F406279

General Info

Members Datasets Scaffolds Average Seq Length
322 136 322 334

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10025675|Ga0070658_100256755
Length 353
Sequence MTEKLNLAPFVRRALPLWAVIACSTPAFADHLGPSGFGSGGGMSVFDPGTLDQGHWATGLRLTYTRPEQRPDVELAALASQHIHAHNTDYNLVAAVGVAYGITHHLTVSAELPYVRRDDLREGTHDHVGGVAVNGVEELGSVSGIGDLNLLAKYRLTEGTGPSLALIAGMKLPTGSTDRSSLGGERLETEHQPGTGSWDPIVGASASLPMGPLTLTASGIYQFSQRGSQDTRLGDRLQGGIALSHRFGAAPYMHSEGHNHHHGDELDEHEGAPKSSWDAFVELAGEWEGRQTIEGEVEDASGGKWSWIAPGVRYNAASGWSASMGVAIPVYQRIRASHPDNRFRLTLSLGRAF

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.07
Rhizosphere 91.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10026188 3300001979 Bacteria 1956
2 JGI24739J22299_10004515 3300001989 Bacteria 5323
3 JGI24737J22298_10020575 3300001990 Bacteria 2107
4 JGI24737J22298_10049279 3300001990 Bacteria 1281
5 Ga0070658_10018600 3300005327 Bacteria 5564
6 Ga0070658_10025675 3300005327 Bacteria 4721
7 Ga0070658_10027785 3300005327 Bacteria 4541
8 Ga0070658_10171914 3300005327 Bacteria 1820
9 Ga0070676_10002563 3300005328 Bacteria 9347
10 Ga0070676_10022656 3300005328 Bacteria 3525
11 Ga0070676_10134121 3300005328 Bacteria 1569
12 Ga0070676_10179262 3300005328 Bacteria 1376
13 Ga0070683_100057675 3300005329 Bacteria 3608
14 Ga0070683_100078455 3300005329 Bacteria 3089
15 Ga0070690_100002202 3300005330 Bacteria 10426
16 Ga0070690_100007634 3300005330 Bacteria 6196
17 Ga0070670_100000350 3300005331 Bacteria 38698
18 Ga0070670_100126916 3300005331 Bacteria 2202
19 Ga0070677_10011483 3300005333 Bacteria 3056
20 Ga0068869_100150205 3300005334 Bacteria 1806
21 Ga0070666_10001765 3300005335 Bacteria 13184
22 Ga0070666_10007443 3300005335 Bacteria 6751
23 Ga0070666_10012055 3300005335 Bacteria 5443
24 Ga0070666_10022434 3300005335 Bacteria 4098
25 Ga0070680_100059059 3300005336 Bacteria 3137
26 Ga0068868_100002214 3300005338 Bacteria 13431
27 Ga0070660_100004780 3300005339 Bacteria 9365
28 Ga0070660_100009808 3300005339 Bacteria 6750
29 Ga0070660_100010328 3300005339 Bacteria 6594
30 Ga0070660_100026725 3300005339 Bacteria 4301
31 Ga0070660_100069750 3300005339 Bacteria 2742
32 Ga0070660_100179705 3300005339 Unclassified 1712
33 Ga0070660_100182339 3300005339 Bacteria 1699
34 Ga0070661_100000353 3300005344 Bacteria 36189
35 Ga0070661_100018670 3300005344 Bacteria 4934
36 Ga0070661_100033608 3300005344 Bacteria 3716
37 Ga0070692_10036666 3300005345 Bacteria 2489
38 Ga0070668_100009798 3300005347 Bacteria 7103
39 Ga0070675_100001470 3300005354 Bacteria 17369
40 Ga0070671_100000469 3300005355 Bacteria 28112
41 Ga0070671_100002050 3300005355 Bacteria 15531
42 Ga0070671_100035254 3300005355 Unclassified 4145
43 Ga0070674_100009053 3300005356 Bacteria 5950
44 Ga0070674_100108154 3300005356 Bacteria 2037
45 Ga0070674_100122533 3300005356 Bacteria 1927
46 Ga0070673_100001044 3300005364 Bacteria 15715
47 Ga0070673_100002148 3300005364 Bacteria 11943
48 Ga0070673_100047163 3300005364 Bacteria 3351
49 Ga0070673_100398957 3300005364 Unclassified 1229
50 Ga0070659_100002552 3300005366 Bacteria 12953
51 Ga0070659_100017167 3300005366 Bacteria 5441
52 Ga0070659_100029980 3300005366 Bacteria 4207
53 Ga0070659_100058120 3300005366 Bacteria 3051
54 Ga0070659_100060886 3300005366 Bacteria 2983
55 Ga0070659_100111999 3300005366 Bacteria 2204
56 Ga0070667_100005527 3300005367 Bacteria 10552
57 Ga0070667_100006651 3300005367 Bacteria 9609
58 Ga0070667_100020407 3300005367 Bacteria 5501
59 Ga0070667_100101381 3300005367 Bacteria 2487
60 Ga0070663_100014523 3300005455 Bacteria 5058
61 Ga0070663_100047890 3300005455 Bacteria 3029
62 Ga0070663_100137652 3300005455 Bacteria 1861
63 Ga0070663_100189413 3300005455 Unclassified 1600
64 Ga0070678_100016394 3300005456 Bacteria 4739
65 Ga0070678_100029984 3300005456 Bacteria 3732
66 Ga0070678_100045208 3300005456 Bacteria 3148
67 Ga0070678_100053586 3300005456 Bacteria 2934
68 Ga0070662_100000611 3300005457 Bacteria 21817
69 Ga0070662_100001103 3300005457 Bacteria 16461
70 Ga0070662_100003172 3300005457 Bacteria 10217
71 Ga0070662_100016901 3300005457 Bacteria 4905
72 Ga0070681_10014906 3300005458 Bacteria 7729
73 Ga0070681_10103659 3300005458 Bacteria 2788
74 Ga0070681_10151835 3300005458 Unclassified 2242
75 Ga0068867_100068074 3300005459 Bacteria 2656
76 Ga0070679_100002274 3300005530 Bacteria 17357
77 Ga0070679_100081154 3300005530 Bacteria 3232
78 Ga0070679_100178831 3300005530 Bacteria 2094
79 Ga0070684_100121179 3300005535 Bacteria 2353
80 Ga0068853_100001382 3300005539 Bacteria 17525
81 Ga0068853_100128291 3300005539 Bacteria 2268
82 Ga0068853_100325633 3300005539 Bacteria 1425
