F406351

General Info

Members Datasets Scaffolds Average Seq Length
322 163 644 385

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100001456|Ga0070697_1000014566
Length 417
Sequence MKPNSASLSKGCEILDTSERYRLGRVSTQVIDFSQKLWRRSANAGVRGLCFSRPLVLIQSDDWGRVGVQDRQGYEELRACGIRLGENPYDFYTLETAEDVIAISDLLKRHRDGTGRPACLVMNFILANLNFPNMADSKFTELQLLPLTRGLPGHWKRPGLFQAYRQGIADGVFFPALHGLTHFCCRAVEHALAENPERGTLLRTCWKAETPYIYWRMPWVGYEYCNPEKPHAGFLQAEAQASLIRQAATYFKKLFSTAPVSACAPGYRANRDTHAAWSQCGVRVVQNGSGAPLPPYMDEWEILNLHRMIDCEPSQRELPTEKYLELAEGCFARGIPAIISVHSVNFHSSLRDFRGPTLRALDQLLSALKAKHPDLLYVTDGDLYEIVNRGCFEGMRGSVSVSVRQKDLAKSVAHGAH

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.76
Rhizosphere 91.93
Stem 0
Stem Tuber 0
Unclassified 22.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100001456 3300005536 Bacteria 18032
2 rootH1_10034318 3300003323 Bacteria 5368
3 Ga0065712_10122265 3300005290 Bacteria 1654
4 Ga0070683_100048358 3300005329 Bacteria 3932
5 Ga0070670_100003024 3300005331 Bacteria 13908
6 Ga0070670_100007117 3300005331 Bacteria 9473
7 Ga0068869_100000409 3300005334 Bacteria 23378
8 Ga0068869_100089482 3300005334 Bacteria 2312
9 Ga0068869_100110087 3300005334 Bacteria 2094
10 Ga0068869_100119416 3300005334 Bacteria 2015
11 Ga0070666_10018456 3300005335 Unclassified 4487
12 Ga0070666_10041405 3300005335 Bacteria 3078
13 Ga0070680_100062853 3300005336 Bacteria 3041
14 Ga0068868_100008296 3300005338 Bacteria 7437
15 Ga0068868_100324355 3300005338 Unclassified 1312
16 Ga0070689_100062076 3300005340 Unclassified 2907
17 Ga0070689_100065514 3300005340 Bacteria 2829
18 Ga0070661_100047234 3300005344 Unclassified 3150
19 Ga0070668_100059631 3300005347 Bacteria 2954
20 Ga0070668_100281275 3300005347 Unclassified 1389
21 Ga0070675_100010047 3300005354 Bacteria 7379
22 Ga0070671_100023856 3300005355 Bacteria 5006
23 Ga0070673_100023333 3300005364 Unclassified 4520
24 Ga0070667_100124215 3300005367 Unclassified 2248
25 Ga0070709_10004727 3300005434 Bacteria 7351
26 Ga0070714_100004457 3300005435 Bacteria 10546
27 Ga0070714_100011855 3300005435 Bacteria 6927
28 Ga0070714_100019474 3300005435 Bacteria 5531
29 Ga0070714_100397378 3300005435 Bacteria 1302
30 Ga0070713_100003300 3300005436 Bacteria 10635
31 Ga0070713_100012588 3300005436 Bacteria 6213
32 Ga0070713_100022788 3300005436 Bacteria 4846
33 Ga0070713_100024028 3300005436 Bacteria 4740
34 Ga0070713_100061317 3300005436 Bacteria 3146
35 Ga0070710_10013295 3300005437 Bacteria 4119
36 Ga0070711_100002533 3300005439 Bacteria 10453
37 Ga0070708_100004627 3300005445 Bacteria 10836
38 Ga0070708_100008441 3300005445 Bacteria 8268
39 Ga0070708_100096407 3300005445 Unclassified 2702
40 Ga0070708_100236312 3300005445 Bacteria 1715
41 Ga0070663_100019415 3300005455 Unclassified 4479
42 Ga0070678_100052337 3300005456 Bacteria 2964
43 Ga0070662_100053046 3300005457 Unclassified 2934
44 Ga0070662_100064196 3300005457 Bacteria 2688
45 Ga0070662_100088345 3300005457 Bacteria 2323
46 Ga0070681_10000353 3300005458 Bacteria 37155
47 Ga0070681_10140451 3300005458 Unclassified 2346
48 Ga0070681_10195299 3300005458 Unclassified 1943
49 Ga0068867_100186861 3300005459 Unclassified 1651
50 Ga0070685_10002192 3300005466 Bacteria 10090
