F406304

General Info

Members Datasets Scaffolds Average Seq Length
322 161 644 103

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_11305135|Ga0070666_113051351
Length 103
Sequence MKQKTEQGVVQEKLVLQLYVSGMSQKSMEAIKNIKQLCSEHLKDDAYDLSIIDIYKHPEMAHEQQIVFSPSLIKKLPEPKKILIGNLSNAEKVIKALGITFKE

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
130 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 2.17
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 31.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_11305135 3300005335 Bacteria 541
2 rootH2_10022652 3300003320 Bacteria 10825
3 Ga0070658_10001315 3300005327 Bacteria 21189
4 Ga0070658_10136753 3300005327 Bacteria 2045
5 Ga0070676_10006915 3300005328 Bacteria 6074
6 Ga0070683_100370623 3300005329 Bacteria 1364
7 Ga0070683_101119814 3300005329 Unclassified 756
8 Ga0070690_100063995 3300005330 Bacteria 2375
9 Ga0070670_101256570 3300005331 Unclassified 677
10 Ga0070677_10517056 3300005333 Unclassified 649
11 Ga0068869_101255033 3300005334 Unclassified 653
12 Ga0068869_101526046 3300005334 Unclassified 593
13 Ga0070666_10451135 3300005335 Bacteria 929
14 Ga0070682_100000270 3300005337 Bacteria 37373
15 Ga0070682_101323112 3300005337 Unclassified 613
16 Ga0068868_100035476 3300005338 Bacteria 3855
17 Ga0068868_100173218 3300005338 Unclassified 1787
18 Ga0068868_100350237 3300005338 Bacteria 1265
19 Ga0070660_100265102 3300005339 Bacteria 1403
20 Ga0070660_100609194 3300005339 Bacteria 913
21 Ga0070661_101339192 3300005344 Bacteria 601
22 Ga0070661_101418232 3300005344 Bacteria 584
23 Ga0070668_100000978 3300005347 Bacteria 20027
24 Ga0070675_100522272 3300005354 Bacteria 1071
25 Ga0070675_100919240 3300005354 Unclassified 802
26 Ga0070671_100037628 3300005355 Bacteria 4013
27 Ga0070671_101461172 3300005355 Unclassified 604
28 Ga0070673_100021169 3300005364 Bacteria 4708
29 Ga0070673_100698957 3300005364 Bacteria 931
30 Ga0070673_101225377 3300005364 Bacteria 703
31 Ga0070659_100028175 3300005366 Bacteria 4335
32 Ga0070667_100002137 3300005367 Bacteria 17407
33 Ga0070667_101029545 3300005367 Unclassified 768
34 Ga0070667_101118798 3300005367 Bacteria 736
35 Ga0070667_101324212 3300005367 Bacteria 675
36 Ga0070667_101769876 3300005367 Unclassified 581
37 Ga0070678_100089224 3300005456 Bacteria 2359
38 Ga0070678_100117335 3300005456 Bacteria 2093
39 Ga0070662_100291700 3300005457 Bacteria 1323
40 Ga0070681_10101248 3300005458 Bacteria 2826
41 Ga0068867_100027995 3300005459 Bacteria 4055
42 Ga0068867_100463879 3300005459 Unclassified 1082
43 Ga0070684_100651788 3300005535 Bacteria 980
44 Ga0070684_102226877 3300005535 Bacteria 517
45 Ga0068853_100018132 3300005539 Bacteria 5821
46 Ga0068853_100042566 3300005539 Unclassified 3884
47 Ga0068853_101179156 3300005539 Unclassified 739
48 Ga0070672_100296480 3300005543 Bacteria 1370
49 Ga0070672_100503316 3300005543 Unclassified 1048
50 Ga0070672_101663979 3300005543 Bacteria 573
51 Ga0070686_100580217 3300005544 Unclassified 881
52 Ga0070686_101386383 3300005544 Bacteria 589
53 Ga0070693_100052412 3300005547 Unclassified 2339
54 Ga0070665_100111522 3300005548 Bacteria 2737
55 Ga0070665_102401781 3300005548 Unclassified 529