83 Ga0070672_100006163 3300005543 Bacteria 8027
84 Ga0070672_100027932 3300005543 Bacteria 4214
85 Ga0070672_100070281 3300005543 Bacteria 2782
86 Ga0070672_100356672 3300005543 Unclassified 1247
87 Ga0070665_100004805 3300005548 Bacteria 14043
88 Ga0070665_100013302 3300005548 Bacteria 8285
89 Ga0068855_100004984 3300005563 Bacteria 16204
90 Ga0070664_100001162 3300005564 Bacteria 20890
91 Ga0070664_100001687 3300005564 Bacteria 17694
92 Ga0070664_100008160 3300005564 Bacteria 8467
93 Ga0070664_100010793 3300005564 Bacteria 7408
94 Ga0070664_100013458 3300005564 Bacteria 6662
95 Ga0070664_100042270 3300005564 Bacteria 3848
96 Ga0070664_100143617 3300005564 Bacteria 2103
97 Ga0068857_100055434 3300005577 Bacteria 3518
98 Ga0068857_100201444 3300005577 Bacteria 1815
99 Ga0068854_100002015 3300005578 Bacteria 12440
100 Ga0068854_100022275 3300005578 Bacteria 4312
101 Ga0068856_100011430 3300005614 Bacteria 8612
102 Ga0068852_100014671 3300005616 Bacteria 6042
103 Ga0068852_100027650 3300005616 Bacteria 4625
104 Ga0068852_100385496 3300005616 Bacteria 1376
105 Ga0068859_100017396 3300005617 Bacteria 7223
106 Ga0068859_100061635 3300005617 Bacteria 3780
107 Ga0068859_100485219 3300005617 Bacteria 1331
108 Ga0068864_100001075 3300005618 Bacteria 22935
109 Ga0068864_100012325 3300005618 Bacteria 7066
110 Ga0068864_100021179 3300005618 Bacteria 5445
111 Ga0068866_10028690 3300005718 Bacteria 2654
112 Ga0068851_10000728 3300005834 Bacteria 14046
113 Ga0068851_10006700 3300005834 Bacteria 5270
114 Ga0068863_100023634 3300005841 Bacteria 5868
115 Ga0068863_100098766 3300005841 Bacteria 2773
116 Ga0068863_100149253 3300005841 Unclassified 2236
117 Ga0068858_100008732 3300005842 Bacteria 9730
118 Ga0068858_100019438 3300005842 Bacteria 6353
119 Ga0068862_100026931 3300005844 Bacteria 4835
120 Ga0097621_100021317 3300006237 Bacteria 5010
121 Ga0068871_100015362 3300006358 Bacteria 5727
122 Ga0068871_100152960 3300006358 Bacteria 1968
123 Ga0097620_100017395 3300006931 Bacteria 7223
124 Ga0097620_100061634 3300006931 Bacteria 3780
125 Ga0097620_100485289 3300006931 Bacteria 1331
126 Ga0105245_10004406 3300009098 Bacteria 12454
127 Ga0105245_10075255 3300009098 Bacteria 3074
128 Ga0105243_10034264 3300009148 Bacteria 3929
129 Ga0105242_10011440 3300009176 Bacteria 6823
130 Ga0105248_10000928 3300009177 Bacteria 32626
131 Ga0105248_10004025 3300009177 Bacteria 16256
132 Ga0105248_10011130 3300009177 Bacteria 9927
133 Ga0105248_10017334 3300009177 Bacteria 7938
134 Ga0105248_10102769 3300009177 Bacteria 3221
135 Ga0105238_10004102 3300009551 Bacteria 14455
136 Ga0157373_10008388 3300013100 Bacteria 7677
137 Ga0157373_10027702 3300013100 Bacteria 4088
138 Ga0157371_10001453 3300013102 Bacteria 24579
139 Ga0157371_10034750 3300013102 Bacteria 3614
140 Ga0157371_10048407 3300013102 Bacteria 3021
141 Ga0157370_10001823 3300013104 Bacteria 26240
142 Ga0157369_10001208 3300013105 Bacteria 32161
143 Ga0157369_10053188 3300013105 Bacteria 4378
144 Ga0157374_10042657 3300013296 Bacteria 4186
145 Ga0157374_10146109 3300013296 Bacteria 2297
146 Ga0157378_10046674 3300013297 Bacteria 3850
147 Ga0163162_10054968 3300013306 Bacteria 4006
148 Ga0157372_10004254 3300013307 Bacteria 15307
149 Ga0157375_10029033 3300013308 Bacteria 5195
150 Ga0157375_10059046 3300013308 Bacteria 3798
151 Ga0157375_10171006 3300013308 Bacteria 2320
152 Ga0163163_10011557 3300014325 Bacteria 8017
153 Ga0157379_10006016 3300014968 Bacteria 10460
154 Ga0157376_10002864 3300014969 Bacteria 11812
155 Ga0207656_10028475 3300025321 Bacteria 2294
156 Ga0207682_10014995 3300025893 Bacteria 3018
157 Ga0207642_10009490 3300025899 Bacteria 3387
158 Ga0207688_10028956 3300025901 Bacteria 3047
159 Ga0207680_10008173 3300025903 Bacteria 5127
160 Ga0207680_10016904 3300025903 Bacteria 3842
161 Ga0207680_10117700 3300025903 Unclassified 1733
162 Ga0207647_10028069 3300025904 Bacteria 3661
163 Ga0207645_10007949 3300025907 Bacteria 7446
164 Ga0207645_10153665 3300025907 Bacteria 1503
165 Ga0207645_10183482 3300025907 Bacteria 1373
166 Ga0207705_10003299 3300025909 Bacteria 12286
167 Ga0207707_10011793 3300025912 Bacteria 7604
168 Ga0207707_10220566 3300025912 Unclassified 1651
169 Ga0207707_10315997 3300025912 Unclassified 1349
170 Ga0207660_10009063 3300025917 Bacteria 6445
171 Ga0207660_10193965 3300025917 Unclassified 1583
172 Ga0207657_10000048 3300025919 Bacteria 111458
173 Ga0207657_10000868 3300025919 Bacteria 31880
174 Ga0207657_10001537 3300025919 Bacteria 24722
175 Ga0207657_10003045 3300025919 Bacteria 17927
176 Ga0207657_10012796 3300025919 Bacteria 8258
177 Ga0207657_10030143 3300025919 Bacteria 4929