51 Ga0070707_100156343 3300005468 Bacteria 2221
52 Ga0070699_100024605 3300005518 Bacteria 5191
53 Ga0070699_100105370 3300005518 Unclassified 2474
54 Ga0070699_100188488 3300005518 Bacteria 1832
55 Ga0070684_100044925 3300005535 Unclassified 3823
56 Ga0070697_100000017 3300005536 Bacteria 141440
57 Ga0070697_100030977 3300005536 Bacteria 4300
58 Ga0070697_100085764 3300005536 Unclassified 2598
59 Ga0070672_100000881 3300005543 Bacteria 17994
60 Ga0070696_100138777 3300005546 Unclassified 1774
61 Ga0070693_100052209 3300005547 Bacteria 2343
62 Ga0070665_100085999 3300005548 Unclassified 3150
63 Ga0070665_100165366 3300005548 Bacteria 2215
64 Ga0068855_100002474 3300005563 Bacteria 22799
65 Ga0068855_100049497 3300005563 Unclassified 4956
66 Ga0068855_100053028 3300005563 Unclassified 4772
67 Ga0068855_100066171 3300005563 Unclassified 4213
68 Ga0068855_100233144 3300005563 Bacteria 2060
69 Ga0068855_100300269 3300005563 Unclassified 1778
70 Ga0070664_100000411 3300005564 Bacteria 31923
71 Ga0070664_100007511 3300005564 Bacteria 8799
72 Ga0070664_100087967 3300005564 Unclassified 2686
73 Ga0068857_100000034 3300005577 Bacteria 73294
74 Ga0068857_100003746 3300005577 Bacteria 12775
75 Ga0068857_100071314 3300005577 Unclassified 3095
76 Ga0068854_100001168 3300005578 Bacteria 15755
77 Ga0068854_100089644 3300005578 Bacteria 2286
78 Ga0068856_100000153 3300005614 Bacteria 70644
79 Ga0068856_100073759 3300005614 Unclassified 3379
80 Ga0068856_100095910 3300005614 Bacteria 2954
81 Ga0068856_100129704 3300005614 Unclassified 2526
82 Ga0068856_100211818 3300005614 Bacteria 1953
83 Ga0068852_100087202 3300005616 Bacteria 2784
84 Ga0068859_100012906 3300005617 Bacteria 8392
85 Ga0068859_100024086 3300005617 Bacteria 6109
86 Ga0068864_100000879 3300005618 Bacteria 25306
87 Ga0068864_100001949 3300005618 Bacteria 16956
88 Ga0068863_100001146 3300005841 Bacteria 26467
89 Ga0068863_100110538 3300005841 Bacteria 2617
90 Ga0068858_100005617 3300005842 Bacteria 12262
91 Ga0068858_100068235 3300005842 Unclassified 3295
92 Ga0068858_100074575 3300005842 Unclassified 3150
93 Ga0068860_100089557 3300005843 Unclassified 2929
94 Ga0068860_100191746 3300005843 Bacteria 1978
95 Ga0068862_100002776 3300005844 Bacteria 15341
96 Ga0068862_100122524 3300005844 Unclassified 2293
97 Ga0070717_10001547 3300006028 Bacteria 15954
98 Ga0070717_10005696 3300006028 Bacteria 9109
99 Ga0070717_10009052 3300006028 Bacteria 7473
100 Ga0070717_10009147 3300006028 Bacteria 7445
101 Ga0070717_10034646 3300006028 Unclassified 4083
102 Ga0070716_100000294 3300006173 Bacteria 20186
103 Ga0070716_100027037 3300006173 Bacteria 3078
104 Ga0070712_100000628 3300006175 Bacteria 20776
105 Ga0070712_100001058 3300006175 Bacteria 16627
106 Ga0097621_100042146 3300006237 Bacteria 3676
107 Ga0097621_100082672 3300006237 Unclassified 2675
108 Ga0097621_100251502 3300006237 Unclassified 1547
109 Ga0068871_100005933 3300006358 Bacteria 8598
110 Ga0068871_100010673 3300006358 Bacteria 6716
111 Ga0075434_100290721 3300006871 Bacteria 1654
112 Ga0075434_100385015 3300006871 Bacteria 1423
113 Ga0075436_100001278 3300006914 Bacteria 17084
114 Ga0097620_100012906 3300006931 Bacteria 8392