56 Ga0068855_100720495 3300005563 Bacteria 1066
57 Ga0070664_100092628 3300005564 Unclassified 2617
58 Ga0070664_100242420 3300005564 Bacteria 1618
59 Ga0068854_100004997 3300005578 Bacteria 8363
60 Ga0068854_101272321 3300005578 Unclassified 661
61 Ga0068856_100037916 3300005614 Unclassified 4730
62 Ga0070702_100071424 3300005615 Bacteria 2052
63 Ga0068852_100024479 3300005616 Unclassified 4880
64 Ga0068852_100203771 3300005616 Bacteria 1873
65 Ga0068852_100271253 3300005616 Bacteria 1633
66 Ga0068852_100348273 3300005616 Bacteria 1446
67 Ga0068852_100558988 3300005616 Bacteria 1145
68 Ga0068864_100146500 3300005618 Unclassified 2135
69 Ga0068864_101215612 3300005618 Bacteria 752
70 Ga0068864_101560625 3300005618 Unclassified 664
71 Ga0068864_101783850 3300005618 Bacteria 620
72 Ga0068861_100498821 3300005719 Bacteria 1100
73 Ga0068870_10147391 3300005840 Unclassified 1383
74 Ga0068863_100196506 3300005841 Bacteria 1939
75 Ga0068863_100586591 3300005841 Bacteria 1102
76 Ga0068858_100000347 3300005842 Bacteria 49031
77 Ga0068858_101305974 3300005842 Bacteria 714
78 Ga0068858_101858356 3300005842 Unclassified 595
79 Ga0068860_100013878 3300005843 Bacteria 7900
80 Ga0068860_100098681 3300005843 Bacteria 2785
81 Ga0068862_101157765 3300005844 Unclassified 770
82 Ga0070715_10324510 3300006163 Bacteria 832
83 Ga0070715_10441091 3300006163 Bacteria 733
84 Ga0070716_101603723 3300006173 Bacteria 534
85 Ga0097621_100031526 3300006237 Bacteria 4207
86 Ga0097621_100459409 3300006237 Bacteria 1148
87 Ga0097621_100564196 3300006237 Bacteria 1037
88 Ga0068871_100056217 3300006358 Bacteria 3198
89 Ga0068871_100212959 3300006358 Unclassified 1672
90 Ga0068871_100941844 3300006358 Unclassified 802
91 Ga0068871_101415902 3300006358 Bacteria 655
92 Ga0075428_100740960 3300006844 Bacteria 1046
93 Ga0075430_101284970 3300006846 Bacteria 602
94 Ga0075431_100883025 3300006847 Unclassified 864
95 Ga0075429_100960274 3300006880 Unclassified 747
96 Ga0068865_100069626 3300006881 Unclassified 2490
97 Ga0097620_100150115 3300006931 Bacteria 2406
98 Ga0105240_10065521 3300009093 Unclassified 4509
99 Ga0105240_10306636 3300009093 Unclassified 1815
100 Ga0111539_10166428 3300009094 Bacteria 2577
101 Ga0111539_11535268 3300009094 Unclassified 772
102 Ga0111539_12444208 3300009094 Bacteria 606
103 Ga0105245_10679792 3300009098 Bacteria 1061
104 Ga0105245_10759392 3300009098 Bacteria 1006
105 Ga0105245_13122263 3300009098 Unclassified 513
106 Ga0105241_10104156 3300009174 Bacteria 2260
107 Ga0105241_10169918 3300009174 Unclassified 1800
108 Ga0105241_11360160 3300009174 Bacteria 678
109 Ga0105242_10485294 3300009176 Bacteria 1172
110 Ga0105242_10658833 3300009176 Bacteria 1019
111 Ga0105242_11997410 3300009176 Bacteria 622
112 Ga0105242_12128236 3300009176 Bacteria 605
113 Ga0105237_10005678 3300009545 Bacteria 14036
114 Ga0105237_10030800 3300009545 Bacteria 5446
115 Ga0105237_10421956 3300009545 Unclassified 1339
116 Ga0105237_11021011 3300009545 Bacteria 834
117 Ga0105237_11353298 3300009545 Unclassified 718
118 Ga0105238_10001145 3300009551 Bacteria 26746
119 Ga0105238_10299918 3300009551 Unclassified 1590