178 Ga0207649_10000959 3300025920 Bacteria 17899
179 Ga0207649_10042438 3300025920 Bacteria 2775
180 Ga0207649_10137749 3300025920 Bacteria 1666
181 Ga0207652_10013974 3300025921 Bacteria 6501
182 Ga0207681_10050759 3300025923 Bacteria 2807
183 Ga0207694_10059298 3300025924 Bacteria 2976
184 Ga0207650_10005483 3300025925 Bacteria 8659
185 Ga0207659_10161550 3300025926 Unclassified 1759
186 Ga0207687_10020379 3300025927 Bacteria 4398
187 Ga0207644_10003923 3300025931 Bacteria 9648
188 Ga0207644_10006596 3300025931 Bacteria 7562
189 Ga0207644_10014343 3300025931 Bacteria 5300
190 Ga0207644_10132966 3300025931 Bacteria 1907
191 Ga0207690_10000816 3300025932 Bacteria 19990
192 Ga0207690_10009409 3300025932 Bacteria 5804
193 Ga0207706_10000381 3300025933 Bacteria 48362
194 Ga0207706_10002600 3300025933 Bacteria 17573
195 Ga0207706_10006075 3300025933 Bacteria 11222
196 Ga0207706_10016743 3300025933 Bacteria 6617
197 Ga0207706_10017222 3300025933 Bacteria 6514
198 Ga0207686_10011881 3300025934 Bacteria 4779
199 Ga0207669_10005450 3300025937 Bacteria 5710
200 Ga0207669_10012863 3300025937 Bacteria 4132
201 Ga0207704_10147927 3300025938 Bacteria 1653
202 Ga0207691_10006382 3300025940 Bacteria 11387
203 Ga0207691_10012242 3300025940 Bacteria 8222
204 Ga0207691_10321196 3300025940 Bacteria 1327
205 Ga0207711_10000243 3300025941 Bacteria 58447
206 Ga0207711_10002866 3300025941 Bacteria 15126
207 Ga0207689_10034851 3300025942 Unclassified 4180
208 Ga0207689_10144200 3300025942 Bacteria 1962
209 Ga0207679_10028198 3300025945 Bacteria 3892
210 Ga0207679_10064359 3300025945 Bacteria 2740
211 Ga0207679_10075885 3300025945 Bacteria 2552
212 Ga0207679_10114132 3300025945 Bacteria 2138
213 Ga0207679_10126646 3300025945 Bacteria 2042
214 Ga0207667_10010559 3300025949 Bacteria 10790
215 Ga0207651_10002647 3300025960 Bacteria 8562
216 Ga0207651_10010863 3300025960 Bacteria 5066
217 Ga0207651_10111952 3300025960 Bacteria 2051
218 Ga0207651_10349265 3300025960 Unclassified 1245
219 Ga0207668_10000150 3300025972 Bacteria 48022
220 Ga0207640_10035270 3300025981 Bacteria 3129
221 Ga0207658_10019158 3300025986 Bacteria 4732
222 Ga0207658_10094739 3300025986 Bacteria 2324
223 Ga0207677_10001278 3300026023 Bacteria 13512
224 Ga0207677_10065576 3300026023 Bacteria 2534
225 Ga0207703_10001643 3300026035 Bacteria 20120
226 Ga0207639_10001098 3300026041 Bacteria 18397
227 Ga0207639_10055072 3300026041 Bacteria 3042
228 Ga0207678_10000357 3300026067 Bacteria 41546
229 Ga0207678_10002532 3300026067 Bacteria 16661
230 Ga0207678_10017319 3300026067 Bacteria 6325
231 Ga0207678_10020153 3300026067 Bacteria 5856
232 Ga0207678_10165274 3300026067 Unclassified 1890
233 Ga0207702_10170455 3300026078 Bacteria 1995
234 Ga0207641_10030712 3300026088 Bacteria 4451
235 Ga0207641_10321168 3300026088 Bacteria 1468
236 Ga0207641_10377867 3300026088 Bacteria 1356
237 Ga0207648_10003766 3300026089 Bacteria 15844
238 Ga0207648_10014617 3300026089 Bacteria 7248
239 Ga0207648_10057327 3300026089 Bacteria 3398
240 Ga0207676_10004053 3300026095 Bacteria 10333
241 Ga0207676_10009061 3300026095 Bacteria 7087
242 Ga0207676_10268670 3300026095 Unclassified 1543
243 Ga0207674_10002612 3300026116 Bacteria 22594
244 Ga0207674_10021715 3300026116 Bacteria 6909
245 Ga0207683_10003677 3300026121 Bacteria 13324
246 Ga0207683_10004412 3300026121 Bacteria 12166
247 Ga0207683_10066996 3300026121 Bacteria 3167
248 Ga0207698_10295568 3300026142 Unclassified 1505
249 Ga0268266_10004977 3300028379 Bacteria 12565
250 Ga0268266_10007425 3300028379 Bacteria 9892
251 Ga0268266_10025866 3300028379 Bacteria 4993
252 Ga0268266_10408941 3300028379 Unclassified 1284
253 Ga0268265_10003997 3300028380 Bacteria 10380
254 Ga0373931_0169360 3300035691 Unclassified 1286
255 Ga0395899_0002038 3300037312 Bacteria 16634
256 Ga0395899_0095580 3300037312 Bacteria 2149
257 Ga0395899_0098192 3300037312 Bacteria 2116
258 Ga0395899_0100232 3300037312 Unclassified 2092
259 Ga0395900_0005857 3300037418 Bacteria 12832
260 Ga0395900_0012640 3300037418 Bacteria 8632
261 Ga0395900_0019732 3300037418 Bacteria 6871
262 Ga0395900_0043153 3300037418 Bacteria 4647
263 Ga0395900_0101614 3300037418 Bacteria 2953
264 Ga0395900_0115483 3300037418 Bacteria 2754
265 Ga0395900_0388301 3300037418 Bacteria 1362
266 Ga0395898_0005548 3300037466 Bacteria 13612
267 Ga0395898_0036595 3300037466 Bacteria 4873
268 Ga0395898_0037459 3300037466 Bacteria 4811
269 Ga0395898_0170383 3300037466 Bacteria 2081
270 Ga0395905_0000204 3300037471 Bacteria 92152
271 Ga0395905_0003297 3300037471 Bacteria 17333
272 Ga0395905_0005840 3300037471 Bacteria 12508
273 Ga0395905_0006460 3300037471 Bacteria 11799