115 Ga0097620_100024085 3300006931 Bacteria 6109
116 Ga0075435_100001821 3300007076 Bacteria 13862
117 Ga0105240_10046370 3300009093 Bacteria 5507
118 Ga0105240_10117676 3300009093 Bacteria 3203
119 Ga0105240_10174595 3300009093 Bacteria 2541
120 Ga0105240_10175136 3300009093 Bacteria 2537
121 Ga0105245_10022288 3300009098 Bacteria 5559
122 Ga0105245_10106248 3300009098 Bacteria 2604
123 Ga0105245_10117636 3300009098 Unclassified 2479
124 Ga0105245_10133449 3300009098 Bacteria 2331
125 Ga0105245_10352585 3300009098 Bacteria 1458
126 Ga0105241_10024336 3300009174 Unclassified 4497
127 Ga0105241_10042974 3300009174 Bacteria 3422
128 Ga0105241_10054175 3300009174 Bacteria 3069
129 Ga0105241_10106794 3300009174 Bacteria 2235
130 Ga0105242_10074713 3300009176 Unclassified 2820
131 Ga0105242_10079076 3300009176 Bacteria 2746
132 Ga0105248_10003820 3300009177 Bacteria 16700
133 Ga0105248_10020446 3300009177 Bacteria 7335
134 Ga0105237_10043455 3300009545 Bacteria 4526
135 Ga0105238_10057628 3300009551 Bacteria 3895
136 Ga0105238_10099011 3300009551 Bacteria 2899
137 Ga0105238_10204526 3300009551 Bacteria 1950
138 Ga0105246_10140122 3300011119 Unclassified 1817
139 Ga0157373_10008465 3300013100 Bacteria 7638
140 Ga0157371_10090712 3300013102 Bacteria 2165
141 Ga0157370_10049541 3300013104 Bacteria 4020
142 Ga0157369_10052360 3300013105 Unclassified 4417
143 Ga0157369_10149084 3300013105 Bacteria 2472
144 Ga0157369_10191311 3300013105 Bacteria 2150
145 Ga0157369_10214779 3300013105 Bacteria 2015
146 Ga0157374_10000548 3300013296 Bacteria 33512
147 Ga0157374_10002949 3300013296 Bacteria 14248
148 Ga0157374_10031204 3300013296 Unclassified 4842
149 Ga0157374_10036739 3300013296 Bacteria 4490
150 Ga0157374_10048565 3300013296 Bacteria 3938
151 Ga0157374_10194250 3300013296 Bacteria 1986
152 Ga0157378_10000014 3300013297 Bacteria 144214
153 Ga0157378_10067175 3300013297 Bacteria 3212
154 Ga0163162_10000602 3300013306 Bacteria 33282
155 Ga0163162_10014745 3300013306 Bacteria 7639
156 Ga0163162_10088317 3300013306 Bacteria 3179
157 Ga0157372_10000673 3300013307 Bacteria 37615
158 Ga0157372_10002280 3300013307 Bacteria 20786
159 Ga0157372_10035832 3300013307 Bacteria 5464
160 Ga0157372_10043266 3300013307 Unclassified 4985
161 Ga0157372_10067667 3300013307 Unclassified 4014
162 Ga0157372_10095218 3300013307 Bacteria 3392
163 Ga0157372_10120481 3300013307 Bacteria 3013
164 Ga0157375_10003728 3300013308 Bacteria 13226
165 Ga0157375_10245767 3300013308 Unclassified 1950
166 Ga0157375_10487303 3300013308 Bacteria 1398
167 Ga0163163_10006753 3300014325 Bacteria 10058
168 Ga0163163_10036074 3300014325 Bacteria 4801
169 Ga0163163_10268340 3300014325 Bacteria 1758
170 Ga0163163_10404020 3300014325 Bacteria 1424
171 Ga0182008_10018606 3300014497 Bacteria 3595
172 Ga0182008_10073288 3300014497 Unclassified 1685
173 Ga0157379_10009671 3300014968 Bacteria 8392
174 Ga0182006_1030685 3300015261 Bacteria 2171
175 Ga0207656_10013944 3300025321 Unclassified 3084
176 Ga0207692_10025727 3300025898 Bacteria 2754
177 Ga0207680_10016399 3300025903 Unclassified 3887
178 Ga0207680_10104784 3300025903 Bacteria 1823
179 Ga0207647_10066306 3300025904 Unclassified 2189