120 Ga0105238_10547404 3300009551 Bacteria 1161
121 Ga0105249_10268692 3300009553 Bacteria 1698
122 Ga0105239_10000128 3300010375 Bacteria 107095
123 Ga0105239_10011634 3300010375 Bacteria 9818
124 Ga0105239_10186740 3300010375 Bacteria 2320
125 Ga0105239_10598688 3300010375 Bacteria 1257
126 Ga0105239_11121499 3300010375 Unclassified 906
127 Ga0105239_11227571 3300010375 Bacteria 864
128 Ga0157373_10042020 3300013100 Unclassified 3268
129 Ga0157371_10245644 3300013102 Bacteria 1288
130 Ga0157371_10626446 3300013102 Unclassified 801
131 Ga0157370_10124903 3300013104 Bacteria 2402
132 Ga0157370_10326824 3300013104 Bacteria 1414
133 Ga0157370_11713655 3300013104 Bacteria 564
134 Ga0157369_10023743 3300013105 Bacteria 6827
135 Ga0157369_10061206 3300013105 Unclassified 4059
136 Ga0157369_10274710 3300013105 Bacteria 1755
137 Ga0157369_10491065 3300013105 Bacteria 1270
138 Ga0157374_10000004 3300013296 Bacteria 759774
139 Ga0157374_10020769 3300013296 Bacteria 5831
140 Ga0157374_10058270 3300013296 Bacteria 3609
141 Ga0157374_10110696 3300013296 Bacteria 2641
142 Ga0157374_10168877 3300013296 Bacteria 2133
143 Ga0157374_10361765 3300013296 Unclassified 1443
144 Ga0157374_10849739 3300013296 Bacteria 929
145 Ga0157374_10908025 3300013296 Bacteria 898
146 Ga0157374_11563857 3300013296 Unclassified 683
147 Ga0157374_11770413 3300013296 Unclassified 643
148 Ga0157374_11887976 3300013296 Bacteria 623
149 Ga0157378_10025479 3300013297 Bacteria 5207
150 Ga0157378_10110305 3300013297 Bacteria 2522
151 Ga0157378_10149967 3300013297 Archaea 2172
152 Ga0157378_11504503 3300013297 Bacteria 718
153 Ga0157378_11629846 3300013297 Unclassified 691
154 Ga0157378_11878453 3300013297 Bacteria 648
155 Ga0163162_10001987 3300013306 Bacteria 19218
156 Ga0163162_10028871 3300013306 Bacteria 5490
157 Ga0163162_10038044 3300013306 Bacteria 4802
158 Ga0163162_10081461 3300013306 Unclassified 3307
159 Ga0163162_10160881 3300013306 Bacteria 2367
160 Ga0163162_10241891 3300013306 Bacteria 1936
161 Ga0163162_10607048 3300013306 Bacteria 1220
162 Ga0157372_10000231 3300013307 Bacteria 62248
163 Ga0157372_10126020 3300013307 Bacteria 2944
164 Ga0157372_10139052 3300013307 Bacteria 2797
165 Ga0157372_10299203 3300013307 Unclassified 1871
166 Ga0157372_10493358 3300013307 Bacteria 1428
167 Ga0157372_11287447 3300013307 Unclassified 844
168 Ga0157372_11744218 3300013307 Bacteria 716
169 Ga0157372_12224470 3300013307 Bacteria 630
170 Ga0157375_10022090 3300013308 Bacteria 5852
171 Ga0157375_10024035 3300013308 Bacteria 5633
172 Ga0157375_10061636 3300013308 Bacteria 3725
173 Ga0157375_10082760 3300013308 Bacteria 3252
174 Ga0157375_10124177 3300013308 Bacteria 2694
175 Ga0157375_10219910 3300013308 Bacteria 2058
176 Ga0157375_10541889 3300013308 Bacteria 1326
177 Ga0157375_11550248 3300013308 Bacteria 783
178 Ga0157375_12423376 3300013308 Bacteria 626
179 Ga0163163_10001834 3300014325 Bacteria 17938
180 Ga0163163_10093403 3300014325 Bacteria 3025
181 Ga0163163_10136951 3300014325 Bacteria 2490
182 Ga0163163_11370804 3300014325 Bacteria 769
183 Ga0157380_10000065 3300014326 Bacteria 60148
184 Ga0157377_10032562 3300014745 Bacteria 2839
185 Ga0157379_10000175 3300014968 Bacteria 48257