274 Ga0395905_0006483 3300037471 Bacteria 11777
275 Ga0395905_0035581 3300037471 Bacteria 4676
276 Ga0395905_0035859 3300037471 Bacteria 4658
277 Ga0395905_0043166 3300037471 Bacteria 4230
278 Ga0395905_0069154 3300037471 Bacteria 3307
279 Ga0395905_0113564 3300037471 Unclassified 2545
280 Ga0395905_0118355 3300037471 Bacteria 2490
281 Ga0395905_0162354 3300037471 Bacteria 2099
282 Ga0395901_0007192 3300038443 Bacteria 11225
283 Ga0395901_0009524 3300038443 Bacteria 9856
284 Ga0395901_0021731 3300038443 Bacteria 6574
285 Ga0395901_0046698 3300038443 Bacteria 4499
286 Ga0395901_0055684 3300038443 Bacteria 4113
287 Ga0395901_0078326 3300038443 Bacteria 3451
288 Ga0395901_0101430 3300038443 Bacteria 3020
289 Ga0395901_0120179 3300038443 Bacteria 2761
290 Ga0395901_0214925 3300038443 Bacteria 2011
291 Ga0495621_0086374 3300046539 Bacteria 1177
292 Ga0495668_0002958 3300046616 Bacteria 13346
293 Ga0495669_0002043 3300046684 Bacteria 8278
294 Ga0495669_0003311 3300046684 Bacteria 6628
295 Ga0495669_0004483 3300046684 Bacteria 5768
296 Ga0495677_0036401 3300047445 Bacteria 1798
297 Ga0496100_0044020 3300048903 Bacteria 2857
298 Ga0496101_0020972 3300048904 Bacteria 4484
299 Ga0496101_0021336 3300048904 Bacteria 4450
300 Ga0496102_0021417 3300048905 Bacteria 5717
301 Ga0496103_0009399 3300048906 Bacteria 5792
302 Ga0496104_0394557 3300048907 Unclassified 1296
303 Ga0496106_0000666 3300048909 Bacteria 24598
304 Ga0496106_0036999 3300048909 Bacteria 3650
305 Ga0496107_0000181 3300048910 Bacteria 32803
306 Ga0496107_0038081 3300048910 Unclassified 3451
307 Ga0496108_0006821 3300048911 Bacteria 9239
308 Ga0496108_0036526 3300048911 Bacteria 4088
309 Ga0496109_0000774 3300048912 Bacteria 26581
310 Ga0496109_0008802 3300048912 Bacteria 8596
311 Ga0496109_0379860 3300048912 Unclassified 1334
312 Ga0496110_0007962 3300048913 Bacteria 8488
313 Ga0496110_0012164 3300048913 Bacteria 7070
314 Ga0496110_0028038 3300048913 Bacteria 4832
315 Ga0496111_0001460 3300048914 Bacteria 13524
316 Ga0496111_0094761 3300048914 Bacteria 2189
317 Ga0496111_0098006 3300048914 Unclassified 2152
318 Ga0496112_0000354 3300048915 Bacteria 29882
319 Ga0496112_0201212 3300048915 Bacteria 1951
320 Ga0496113_0004786 3300048916 Bacteria 8365
321 Ga0496113_0008615 3300048916 Bacteria 6651
322 Ga0496114_0053618 3300048917 Bacteria 3361

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10171914 Ga0070658_101719141 261
2 3300005616 Ga0068852_100385496 Ga0068852_1003854961 261
3 3300026067 Ga0207678_10020153 Ga0207678_100201532 261
4 3300001990 JGI24737J22298_10020575 JGI24737J22298_100205752 277
5 3300005364 Ga0070673_100047163 Ga0070673_1000471633 277
6 3300005366 Ga0070659_100017167 Ga0070659_1000171675 277
7 3300005543 Ga0070672_100356672 Ga0070672_1003566721 277
8 3300005618 Ga0068864_100012325 Ga0068864_1000123254 277
9 3300005841 Ga0068863_100098766 Ga0068863_1000987662 277
10 3300009177 Ga0105248_10000928 Ga0105248_1000092811 277
11 3300025940 Ga0207691_10321196 Ga0207691_103211962 277
12 3300025941 Ga0207711_10000243 Ga0207711_1000024343 277
13 3300026088 Ga0207641_10321168 Ga0207641_103211681 277
14 3300026095 Ga0207676_10004053 Ga0207676_1000405311 277
15 3300048904 Ga0496101_0020972 Ga0496101_0020972_3307_4347 277
16 3300048907 Ga0496104_0394557 Ga0496104_0394557_119_1159 277
17 3300048909 Ga0496106_0000666 Ga0496106_0000666_16798_17838 277
18 3300048910 Ga0496107_0000181 Ga0496107_0000181_6565_7605 277
19 3300048911 Ga0496108_0006821 Ga0496108_0006821_5171_6211 277
20 3300048912 Ga0496109_0000774 Ga0496109_0000774_19020_20060 277
21 3300048913 Ga0496110_0028038 Ga0496110_0028038_692_1732 277
22 3300048914 Ga0496111_0001460 Ga0496111_0001460_8214_9254 277
23 3300048915 Ga0496112_0000354 Ga0496112_0000354_21959_22999 277
24 3300048916 Ga0496113_0004786 Ga0496113_0004786_2624_3664 277
25 3300005564 Ga0070664_100143617 Ga0070664_1001436172 281
26 3300025945 Ga0207679_10126646 Ga0207679_101266462 281
27 3300005355 Ga0070671_100000469 Ga0070671_1000004696 282
28 3300025931 Ga0207644_10006596 Ga0207644_100065961 282
29 3300025932 Ga0207690_10009409 Ga0207690_100094094 282
30 3300005530 Ga0070679_100178831 Ga0070679_1001788313 286
31 3300005329 Ga0070683_100057675 Ga0070683_1000576755 288
32 3300005336 Ga0070680_100059059 Ga0070680_1000590595 288
33 3300005339 Ga0070660_100010328 Ga0070660_1000103281 288
34 3300005344 Ga0070661_100000353 Ga0070661_10000035324 288
35 3300005345 Ga0070692_10036666 Ga0070692_100366663 288
36 3300005366 Ga0070659_100002552 Ga0070659_1000025525 288
37 3300005457 Ga0070662_100000611 Ga0070662_1000006117 288
38 3300005458 Ga0070681_10014906 Ga0070681_100149066 288