180 Ga0207699_10010560 3300025906 Bacteria 4640
181 Ga0207654_10092936 3300025911 Bacteria 1843
182 Ga0207707_10005806 3300025912 Bacteria 10785
183 Ga0207695_10063948 3300025913 Bacteria 3791
184 Ga0207695_10070011 3300025913 Unclassified 3588
185 Ga0207695_10106157 3300025913 Bacteria 2795
186 Ga0207671_10119958 3300025914 Bacteria 2010
187 Ga0207671_10125020 3300025914 Bacteria 1969
188 Ga0207693_10000157 3300025915 Bacteria 63147
189 Ga0207693_10011805 3300025915 Bacteria 7059
190 Ga0207693_10058918 3300025915 Unclassified 3008
191 Ga0207663_10004623 3300025916 Bacteria 6861
192 Ga0207657_10003970 3300025919 Bacteria 15710
193 Ga0207657_10014258 3300025919 Bacteria 7769
194 Ga0207649_10000151 3300025920 Bacteria 56863
195 Ga0207681_10065990 3300025923 Bacteria 2504
196 Ga0207650_10000024 3300025925 Bacteria 299184
197 Ga0207650_10009274 3300025925 Bacteria 6724
198 Ga0207659_10004981 3300025926 Bacteria 8047
199 Ga0207687_10013485 3300025927 Bacteria 5336
200 Ga0207687_10168773 3300025927 Bacteria 1686
201 Ga0207700_10112164 3300025928 Bacteria 2196
202 Ga0207700_10273585 3300025928 Unclassified 1450
203 Ga0207664_10016218 3300025929 Bacteria 5428
204 Ga0207664_10099414 3300025929 Bacteria 2401
205 Ga0207664_10157837 3300025929 Unclassified 1932
206 Ga0207664_10164007 3300025929 Unclassified 1897
207 Ga0207644_10005335 3300025931 Bacteria 8389
208 Ga0207690_10020018 3300025932 Bacteria 4128
209 Ga0207706_10038330 3300025933 Bacteria 4252
210 Ga0207706_10047435 3300025933 Bacteria 3800
211 Ga0207706_10218188 3300025933 Unclassified 1671
212 Ga0207665_10089358 3300025939 Bacteria 2133
213 Ga0207691_10004141 3300025940 Bacteria 14090
214 Ga0207711_10007054 3300025941 Bacteria 9417
215 Ga0207689_10004340 3300025942 Bacteria 12917
216 Ga0207689_10119579 3300025942 Bacteria 2167
217 Ga0207689_10130219 3300025942 Bacteria 2070
218 Ga0207661_10000324 3300025944 Bacteria 30399
219 Ga0207661_10044996 3300025944 Bacteria 3491
220 Ga0207661_10127288 3300025944 Bacteria 2177
221 Ga0207679_10000040 3300025945 Bacteria 127317
222 Ga0207679_10039685 3300025945 Bacteria 3364
223 Ga0207679_10099875 3300025945 Bacteria 2267
224 Ga0207667_10004536 3300025949 Bacteria 17017
225 Ga0207667_10142298 3300025949 Unclassified 2470
226 Ga0207651_10015197 3300025960 Unclassified 4466
227 Ga0207668_10051467 3300025972 Bacteria 2845
228 Ga0207640_10007937 3300025981 Bacteria 5859
229 Ga0207640_10050901 3300025981 Bacteria 2690
230 Ga0207640_10060605 3300025981 Bacteria 2502
231 Ga0207658_10067528 3300025986 Bacteria 2694
232 Ga0207677_10017331 3300026023 Bacteria 4291
233 Ga0207703_10001215 3300026035 Bacteria 24082
234 Ga0207703_10006699 3300026035 Bacteria 9189
235 Ga0207639_10035150 3300026041 Bacteria 3707
236 Ga0207639_10058822 3300026041 Bacteria 2958
237 Ga0207678_10007066 3300026067 Bacteria 9968
238 Ga0207678_10010662 3300026067 Bacteria 8073
239 Ga0207702_10002114 3300026078 Bacteria 19137
240 Ga0207702_10110840 3300026078 Bacteria 2439
241 Ga0207702_10141838 3300026078 Bacteria 2175
242 Ga0207641_10000030 3300026088 Bacteria 224468
243 Ga0207641_10058592 3300026088 Bacteria 3278
244 Ga0207648_10041984 3300026089 Bacteria 4016