186 Ga0157379_10259998 3300014968 Bacteria 1577
187 Ga0157379_10782136 3300014968 Viruses 900
188 Ga0157376_10000133 3300014969 Bacteria 51459
189 Ga0157376_10008519 3300014969 Bacteria 7407
190 Ga0157376_10030544 3300014969 Bacteria 4303
191 Ga0157376_10065230 3300014969 Unclassified 3074
192 Ga0157376_10065715 3300014969 Bacteria 3064
193 Ga0157376_10146946 3300014969 Unclassified 2121
194 Ga0157376_10253258 3300014969 Bacteria 1646
195 Ga0157376_10504722 3300014969 Unclassified 1189
196 Ga0157376_11940315 3300014969 Bacteria 626
197 Ga0163161_10038007 3300017792 Bacteria 3451
198 Ga0163161_10917319 3300017792 Unclassified 743
199 Ga0207656_10663137 3300025321 Bacteria 534
200 Ga0207682_10388324 3300025893 Unclassified 659
201 Ga0207682_10411104 3300025893 Unclassified 640
202 Ga0207688_10106592 3300025901 Bacteria 1623
203 Ga0207680_10420911 3300025903 Bacteria 946
204 Ga0207647_10011395 3300025904 Bacteria 6235
205 Ga0207685_10243550 3300025905 Bacteria 866
206 Ga0207645_10010295 3300025907 Bacteria 6424
207 Ga0207705_10141493 3300025909 Bacteria 1797
208 Ga0207705_10572813 3300025909 Bacteria 878
209 Ga0207654_10065809 3300025911 Bacteria 2135
210 Ga0207654_10155331 3300025911 Bacteria 1473
211 Ga0207707_10148680 3300025912 Bacteria 2048
212 Ga0207695_10041120 3300025913 Bacteria 4949
213 Ga0207695_10044591 3300025913 Bacteria 4715
214 Ga0207695_10058072 3300025913 Unclassified 4017
215 Ga0207671_10005973 3300025914 Bacteria 11024
216 Ga0207671_10018649 3300025914 Bacteria 5317
217 Ga0207657_10597507 3300025919 Bacteria 861
218 Ga0207657_10718367 3300025919 Unclassified 775
219 Ga0207649_11127818 3300025920 Bacteria 619
220 Ga0207694_10331355 3300025924 Bacteria 1257
221 Ga0207650_10425271 3300025925 Bacteria 1103
222 Ga0207659_11114500 3300025926 Unclassified 679
223 Ga0207687_10215880 3300025927 Bacteria 1507
224 Ga0207687_10482618 3300025927 Bacteria 1032
225 Ga0207690_10002073 3300025932 Bacteria 12290
226 Ga0207706_10302075 3300025933 Bacteria 1394
227 Ga0207669_11794325 3300025937 Unclassified 524
228 Ga0207704_10086695 3300025938 Unclassified 2043
229 Ga0207704_11056999 3300025938 Unclassified 689
230 Ga0207691_10002688 3300025940 Bacteria 17384
231 Ga0207691_10041687 3300025940 Bacteria 4237
232 Ga0207691_10101682 3300025940 Unclassified 2564
233 Ga0207689_10076994 3300025942 Bacteria 2742
234 Ga0207689_11021252 3300025942 Unclassified 697
235 Ga0207661_10320123 3300025944 Bacteria 1394
236 Ga0207679_10073461 3300025945 Unclassified 2588
237 Ga0207667_10516594 3300025949 Bacteria 1210
238 Ga0207651_10363398 3300025960 Bacteria 1222
239 Ga0207712_10553342 3300025961 Bacteria 990
240 Ga0207640_10003587 3300025981 Bacteria 8365
241 Ga0207640_10864803 3300025981 Bacteria 787
242 Ga0207640_11235488 3300025981 Unclassified 665
243 Ga0207658_11221049 3300025986 Bacteria 687
244 Ga0207677_10016039 3300026023 Bacteria 4425
245 Ga0207677_10540805 3300026023 Bacteria 1014
246 Ga0207677_11449729 3300026023 Unclassified 633
247 Ga0207703_10401270 3300026035 Bacteria 1272
248 Ga0207703_11008471 3300026035 Bacteria 799
249 Ga0207703_11920104 3300026035 Unclassified 568