39 3300005458 Ga0070681_10103659 Ga0070681_101036592 288
40 3300005530 Ga0070679_100002274 Ga0070679_10000227418 288
41 3300005530 Ga0070679_100081154 Ga0070679_1000811543 288
42 3300005535 Ga0070684_100121179 Ga0070684_1001211794 288
43 3300005539 Ga0068853_100001382 Ga0068853_10000138217 288
44 3300005563 Ga0068855_100004984 Ga0068855_10000498419 288
45 3300005564 Ga0070664_100008160 Ga0070664_1000081604 288
46 3300005577 Ga0068857_100201444 Ga0068857_1002014441 288
47 3300005578 Ga0068854_100002015 Ga0068854_1000020155 288
48 3300005614 Ga0068856_100011430 Ga0068856_1000114305 288
49 3300013100 Ga0157373_10008388 Ga0157373_100083886 288
50 3300013102 Ga0157371_10001453 Ga0157371_1000145323 288
51 3300013104 Ga0157370_10001823 Ga0157370_1000182314 288
52 3300013105 Ga0157369_10001208 Ga0157369_1000120820 288
53 3300013307 Ga0157372_10004254 Ga0157372_100042543 288
54 3300025912 Ga0207707_10011793 Ga0207707_100117935 288
55 3300025917 Ga0207660_10009063 Ga0207660_100090635 288
56 3300025919 Ga0207657_10000048 Ga0207657_1000004830 288
57 3300025920 Ga0207649_10000959 Ga0207649_100009595 288
58 3300025921 Ga0207652_10013974 Ga0207652_100139742 288
59 3300025932 Ga0207690_10000816 Ga0207690_100008167 288
60 3300025933 Ga0207706_10000381 Ga0207706_1000038120 288
61 3300025945 Ga0207679_10028198 Ga0207679_100281982 288
62 3300025949 Ga0207667_10010559 Ga0207667_100105592 288
63 3300025981 Ga0207640_10035270 Ga0207640_100352701 288
64 3300026041 Ga0207639_10001098 Ga0207639_1000109818 288
65 3300026078 Ga0207702_10170455 Ga0207702_101704553 288
66 3300026116 Ga0207674_10021715 Ga0207674_100217156 288
67 3300048917 Ga0496114_0053618 Ga0496114_0053618_77_1096 290
68 3300005539 Ga0068853_100325633 Ga0068853_1003256331 293
69 3300005841 Ga0068863_100149253 Ga0068863_1001492532 293
70 3300005356 Ga0070674_100108154 Ga0070674_1001081542 294
71 3300005543 Ga0070672_100070281 Ga0070672_1000702814 294
72 3300048915 Ga0496112_0201212 Ga0496112_0201212_511_1551 294
73 3300005844 Ga0068862_100026931 Ga0068862_1000269312 295
74 3300028380 Ga0268265_10003997 Ga0268265_100039974 295
75 3300037471 Ga0395905_0003297 Ga0395905_0003297_7237_8262 296
76 3300005458 Ga0070681_10151835 Ga0070681_101518352 297
77 3300025912 Ga0207707_10220566 Ga0207707_102205662 297
78 3300025919 Ga0207657_10003045 Ga0207657_100030452 297
79 3300005339 Ga0070660_100069750 Ga0070660_1000697502 298
80 3300005366 Ga0070659_100058120 Ga0070659_1000581202 298
81 3300005456 Ga0070678_100029984 Ga0070678_1000299843 298
82 3300025919 Ga0207657_10030143 Ga0207657_100301438 298
83 3300025960 Ga0207651_10111952 Ga0207651_101119522 298
84 3300026121 Ga0207683_10003677 Ga0207683_1000367715 298
85 3300005548 Ga0070665_100004805 Ga0070665_1000048057 299
86 3300028379 Ga0268266_10004977 Ga0268266_100049776 299
87 3300037471 Ga0395905_0000204 Ga0395905_0000204_73803_74861 299
88 3300005328 Ga0070676_10002563 Ga0070676_100025634 300
89 3300005334 Ga0068869_100150205 Ga0068869_1001502052 300
90 3300005347 Ga0070668_100009798 Ga0070668_1000097983 300
91 3300005356 Ga0070674_100122533 Ga0070674_1001225333 300
92 3300005367 Ga0070667_100101381 Ga0070667_1001013813 300
93 3300005456 Ga0070678_100045208 Ga0070678_1000452082 300
94 3300005459 Ga0068867_100068074 Ga0068867_1000680744 300
95 3300005543 Ga0070672_100027932 Ga0070672_1000279324 300
96 3300025907 Ga0207645_10007949 Ga0207645_100079496 300
97 3300025923 Ga0207681_10050759 Ga0207681_100507593 300
98 3300025942 Ga0207689_10144200 Ga0207689_101442002 300
99 3300025972 Ga0207668_10000150 Ga0207668_1000015012 300
100 3300025986 Ga0207658_10094739 Ga0207658_100947393 300
101 3300026089 Ga0207648_10014617 Ga0207648_100146174 300
102 3300025942 Ga0207689_10034851 Ga0207689_100348512 301
103 3300038443 Ga0395901_0046698 Ga0395901_0046698_226_1263 301
104 3300005327 Ga0070658_10018600 Ga0070658_100186008 302
105 3300005339 Ga0070660_100004780 Ga0070660_1000047808 302
106 3300005366 Ga0070659_100111999 Ga0070659_1001119992 302
107 3300005455 Ga0070663_100047890 Ga0070663_1000478902 302
108 3300009177 Ga0105248_10017334 Ga0105248_100173345 302
109 3300037471 Ga0395905_0069154 Ga0395905_0069154_2058_3116 302
110 3300037471 Ga0395905_0118355 Ga0395905_0118355_374_1387 302
111 3300046684 Ga0495669_0004483 Ga0495669_0004483_2275_3318 302
112 3300005339 Ga0070660_100026725 Ga0070660_1000267254 303
113 3300005339 Ga0070660_100182339 Ga0070660_1001823391 303
114 3300005564 Ga0070664_100001162 Ga0070664_1000011626 303
115 3300005539 Ga0068853_100128291 Ga0068853_1001282913 304
116 3300025933 Ga0207706_10017222 Ga0207706_100172229 304