245 Ga0207676_10000192 3300026095 Bacteria 53242
246 Ga0207676_10000927 3300026095 Bacteria 22687
247 Ga0207676_10243497 3300026095 Unclassified 1615
248 Ga0207674_10000069 3300026116 Bacteria 106470
249 Ga0207674_10000203 3300026116 Bacteria 73537
250 Ga0207674_10045416 3300026116 Unclassified 4519
251 Ga0207674_10073188 3300026116 Unclassified 3440
252 Ga0207683_10031200 3300026121 Unclassified 4624
253 Ga0268266_10002454 3300028379 Bacteria 19876
254 Ga0268266_10002774 3300028379 Bacteria 18287
255 Ga0268265_10001424 3300028380 Bacteria 20240
256 Ga0268265_10164732 3300028380 Bacteria 1888
257 Ga0268264_10022831 3300028381 Bacteria 5105
258 Ga0265338_10032387 3300028800 Bacteria 5100
259 Ga0265339_10010132 3300031249 Bacteria 5869
260 Ga0265316_10020548 3300031344 Bacteria 5617
261 Ga0265342_10010763 3300031712 Bacteria 6310
262 Ga0373926_0013862 3300035083 Bacteria 2737
263 Ga0373936_0013859 3300035113 Bacteria 3078
264 Ga0373943_0017989 3300035170 Bacteria 3242
265 Ga0373946_0113642 3300035171 Unclassified 1228
266 Ga0373935_0036907 3300035692 Bacteria 3057
267 Ga0373927_0002654 3300035695 Bacteria 13038
268 Ga0373927_0106343 3300035695 Unclassified 1827
269 Ga0373927_0136944 3300035695 Unclassified 1601
270 Ga0373947_0009082 3300035725 Bacteria 5713
271 Ga0373925_0005860 3300037068 Bacteria 9111
272 Ga0373925_0084847 3300037068 Bacteria 2414
273 Ga0373925_0223652 3300037068 Unclassified 1503
274 Ga0466957_0023107 3300044842 Bacteria 3673
275 Ga0466967_0029757 3300045976 Bacteria 4576
276 Ga0466967_0039876 3300045976 Unclassified 4040
277 Ga0466967_0055098 3300045976 Unclassified 3502
278 Ga0495580_0009368 3300046472 Bacteria 7704
279 Ga0495580_0011610 3300046472 Bacteria 6813
280 Ga0495580_0017375 3300046472 Bacteria 5382
281 Ga0495580_0024247 3300046472 Bacteria 4445
282 Ga0495580_0044743 3300046472 Bacteria 3147
283 Ga0495582_0000224 3300046473 Bacteria 31305
284 Ga0495639_0046532 3300046475 Unclassified 1964
285 Ga0495630_0135394 3300046517 Unclassified 1872
286 Ga0495666_0032506 3300046526 Bacteria 2553
287 Ga0495635_0076504 3300046663 Bacteria 2294
288 Ga0495624_0108830 3300046690 Bacteria 1705
289 Ga0495581_0100655 3300047315 Bacteria 1679
290 Ga0495674_0171528 3300047319 Unclassified 1810
291 Ga0496101_0048419 3300048904 Unclassified 3055
292 Ga0496102_0000690 3300048905 Bacteria 33524
293 Ga0496103_0005165 3300048906 Bacteria 7856
294 Ga0496103_0074315 3300048906 Bacteria 2131
295 Ga0496103_0084816 3300048906 Unclassified 1996
296 Ga0496104_0026522 3300048907 Bacteria 5352
297 Ga0496104_0028800 3300048907 Bacteria 5148
298 Ga0496105_0057845 3300048908 Bacteria 3201
299 Ga0496106_0011489 3300048909 Bacteria 6550
300 Ga0496107_0081926 3300048910 Bacteria 2353
301 Ga0496107_0208963 3300048910 Bacteria 1451
302 Ga0496108_0001142 3300048911 Bacteria 20733
303 Ga0496108_0063082 3300048911 Bacteria 3120
304 Ga0496109_0000768 3300048912 Bacteria 26697
305 Ga0496109_0225487 3300048912 Unclassified 1763
306 Ga0496112_0000235 3300048915 Bacteria 35455
307 Ga0496112_0036249 3300048915 Bacteria 4811
308 Ga0496112_0044754 3300048915 Bacteria 4338
309 Ga0496112_0057648 3300048915 Unclassified 3824