250 Ga0207639_10046889 3300026041 Unclassified 3263
251 Ga0207639_10053099 3300026041 Bacteria 3090
252 Ga0207639_11981073 3300026041 Unclassified 543
253 Ga0207702_10026947 3300026078 Unclassified 4773
254 Ga0207702_10926703 3300026078 Unclassified 863
255 Ga0207648_10025932 3300026089 Bacteria 5214
256 Ga0207648_10697904 3300026089 Unclassified 940
257 Ga0207676_10621452 3300026095 Bacteria 1040
258 Ga0207676_10695183 3300026095 Bacteria 985
259 Ga0207676_11292004 3300026095 Unclassified 724
260 Ga0207675_100041847 3300026118 Bacteria 4278
261 Ga0207675_100600258 3300026118 Unclassified 1104
262 Ga0207683_10080910 3300026121 Bacteria 2882
263 Ga0207683_10113872 3300026121 Bacteria 2423
264 Ga0207698_10168601 3300026142 Bacteria 1925
265 Ga0207698_10244502 3300026142 Unclassified 1638
266 Ga0207698_11176413 3300026142 Bacteria 781
267 Ga0207698_11554662 3300026142 Unclassified 677
268 Ga0207698_11705488 3300026142 Unclassified 645
269 Ga0207698_12551731 3300026142 Bacteria 521
270 Ga0207428_10839432 3300027907 Bacteria 651
271 Ga0268266_12030437 3300028379 Unclassified 548
272 Ga0268265_10943950 3300028380 Unclassified 849
273 Ga0268264_10009839 3300028381 Bacteria 7914
274 Ga0268264_10016588 3300028381 Bacteria 6031
275 Ga0373953_0498591 3300035117 Bacteria 540
276 Ga0373924_0541938 3300035410 Bacteria 524
277 Ga0373931_0435677 3300035691 Bacteria 836
278 Ga0373935_1233711 3300035692 Bacteria 558
279 Ga0373933_0377693 3300035724 Bacteria 923
280 Ga0373937_0105575 3300036401 Bacteria 2618
281 Ga0373937_0385928 3300036401 Bacteria 1328
282 Ga0373937_1788734 3300036401 Unclassified 561
283 Ga0265778_001616 3300036457 Bacteria 2078
284 Ga0436365_1629470 3300039437 Bacteria 914
285 Ga0451787_765347 3300041441 Bacteria 529
286 Ga0451798_0525462 3300041458 Bacteria 898
287 Ga0451807_1023154 3300041486 Unclassified 1694
288 Ga0451807_2075102 3300041486 Bacteria 751
289 Ga0451839_0573515 3300041496 Unclassified 575
290 Ga0451853_1894853 3300041512 Bacteria 684
291 Ga0439435_0099939 3300042436 Unclassified 890
292 Ga0466967_2205610 3300045976 Unclassified 547
293 Ga0495651_0605048 3300046462 Bacteria 691
294 Ga0495606_0014462 3300046507 Bacteria 6156
295 Ga0495606_0080651 3300046507 Bacteria 2024
296 Ga0495608_0744141 3300046511 Bacteria 581
297 Ga0495628_0999409 3300046516 Unclassified 576
298 Ga0495630_0246040 3300046517 Bacteria 1366
299 Ga0495652_0134931 3300046529 Unclassified 1949
300 Ga0495586_0060117 3300046535 Unclassified 2066
301 Ga0495587_0254381 3300046536 Bacteria 987
302 Ga0495645_0084894 3300046543 Unclassified 2267
303 Ga0495645_0447669 3300046543 Unclassified 815
304 Ga0495634_0108271 3300046642 Unclassified 1789
305 Ga0495581_0551476 3300047315 Bacteria 669
306 Ga0495674_0020023 3300047319 Bacteria 6203
307 Ga0495674_0173263 3300047319 Bacteria 1800
308 Ga0495684_0074400 3300047471 Unclassified 2581
309 Ga0496105_0480689 3300048908 Unclassified 977
310 Ga0496107_1120751 3300048910 Unclassified 568
311 Ga0496115_0538721 3300048918 Unclassified 934
312 Ga0501047_0426830 3300049581 Bacteria 1157
313 nmdc:mga09592_1391657_c1 3300050508 Unclassified 574
314 nmdc:mga0qj67_1250923_c1 3300050509 Bacteria 576