117 3300005327 Ga0070658_10027785 Ga0070658_100277854 305
118 3300005331 Ga0070670_100000350 Ga0070670_1000003507 305
119 3300005333 Ga0070677_10011483 Ga0070677_100114834 305
120 3300005335 Ga0070666_10007443 Ga0070666_100074434 305
121 3300005354 Ga0070675_100001470 Ga0070675_10000147011 305
122 3300005355 Ga0070671_100002050 Ga0070671_1000020507 305
123 3300005364 Ga0070673_100001044 Ga0070673_1000010449 305
124 3300005367 Ga0070667_100020407 Ga0070667_1000204073 305
125 3300005455 Ga0070663_100189413 Ga0070663_1001894131 305
126 3300005456 Ga0070678_100053586 Ga0070678_1000535864 305
127 3300005457 Ga0070662_100003172 Ga0070662_1000031723 305
128 3300005543 Ga0070672_100006163 Ga0070672_1000061632 305
129 3300005564 Ga0070664_100001687 Ga0070664_10000168710 305
130 3300005618 Ga0068864_100021179 Ga0068864_1000211795 305
131 3300009177 Ga0105248_10004025 Ga0105248_1000402511 305
132 3300013308 Ga0157375_10029033 Ga0157375_100290334 305
133 3300025893 Ga0207682_10014995 Ga0207682_100149952 305
134 3300025903 Ga0207680_10016904 Ga0207680_100169042 305
135 3300025920 Ga0207649_10042438 Ga0207649_100424382 305
136 3300025925 Ga0207650_10005483 Ga0207650_100054835 305
137 3300025926 Ga0207659_10161550 Ga0207659_101615502 305
138 3300025931 Ga0207644_10003923 Ga0207644_100039232 305
139 3300025933 Ga0207706_10016743 Ga0207706_100167435 305
140 3300025937 Ga0207669_10012863 Ga0207669_100128633 305
141 3300025940 Ga0207691_10006382 Ga0207691_100063827 305
142 3300025945 Ga0207679_10064359 Ga0207679_100643592 305
143 3300025960 Ga0207651_10002647 Ga0207651_100026474 305
144 3300026095 Ga0207676_10009061 Ga0207676_100090614 305
145 3300026121 Ga0207683_10066996 Ga0207683_100669964 305
146 3300037312 Ga0395899_0002038 Ga0395899_0002038_5459_6553 305
147 3300037418 Ga0395900_0388301 Ga0395900_0388301_248_1342 305
148 3300046684 Ga0495669_0002043 Ga0495669_0002043_6693_7757 305
149 3300048912 Ga0496109_0008802 Ga0496109_0008802_4032_5096 305
150 3300048913 Ga0496110_0007962 Ga0496110_0007962_7094_8158 305
151 3300048914 Ga0496111_0098006 Ga0496111_0098006_31_1095 305
152 3300005617 Ga0068859_100061635 Ga0068859_1000616357 306
153 3300006931 Ga0097620_100061634 Ga0097620_1000616347 306
154 3300009177 Ga0105248_10102769 Ga0105248_101027695 306
155 3300026088 Ga0207641_10377867 Ga0207641_103778671 306
156 3300037471 Ga0395905_0035859 Ga0395905_0035859_2523_3533 306
157 3300038443 Ga0395901_0078326 Ga0395901_0078326_836_1846 306
158 3300037466 Ga0395898_0005548 Ga0395898_0005548_136_1230 308
159 3300009098 Ga0105245_10075255 Ga0105245_100752554 309
160 3300025912 Ga0207707_10315997 Ga0207707_103159971 309
161 3300025917 Ga0207660_10193965 Ga0207660_101939652 309
162 3300005328 Ga0070676_10134121 Ga0070676_101341211 313
163 3300005330 Ga0070690_100007634 Ga0070690_1000076348 313
164 3300005335 Ga0070666_10001765 Ga0070666_1000176511 313
165 3300005338 Ga0068868_100002214 Ga0068868_10000221413 313
166 3300005355 Ga0070671_100035254 Ga0070671_1000352542 313
167 3300005356 Ga0070674_100009053 Ga0070674_1000090538 313
168 3300005367 Ga0070667_100005527 Ga0070667_1000055276 313
169 3300005564 Ga0070664_100013458 Ga0070664_1000134586 313
170 3300005617 Ga0068859_100485219 Ga0068859_1004852191 313
171 3300005718 Ga0068866_10028690 Ga0068866_100286903 313
172 3300005842 Ga0068858_100008732 Ga0068858_1000087328 313
173 3300006931 Ga0097620_100485289 Ga0097620_1004852891 313
174 3300009177 Ga0105248_10011130 Ga0105248_100111308 313
175 3300013100 Ga0157373_10027702 Ga0157373_100277022 313
176 3300013308 Ga0157375_10171006 Ga0157375_101710064 313
177 3300025903 Ga0207680_10008173 Ga0207680_100081732 313
178 3300025907 Ga0207645_10153665 Ga0207645_101536652 313
179 3300025919 Ga0207657_10000868 Ga0207657_1000086832 313
180 3300025937 Ga0207669_10005450 Ga0207669_100054504 313
181 3300025941 Ga0207711_10002866 Ga0207711_1000286615 313
182 3300026023 Ga0207677_10001278 Ga0207677_100012789 313
183 3300026035 Ga0207703_10001643 Ga0207703_1000164310 313
184 3300026041 Ga0207639_10055072 Ga0207639_100550722 313
185 3300026067 Ga0207678_10017319 Ga0207678_100173193 313
186 3300037418 Ga0395900_0043153 Ga0395900_0043153_3067_4077 313
187 3300037466 Ga0395898_0036595 Ga0395898_0036595_2476_3486 313
188 3300038443 Ga0395901_0021731 Ga0395901_0021731_1388_2398 313
189 3300005327 Ga0070658_10025675 Ga0070658_100256755 314
190 3300005328 Ga0070676_10022656 Ga0070676_100226564 314
191 3300005330 Ga0070690_100002202 Ga0070690_1000022029 314
192 3300005331 Ga0070670_100126916 Ga0070670_1001269162 314
193 3300005335 Ga0070666_10022434 Ga0070666_100224342 314
194 3300005344 Ga0070661_100033608 Ga0070661_1000336084 314