310 Ga0496112_0058335 3300048915 Unclassified 3801
311 Ga0496112_0062168 3300048915 Unclassified 3683
312 Ga0496112_0110638 3300048915 Bacteria 2717
313 Ga0496112_0133051 3300048915 Bacteria 2458
314 Ga0496113_0008451 3300048916 Bacteria 6708
315 Ga0496115_0062743 3300048918 Bacteria 2998
316 Ga0501083_0092175 3300049744 Bacteria 2000
317 nmdc:mga0n895_291142_c1 3300050512 Bacteria 1656
318 nmdc:mga0rr50_134065_c1 3300050513 Bacteria 1986
319 nmdc:mga0rr50_586_c2 3300050513 Bacteria 9916
320 nmdc:mga08x19_106300_c1 3300050514 Bacteria 1867
321 nmdc:mga08x19_7755_c1 3300050514 Bacteria 6376
322 Ga0466962_0070992 3300061719 Unclassified 1664
323 Ga0070697_100001456
324 rootH1_10034318
325 Ga0065712_10122265
326 Ga0070683_100048358
327 Ga0070670_100003024
328 Ga0070670_100007117
329 Ga0068869_100000409
330 Ga0068869_100089482
331 Ga0068869_100110087
332 Ga0068869_100119416
333 Ga0070666_10018456
334 Ga0070666_10041405
335 Ga0070680_100062853
336 Ga0068868_100008296
337 Ga0068868_100324355
338 Ga0070689_100062076
339 Ga0070689_100065514
340 Ga0070661_100047234
341 Ga0070668_100059631
342 Ga0070668_100281275
343 Ga0070675_100010047
344 Ga0070671_100023856
345 Ga0070673_100023333
346 Ga0070667_100124215
347 Ga0070709_10004727
348 Ga0070714_100004457
349 Ga0070714_100011855
350 Ga0070714_100019474
351 Ga0070714_100397378
352 Ga0070713_100003300
353 Ga0070713_100012588
354 Ga0070713_100022788
355 Ga0070713_100024028
356 Ga0070713_100061317
357 Ga0070710_10013295
358 Ga0070711_100002533
359 Ga0070708_100004627
360 Ga0070708_100008441
361 Ga0070708_100096407
362 Ga0070708_100236312
363 Ga0070663_100019415
364 Ga0070678_100052337
365 Ga0070662_100053046
366 Ga0070662_100064196
367 Ga0070662_100088345
368 Ga0070681_10000353
369 Ga0070681_10140451
370 Ga0070681_10195299
371 Ga0068867_100186861
372 Ga0070685_10002192
373 Ga0070707_100156343
374 Ga0070699_100024605
375 Ga0070699_100105370
376 Ga0070699_100188488
377 Ga0070684_100044925
378 Ga0070697_100000017
379 Ga0070697_100030977
380 Ga0070697_100085764
381 Ga0070672_100000881
382 Ga0070696_100138777
383 Ga0070693_100052209
384 Ga0070665_100085999
385 Ga0070665_100165366
386 Ga0068855_100002474
387 Ga0068855_100049497
388 Ga0068855_100053028
389 Ga0068855_100066171
390 Ga0068855_100233144
391 Ga0068855_100300269
392 Ga0070664_100000411
393 Ga0070664_100007511
394 Ga0070664_100087967
395 Ga0068857_100000034
396 Ga0068857_100003746
397 Ga0068857_100071314
398 Ga0068854_100001168
399 Ga0068854_100089644
400 Ga0068856_100000153
401 Ga0068856_100073759
402 Ga0068856_100095910
403 Ga0068856_100129704
404 Ga0068856_100211818
405 Ga0068852_100087202
406 Ga0068859_100012906
407 Ga0068859_100024086
408 Ga0068864_100000879
409 Ga0068864_100001949
410 Ga0068863_100001146
411 Ga0068863_100110538
412 Ga0068858_100005617
413 Ga0068858_100068235
414 Ga0068858_100074575
415 Ga0068860_100089557
416 Ga0068860_100191746
417 Ga0068862_100002776
418 Ga0068862_100122524
419 Ga0070717_10001547
420 Ga0070717_10005696
421 Ga0070717_10009052
422 Ga0070717_10009147
423 Ga0070717_10034646
424 Ga0070716_100000294
425 Ga0070716_100027037
426 Ga0070712_100000628
427 Ga0070712_100001058
428 Ga0097621_100042146
429 Ga0097621_100082672