315 nmdc:mga06r32_857976_c1 3300050510 Unclassified 866
316 nmdc:mga08y16_1200707_c1 3300050511 Unclassified 729
317 nmdc:mga08y16_358167_c1 3300050511 Bacteria 1498
318 Ga0495595_0383895 3300053084 Unclassified 711
319 Ga0495619_0110423 3300053085 Unclassified 1879
320 Ga0500578_0421501 3300053086 Unclassified 765
321 Ga0500568_0044026 3300053139 Bacteria 1782
322 Ga0500616_0070336 3300053153 Bacteria 1787
323 Ga0070666_11305135
324 rootH2_10022652
325 Ga0070658_10001315
326 Ga0070658_10136753
327 Ga0070676_10006915
328 Ga0070683_100370623
329 Ga0070683_101119814
330 Ga0070690_100063995
331 Ga0070670_101256570
332 Ga0070677_10517056
333 Ga0068869_101255033
334 Ga0068869_101526046
335 Ga0070666_10451135
336 Ga0070682_100000270
337 Ga0070682_101323112
338 Ga0068868_100035476
339 Ga0068868_100173218
340 Ga0068868_100350237
341 Ga0070660_100265102
342 Ga0070660_100609194
343 Ga0070661_101339192
344 Ga0070661_101418232
345 Ga0070668_100000978
346 Ga0070675_100522272
347 Ga0070675_100919240
348 Ga0070671_100037628
349 Ga0070671_101461172
350 Ga0070673_100021169
351 Ga0070673_100698957
352 Ga0070673_101225377
353 Ga0070659_100028175
354 Ga0070667_100002137
355 Ga0070667_101029545
356 Ga0070667_101118798
357 Ga0070667_101324212
358 Ga0070667_101769876
359 Ga0070678_100089224
360 Ga0070678_100117335
361 Ga0070662_100291700
362 Ga0070681_10101248
363 Ga0068867_100027995
364 Ga0068867_100463879
365 Ga0070684_100651788
366 Ga0070684_102226877
367 Ga0068853_100018132
368 Ga0068853_100042566
369 Ga0068853_101179156
370 Ga0070672_100296480
371 Ga0070672_100503316
372 Ga0070672_101663979
373 Ga0070686_100580217
374 Ga0070686_101386383
375 Ga0070693_100052412
376 Ga0070665_100111522
377 Ga0070665_102401781
378 Ga0068855_100720495
379 Ga0070664_100092628
380 Ga0070664_100242420
381 Ga0068854_100004997
382 Ga0068854_101272321
383 Ga0068856_100037916
384 Ga0070702_100071424
385 Ga0068852_100024479
386 Ga0068852_100203771
387 Ga0068852_100271253
388 Ga0068852_100348273
389 Ga0068852_100558988
390 Ga0068864_100146500
391 Ga0068864_101215612
392 Ga0068864_101560625
393 Ga0068864_101783850
394 Ga0068861_100498821
395 Ga0068870_10147391
396 Ga0068863_100196506
397 Ga0068863_100586591
398 Ga0068858_100000347
399 Ga0068858_101305974
400 Ga0068858_101858356
401 Ga0068860_100013878
402 Ga0068860_100098681
403 Ga0068862_101157765
404 Ga0070715_10324510
405 Ga0070715_10441091
406 Ga0070716_101603723
407 Ga0097621_100031526
408 Ga0097621_100459409
409 Ga0097621_100564196
410 Ga0068871_100056217
411 Ga0068871_100212959
412 Ga0068871_100941844
413 Ga0068871_101415902
414 Ga0075428_100740960
415 Ga0075430_101284970
416 Ga0075431_100883025
417 Ga0075429_100960274
418 Ga0068865_100069626
419 Ga0097620_100150115
420 Ga0105240_10065521
421 Ga0105240_10306636
422 Ga0111539_10166428
423 Ga0111539_11535268
424 Ga0111539_12444208
425 Ga0105245_10679792
426 Ga0105245_10759392
427 Ga0105245_13122263
428 Ga0105241_10104156
429 Ga0105241_10169918
430 Ga0105241_11360160
431 Ga0105242_10485294
432 Ga0105242_10658833
433 Ga0105242_11997410
434 Ga0105242_12128236
435 Ga0105237_10005678
436 Ga0105237_10030800
437 Ga0105237_10421956
438 Ga0105237_11021011
439 Ga0105237_11353298