195 3300005366 Ga0070659_100029980 Ga0070659_1000299804 314
196 3300005456 Ga0070678_100016394 Ga0070678_1000163945 314
197 3300005457 Ga0070662_100001103 Ga0070662_10000110316 314
198 3300005548 Ga0070665_100013302 Ga0070665_1000133024 314
199 3300005564 Ga0070664_100010793 Ga0070664_1000107933 314
200 3300005616 Ga0068852_100014671 Ga0068852_1000146717 314
201 3300005617 Ga0068859_100017396 Ga0068859_1000173967 314
202 3300005618 Ga0068864_100001075 Ga0068864_10000107522 314
203 3300005834 Ga0068851_10000728 Ga0068851_1000072814 314
204 3300005834 Ga0068851_10006700 Ga0068851_100067005 314
205 3300005841 Ga0068863_100023634 Ga0068863_1000236345 314
206 3300005842 Ga0068858_100019438 Ga0068858_1000194381 314
207 3300006237 Ga0097621_100021317 Ga0097621_1000213174 314
208 3300006358 Ga0068871_100015362 Ga0068871_1000153625 314
209 3300006358 Ga0068871_100152960 Ga0068871_1001529602 314
210 3300006931 Ga0097620_100017395 Ga0097620_1000173957 314
211 3300009098 Ga0105245_10004406 Ga0105245_100044064 314
212 3300009148 Ga0105243_10034264 Ga0105243_100342643 314
213 3300009176 Ga0105242_10011440 Ga0105242_100114409 314
214 3300009551 Ga0105238_10004102 Ga0105238_1000410212 314
215 3300013102 Ga0157371_10034750 Ga0157371_100347502 314
216 3300013105 Ga0157369_10053188 Ga0157369_100531884 314
217 3300013296 Ga0157374_10042657 Ga0157374_100426574 314
218 3300013296 Ga0157374_10146109 Ga0157374_101461092 314
219 3300013297 Ga0157378_10046674 Ga0157378_100466744 314
220 3300013306 Ga0163162_10054968 Ga0163162_100549684 314
221 3300013308 Ga0157375_10059046 Ga0157375_100590464 314
222 3300014325 Ga0163163_10011557 Ga0163163_100115577 314
223 3300014968 Ga0157379_10006016 Ga0157379_100060164 314
224 3300014969 Ga0157376_10002864 Ga0157376_100028646 314
225 3300025321 Ga0207656_10028475 Ga0207656_100284754 314
226 3300025899 Ga0207642_10009490 Ga0207642_100094905 314
227 3300025901 Ga0207688_10028956 Ga0207688_100289561 314
228 3300025903 Ga0207680_10117700 Ga0207680_101177002 314
229 3300025904 Ga0207647_10028069 Ga0207647_100280693 314
230 3300025909 Ga0207705_10003299 Ga0207705_100032991 314
231 3300025919 Ga0207657_10012796 Ga0207657_100127969 314
232 3300025924 Ga0207694_10059298 Ga0207694_100592982 314
233 3300025927 Ga0207687_10020379 Ga0207687_100203794 314
234 3300025931 Ga0207644_10014343 Ga0207644_100143436 314
235 3300025933 Ga0207706_10002600 Ga0207706_100026007 314
236 3300025934 Ga0207686_10011881 Ga0207686_100118813 314
237 3300025938 Ga0207704_10147927 Ga0207704_101479272 314
238 3300025940 Ga0207691_10012242 Ga0207691_100122428 314
239 3300025945 Ga0207679_10075885 Ga0207679_100758853 314
240 3300025960 Ga0207651_10010863 Ga0207651_100108636 314
241 3300026023 Ga0207677_10065576 Ga0207677_100655762 314
242 3300026067 Ga0207678_10002532 Ga0207678_1000253213 314
243 3300026088 Ga0207641_10030712 Ga0207641_100307128 314
244 3300026089 Ga0207648_10003766 Ga0207648_1000376613 314
245 3300026095 Ga0207676_10268670 Ga0207676_102686702 314
246 3300026121 Ga0207683_10004412 Ga0207683_100044124 314
247 3300026142 Ga0207698_10295568 Ga0207698_102955682 314
248 3300028379 Ga0268266_10007425 Ga0268266_100074255 314
249 3300028379 Ga0268266_10408941 Ga0268266_104089412 314
250 3300035691 Ga0373931_0169360 Ga0373931_0169360_174_1235 314
251 3300037312 Ga0395899_0098192 Ga0395899_0098192_891_1925 314
252 3300037418 Ga0395900_0019732 Ga0395900_0019732_2565_3626 314
253 3300037418 Ga0395900_0101614 Ga0395900_0101614_790_1821 314
254 3300037418 Ga0395900_0115483 Ga0395900_0115483_118_1152 314
255 3300037466 Ga0395898_0170383 Ga0395898_0170383_379_1410 314
256 3300037471 Ga0395905_0006460 Ga0395905_0006460_5834_6868 314
257 3300037471 Ga0395905_0006483 Ga0395905_0006483_3796_4827 314
258 3300037471 Ga0395905_0043166 Ga0395905_0043166_87_1148 314
259 3300037471 Ga0395905_0113564 Ga0395905_0113564_692_1729 314
260 3300038443 Ga0395901_0009524 Ga0395901_0009524_158_1192 314
261 3300038443 Ga0395901_0055684 Ga0395901_0055684_2108_3166 314
262 3300038443 Ga0395901_0101430 Ga0395901_0101430_560_1591 314
263 3300038443 Ga0395901_0120179 Ga0395901_0120179_805_1836 314
264 3300038443 Ga0395901_0214925 Ga0395901_0214925_864_1925 314
265 3300048904 Ga0496101_0021336 Ga0496101_0021336_2925_3986 314
266 3300048905 Ga0496102_0021417 Ga0496102_0021417_3687_4748 314
267 3300048906 Ga0496103_0009399 Ga0496103_0009399_1532_2593 314
268 3300048909 Ga0496106_0036999 Ga0496106_0036999_352_1413 314
269 3300048910 Ga0496107_0038081 Ga0496107_0038081_1334_2395 314
270 3300048911 Ga0496108_0036526 Ga0496108_0036526_2690_3751 314
271 3300048912 Ga0496109_0379860 Ga0496109_0379860_227_1288 314
