0090143_855_1433 185
309 3300049571 Ga0501034_0068697 Ga0501034_0068697_2891_3469 185
310 3300049573 Ga0501037_0023995 Ga0501037_0023995_2204_2782 185
311 3300049574 Ga0501038_0001226 Ga0501038_0001226_2805_3383 185
312 3300049579 Ga0501043_0041109 Ga0501043_0041109_1385_1963 185
313 3300049581 Ga0501047_0002035 Ga0501047_0002035_1508_2086 185
314 3300049582 Ga0501048_0000749 Ga0501048_0000749_19432_20010 185
315 3300049586 Ga0501070_0007815 Ga0501070_0007815_5911_6489 185
316 3300049589 Ga0501073_0134718 Ga0501073_0134718_973_1551 185
317 3300049822 Ga0501035_0007201 Ga0501035_0007201_6943_7521 185
318 3300049823 Ga0501044_0390186 Ga0501044_0390186_147_725 185
319 3300050512 nmdc:mga0n895_307558_c1 nmdc:mga0n895_307558_c1_638_1207 185
320 3300050513 nmdc:mga0rr50_58171_c1 nmdc:mga0rr50_58171_c1_1746_2315 185
321 3300050515 nmdc:mga0a205_20627_c1 nmdc:mga0a205_20627_c1_5067_5636 185
322 3300061719 Ga0466962_0432909 Ga0466962_0432909_38_607 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

12

184

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c0z-assembly1.cif.gz_A-2 the 1.6 a resolution crystal structure of novw: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of streptomyces spheroides 0.8923 6 184
2d5h-assembly1.cif.gz_A crystal structure of recombinant soybean proglycinin a3b4 subunit, its comparison with mature glycinin a3b4 subunit, responsible for hexamer assembly 0.8866 51 134
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.8824 7 178
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.8762 8 180
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.8733 6 179
ID Description Score Start End Superfamily
af_Q652P9_24_210_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8946 51 134 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8933 9 184 2.60.120.10
af_A0A0R0L0M3_22_151_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8849 50 135 2.60.120.10
2vqaC01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.881 51 134 2.60.120.10
af_A0A0R0GUX4_36_216_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.88 51 134 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1R4FAM8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) 0.9705 3 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A660M742-F1-model_v4 dTDP-4-keto-6-deoxy-D-glucose epimerase 0.966 3 181 GO:0000271
GO:0005829
GO:0008830
AF-A0A2A9D3F3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9635 3 184 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-R6ZG37-F1-model_v4 dTDP-4-dehydrorhamnose 3 5-epimerase 0.9481 1 184 GO:0000271
GO:0005829
GO:0008830
AF-A0A2A9D3F3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9432 3 184 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
94.34 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map