440 Ga0105238_10001145
441 Ga0105238_10299918
442 Ga0105238_10547404
443 Ga0105249_10268692
444 Ga0105239_10000128
445 Ga0105239_10011634
446 Ga0105239_10186740
447 Ga0105239_10598688
448 Ga0105239_11121499
449 Ga0105239_11227571
450 Ga0157373_10042020
451 Ga0157371_10245644
452 Ga0157371_10626446
453 Ga0157370_10124903
454 Ga0157370_10326824
455 Ga0157370_11713655
456 Ga0157369_10023743
457 Ga0157369_10061206
458 Ga0157369_10274710
459 Ga0157369_10491065
460 Ga0157374_10000004
461 Ga0157374_10020769
462 Ga0157374_10058270
463 Ga0157374_10110696
464 Ga0157374_10168877
465 Ga0157374_10361765
466 Ga0157374_10849739
467 Ga0157374_10908025
468 Ga0157374_11563857
469 Ga0157374_11770413
470 Ga0157374_11887976
471 Ga0157378_10025479
472 Ga0157378_10110305
473 Ga0157378_10149967
474 Ga0157378_11504503
475 Ga0157378_11629846
476 Ga0157378_11878453
477 Ga0163162_10001987
478 Ga0163162_10028871
479 Ga0163162_10038044
480 Ga0163162_10081461
481 Ga0163162_10160881
482 Ga0163162_10241891
483 Ga0163162_10607048
484 Ga0157372_10000231
485 Ga0157372_10126020
486 Ga0157372_10139052
487 Ga0157372_10299203
488 Ga0157372_10493358
489 Ga0157372_11287447
490 Ga0157372_11744218
491 Ga0157372_12224470
492 Ga0157375_10022090
493 Ga0157375_10024035
494 Ga0157375_10061636
495 Ga0157375_10082760
496 Ga0157375_10124177
497 Ga0157375_10219910
498 Ga0157375_10541889
499 Ga0157375_11550248
500 Ga0157375_12423376
501 Ga0163163_10001834
502 Ga0163163_10093403
503 Ga0163163_10136951
504 Ga0163163_11370804
505 Ga0157380_10000065
506 Ga0157377_10032562
507 Ga0157379_10000175
508 Ga0157379_10259998
509 Ga0157379_10782136
510 Ga0157376_10000133
511 Ga0157376_10008519
512 Ga0157376_10030544
513 Ga0157376_10065230
514 Ga0157376_10065715
515 Ga0157376_10146946
516 Ga0157376_10253258
517 Ga0157376_10504722
518 Ga0157376_11940315
519 Ga0163161_10038007
520 Ga0163161_10917319
521 Ga0207656_10663137
522 Ga0207682_10388324
523 Ga0207682_10411104
524 Ga0207688_10106592
525 Ga0207680_10420911
526 Ga0207647_10011395
527 Ga0207685_10243550
528 Ga0207645_10010295
529 Ga0207705_10141493
530 Ga0207705_10572813
531 Ga0207654_10065809
532 Ga0207654_10155331
533 Ga0207707_10148680
534 Ga0207695_10041120
535 Ga0207695_10044591
536 Ga0207695_10058072
537 Ga0207671_10005973
538 Ga0207671_10018649
539 Ga0207657_10597507
540 Ga0207657_10718367
541 Ga0207649_11127818
542 Ga0207694_10331355
543 Ga0207650_10425271
544 Ga0207659_11114500
545 Ga0207687_10215880
546 Ga0207687_10482618
547 Ga0207690_10002073
548 Ga0207706_10302075
549 Ga0207669_11794325
550 Ga0207704_10086695
551 Ga0207704_11056999
552 Ga0207691_10002688
553 Ga0207691_10041687
554 Ga0207691_10101682
555 Ga0207689_10076994
556 Ga0207689_11021252
557 Ga0207661_10320123
558 Ga0207679_10073461
559 Ga0207667_10516594
560 Ga0207651_10363398
561 Ga0207712_10553342
562 Ga0207640_10003587
563 Ga0207640_10864803
564 Ga0207640_11235488
565 Ga0207658_11221049
566 Ga0207677_10016039
567 Ga0207677_10540805
568 Ga0207677_11449729
569 Ga0207703_10401270
570 Ga0207703_11008471
571 Ga0207703_11920104
572 Ga0207639_10046889
573 Ga0207639_10053099
574 Ga0207639_11981073
575 Ga0207702_10026947
576 Ga0207702_10926703
577 Ga0207648_10025932