430 Ga0097621_100251502
431 Ga0068871_100005933
432 Ga0068871_100010673
433 Ga0075434_100290721
434 Ga0075434_100385015
435 Ga0075436_100001278
436 Ga0097620_100012906
437 Ga0097620_100024085
438 Ga0075435_100001821
439 Ga0105240_10046370
440 Ga0105240_10117676
441 Ga0105240_10174595
442 Ga0105240_10175136
443 Ga0105245_10022288
444 Ga0105245_10106248
445 Ga0105245_10117636
446 Ga0105245_10133449
447 Ga0105245_10352585
448 Ga0105241_10024336
449 Ga0105241_10042974
450 Ga0105241_10054175
451 Ga0105241_10106794
452 Ga0105242_10074713
453 Ga0105242_10079076
454 Ga0105248_10003820
455 Ga0105248_10020446
456 Ga0105237_10043455
457 Ga0105238_10057628
458 Ga0105238_10099011
459 Ga0105238_10204526
460 Ga0105246_10140122
461 Ga0157373_10008465
462 Ga0157371_10090712
463 Ga0157370_10049541
464 Ga0157369_10052360
465 Ga0157369_10149084
466 Ga0157369_10191311
467 Ga0157369_10214779
468 Ga0157374_10000548
469 Ga0157374_10002949
470 Ga0157374_10031204
471 Ga0157374_10036739
472 Ga0157374_10048565
473 Ga0157374_10194250
474 Ga0157378_10000014
475 Ga0157378_10067175
476 Ga0163162_10000602
477 Ga0163162_10014745
478 Ga0163162_10088317
479 Ga0157372_10000673
480 Ga0157372_10002280
481 Ga0157372_10035832
482 Ga0157372_10043266
483 Ga0157372_10067667
484 Ga0157372_10095218
485 Ga0157372_10120481
486 Ga0157375_10003728
487 Ga0157375_10245767
488 Ga0157375_10487303
489 Ga0163163_10006753
490 Ga0163163_10036074
491 Ga0163163_10268340
492 Ga0163163_10404020
493 Ga0182008_10018606
494 Ga0182008_10073288
495 Ga0157379_10009671
496 Ga0182006_1030685
497 Ga0207656_10013944
498 Ga0207692_10025727
499 Ga0207680_10016399
500 Ga0207680_10104784
501 Ga0207647_10066306
502 Ga0207699_10010560
503 Ga0207654_10092936
504 Ga0207707_10005806
505 Ga0207695_10063948
506 Ga0207695_10070011
507 Ga0207695_10106157
508 Ga0207671_10119958
509 Ga0207671_10125020
510 Ga0207693_10000157
511 Ga0207693_10011805
512 Ga0207693_10058918
513 Ga0207663_10004623
514 Ga0207657_10003970
515 Ga0207657_10014258
516 Ga0207649_10000151
517 Ga0207681_10065990
518 Ga0207650_10000024
519 Ga0207650_10009274
520 Ga0207659_10004981
521 Ga0207687_10013485
522 Ga0207687_10168773
523 Ga0207700_10112164
524 Ga0207700_10273585
525 Ga0207664_10016218
526 Ga0207664_10099414
527 Ga0207664_10157837
528 Ga0207664_10164007
529 Ga0207644_10005335
530 Ga0207690_10020018
531 Ga0207706_10038330
532 Ga0207706_10047435
533 Ga0207706_10218188
534 Ga0207665_10089358
535 Ga0207691_10004141
536 Ga0207711_10007054
537 Ga0207689_10004340
538 Ga0207689_10119579
539 Ga0207689_10130219
540 Ga0207661_10000324
541 Ga0207661_10044996
542 Ga0207661_10127288
543 Ga0207679_10000040
544 Ga0207679_10039685
545 Ga0207679_10099875
546 Ga0207667_10004536
547 Ga0207667_10142298
548 Ga0207651_10015197
549 Ga0207668_10051467
550 Ga0207640_10007937
551 Ga0207640_10050901
552 Ga0207640_10060605
553 Ga0207658_10067528
554 Ga0207677_10017331
555 Ga0207703_10001215
556 Ga0207703_10006699
557 Ga0207639_10035150
558 Ga0207639_10058822
559 Ga0207678_10007066
560 Ga0207678_10010662
561 Ga0207702_10002114
562 Ga0207702_10110840
563 Ga0207702_10141838
564 Ga0207641_10000030
565 Ga0207641_10058592
566 Ga0207648_10041984
567 Ga0207676_10000192