272 3300048913 Ga0496110_0012164 Ga0496110_0012164_4117_5178 314
273 3300048914 Ga0496111_0094761 Ga0496111_0094761_954_2015 314
274 3300048916 Ga0496113_0008615 Ga0496113_0008615_4950_6011 314
275 3300001979 JGI24740J21852_10026188 JGI24740J21852_100261883 315
276 3300001989 JGI24739J22299_10004515 JGI24739J22299_100045154 315
277 3300001990 JGI24737J22298_10049279 JGI24737J22298_100492791 315
278 3300005328 Ga0070676_10179262 Ga0070676_101792621 315
279 3300005329 Ga0070683_100078455 Ga0070683_1000784554 315
280 3300005335 Ga0070666_10012055 Ga0070666_100120554 315
281 3300005339 Ga0070660_100009808 Ga0070660_1000098086 315
282 3300005339 Ga0070660_100179705 Ga0070660_1001797052 315
283 3300005344 Ga0070661_100018670 Ga0070661_1000186702 315
284 3300005364 Ga0070673_100002148 Ga0070673_1000021489 315
285 3300005364 Ga0070673_100398957 Ga0070673_1003989571 315
286 3300005366 Ga0070659_100060886 Ga0070659_1000608864 315
287 3300005367 Ga0070667_100006651 Ga0070667_1000066514 315
288 3300005455 Ga0070663_100014523 Ga0070663_1000145234 315
289 3300005455 Ga0070663_100137652 Ga0070663_1001376523 315
290 3300005457 Ga0070662_100016901 Ga0070662_1000169013 315
291 3300005564 Ga0070664_100042270 Ga0070664_1000422706 315
292 3300005577 Ga0068857_100055434 Ga0068857_1000554345 315
293 3300005578 Ga0068854_100022275 Ga0068854_1000222755 315
294 3300005616 Ga0068852_100027650 Ga0068852_1000276505 315
295 3300013102 Ga0157371_10048407 Ga0157371_100484072 315
296 3300025907 Ga0207645_10183482 Ga0207645_101834821 315
297 3300025919 Ga0207657_10001537 Ga0207657_1000153711 315
298 3300025920 Ga0207649_10137749 Ga0207649_101377492 315
299 3300025931 Ga0207644_10132966 Ga0207644_101329663 315
300 3300025933 Ga0207706_10006075 Ga0207706_100060753 315
301 3300025945 Ga0207679_10114132 Ga0207679_101141323 315
302 3300025960 Ga0207651_10349265 Ga0207651_103492651 315
303 3300025986 Ga0207658_10019158 Ga0207658_100191584 315
304 3300026067 Ga0207678_10000357 Ga0207678_1000035723 315
305 3300026067 Ga0207678_10165274 Ga0207678_101652741 315
306 3300026089 Ga0207648_10057327 Ga0207648_100573275 315
307 3300026116 Ga0207674_10002612 Ga0207674_100026124 315
308 3300028379 Ga0268266_10025866 Ga0268266_100258664 315
309 3300037312 Ga0395899_0095580 Ga0395899_0095580_145_1194 315
310 3300037312 Ga0395899_0100232 Ga0395899_0100232_214_1248 315
311 3300037418 Ga0395900_0005857 Ga0395900_0005857_1175_2224 315
312 3300037418 Ga0395900_0012640 Ga0395900_0012640_3583_4617 315
313 3300037466 Ga0395898_0037459 Ga0395898_0037459_2471_3520 315
314 3300037471 Ga0395905_0005840 Ga0395905_0005840_2747_3781 315
315 3300037471 Ga0395905_0035581 Ga0395905_0035581_3488_4525 315
316 3300037471 Ga0395905_0162354 Ga0395905_0162354_200_1249 315
317 3300038443 Ga0395901_0007192 Ga0395901_0007192_851_1900 315
318 3300046539 Ga0495621_0086374 Ga0495621_0086374_64_1101 315
319 3300046616 Ga0495668_0002958 Ga0495668_0002958_6013_7023 315
320 3300046684 Ga0495669_0003311 Ga0495669_0003311_3817_4827 315
321 3300047445 Ga0495677_0036401 Ga0495677_0036401_444_1454 315
322 3300048903 Ga0496100_0044020 Ga0496100_0044020_107_1171 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13557

Phenol_MetA_deg

Putative MetA-pathway of phenol degradation

114

280

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o68-assembly4.cif.gz_L crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7574 23 315
5o68-assembly2.cif.gz_F crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7457 2 315
5o68-assembly1.cif.gz_C crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7385 25 315
4rl8-assembly2.cif.gz_B crystal structure of the cog4313 outer membrane channel from pseudomonas putida f1 0.7368 18 315
5o68-assembly3.cif.gz_I crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7327 23 315
ID Description Score Start End Superfamily
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.667 26 315 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6571 26 315 2.40.160.40
3qy3A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6466 267 314 3.10.129.10
3qq2A00 Mainly Beta;Beta Barrel;Lipocalin;Autotransporter beta-domain 0.6092 26 313 2.40.128.130
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6083 24 315 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A7H0GBW3-F1-model_v4 deleted 0.9509 1 315
AF-A0A7H0GBW3-F1-model_v4 deleted 0.948 1 315
AF-A0A832J2A4-F1-model_v4 Transporter 0.9381 101 315
AF-A0A1D2U0A8-F1-model_v4 Transporter 0.9289 12 315
AF-A0A1D2U0A8-F1-model_v4 Transporter 0.9258 12 315

Feature Viewer

pLDDT pTM Quality
80.18 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map