578 Ga0207648_10697904
579 Ga0207676_10621452
580 Ga0207676_10695183
581 Ga0207676_11292004
582 Ga0207675_100041847
583 Ga0207675_100600258
584 Ga0207683_10080910
585 Ga0207683_10113872
586 Ga0207698_10168601
587 Ga0207698_10244502
588 Ga0207698_11176413
589 Ga0207698_11554662
590 Ga0207698_11705488
591 Ga0207698_12551731
592 Ga0207428_10839432
593 Ga0268266_12030437
594 Ga0268265_10943950
595 Ga0268264_10009839
596 Ga0268264_10016588
597 Ga0373953_0498591
598 Ga0373924_0541938
599 Ga0373931_0435677
600 Ga0373935_1233711
601 Ga0373933_0377693
602 Ga0373937_0105575
603 Ga0373937_0385928
604 Ga0373937_1788734
605 Ga0265778_001616
606 Ga0436365_1629470
607 Ga0451787_765347
608 Ga0451798_0525462
609 Ga0451807_1023154
610 Ga0451807_2075102
611 Ga0451839_0573515
612 Ga0451853_1894853
613 Ga0439435_0099939
614 Ga0466967_2205610
615 Ga0495651_0605048
616 Ga0495606_0014462
617 Ga0495606_0080651
618 Ga0495608_0744141
619 Ga0495628_0999409
620 Ga0495630_0246040
621 Ga0495652_0134931
622 Ga0495586_0060117
623 Ga0495587_0254381
624 Ga0495645_0084894
625 Ga0495645_0447669
626 Ga0495634_0108271
627 Ga0495581_0551476
628 Ga0495674_0020023
629 Ga0495674_0173263
630 Ga0495684_0074400
631 Ga0496105_0480689
632 Ga0496107_1120751
633 Ga0496115_0538721
634 Ga0501047_0426830
635 nmdc:mga09592_1391657_c1
636 nmdc:mga0qj67_1250923_c1
637 nmdc:mga06r32_857976_c1
638 nmdc:mga08y16_1200707_c1
639 nmdc:mga08y16_358167_c1
640 Ga0495595_0383895
641 Ga0495619_0110423
642 Ga0500578_0421501
643 Ga0500568_0044026
644 Ga0500616_0070336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07689

KaiB

KaiB domain

17

99

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kun-assembly1.cif.gz_B crystal structure of legionella pneumophila lpp1115 / kaib 0.9552 12 99
4kun-assembly1.cif.gz_B crystal structure of legionella pneumophila lpp1115 / kaib 0.9248 12 99
8fwj-assembly1.cif.gz_M structure of dodecameric kaic-rs-s413e/s414e complexed with kaib-rs solved by cryo-em 0.8861 15 100
8fwj-assembly1.cif.gz_M structure of dodecameric kaic-rs-s413e/s414e complexed with kaib-rs solved by cryo-em 0.8673 15 100
5jwr-assembly1.cif.gz_B crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic and a dimer of kaia c-terminal domains from thermosynechococcus elongatus 0.8672 13 100
ID Description Score Start End Superfamily
4kunB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9555 13 96 3.40.30.10
4kunB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9036 13 96 3.40.30.10
5jwoB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9003 13 98 3.40.30.10
5jwoB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8722 13 98 3.40.30.10
af_Q9SEU7_68_173_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8613 12 97 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A0Q4XA40-F1-model_v4 Circadian clock protein KaiB 0.9642 13 99 GO:0048511
AF-A0A6V8NBA5-F1-model_v4 KaiB domain-containing protein 0.9491 13 99 GO:0048511
AF-Q55819-F1-model_v4 Circadian clock protein KaiB3 0.9483 10 99 GO:0048511
AF-I3IPM3-F1-model_v4 KaiB domain-containing protein 0.9479 13 99 GO:0048511
AF-A0A7V0SDN5-F1-model_v4 Circadian clock protein KaiB 0.9478 12 101 GO:0048511

Map