568 Ga0207676_10000927
569 Ga0207676_10243497
570 Ga0207674_10000069
571 Ga0207674_10000203
572 Ga0207674_10045416
573 Ga0207674_10073188
574 Ga0207683_10031200
575 Ga0268266_10002454
576 Ga0268266_10002774
577 Ga0268265_10001424
578 Ga0268265_10164732
579 Ga0268264_10022831
580 Ga0265338_10032387
581 Ga0265339_10010132
582 Ga0265316_10020548
583 Ga0265342_10010763
584 Ga0373926_0013862
585 Ga0373936_0013859
586 Ga0373943_0017989
587 Ga0373946_0113642
588 Ga0373935_0036907
589 Ga0373927_0002654
590 Ga0373927_0106343
591 Ga0373927_0136944
592 Ga0373947_0009082
593 Ga0373925_0005860
594 Ga0373925_0084847
595 Ga0373925_0223652
596 Ga0466957_0023107
597 Ga0466967_0029757
598 Ga0466967_0039876
599 Ga0466967_0055098
600 Ga0495580_0009368
601 Ga0495580_0011610
602 Ga0495580_0017375
603 Ga0495580_0024247
604 Ga0495580_0044743
605 Ga0495582_0000224
606 Ga0495639_0046532
607 Ga0495630_0135394
608 Ga0495666_0032506
609 Ga0495635_0076504
610 Ga0495624_0108830
611 Ga0495581_0100655
612 Ga0495674_0171528
613 Ga0496101_0048419
614 Ga0496102_0000690
615 Ga0496103_0005165
616 Ga0496103_0074315
617 Ga0496103_0084816
618 Ga0496104_0026522
619 Ga0496104_0028800
620 Ga0496105_0057845
621 Ga0496106_0011489
622 Ga0496107_0081926
623 Ga0496107_0208963
624 Ga0496108_0001142
625 Ga0496108_0063082
626 Ga0496109_0000768
627 Ga0496109_0225487
628 Ga0496112_0000235
629 Ga0496112_0036249
630 Ga0496112_0044754
631 Ga0496112_0057648
632 Ga0496112_0058335
633 Ga0496112_0062168
634 Ga0496112_0110638
635 Ga0496112_0133051
636 Ga0496113_0008451
637 Ga0496115_0062743
638 Ga0501083_0092175
639 nmdc:mga0n895_291142_c1
640 nmdc:mga0rr50_134065_c1
641 nmdc:mga0rr50_586_c2
642 nmdc:mga08x19_106300_c1
643 nmdc:mga08x19_7755_c1
644 Ga0466962_0070992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cc0-assembly1.cif.gz_B family 4 carbohydrate esterase from streptomyces lividans in complex with acetate 0.7555 23 349
5lgc-assembly1.cif.gz_A t48 deacetylase with substrate 0.7403 22 346
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.7229 23 341
7ax7-assembly1.cif.gz_A crystal structure of the xyl-ce4 domain of a multidomain xylanase from the hindgut metagenome of trinervitermes trinervoides 0.7226 22 346
2iw0-assembly1.cif.gz_A structure of the chitin deacetylase from the fungal pathogen colletotrichum lindemuthianum 0.716 19 346
ID Description Score Start End Superfamily
2cc0B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7555 23 349 3.20.20.370
5lgcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7403 22 346 3.20.20.370
af_P71837_4_164_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7382 114 268 3.20.20.370
2iw0A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.716 19 346 3.20.20.370
2c79A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7082 24 341 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A2V9WEX1-F1-model_v4 Uncharacterized protein 0.9461 35 186
AF-A0A2V9ZZ58-F1-model_v4 Uncharacterized protein 0.9408 14 386
AF-A0A2V9WEX1-F1-model_v4 Uncharacterized protein 0.9402 35 186
AF-A0A2V9ZZ58-F1-model_v4 Uncharacterized protein 0.9286 14 386
AF-A0A1Y2K3Q9-F1-model_v4 Putative Glycosyl hydrolase family 57 0.8997 44 357 GO:0005975
GO:0016787

Map