F406279
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 322 | 136 | 322 | 334 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10025675|Ga0070658_100256755 |
| Length | 353 |
| Sequence | MTEKLNLAPFVRRALPLWAVIACSTPAFADHLGPSGFGSGGGMSVFDPGTLDQGHWATGLRLTYTRPEQRPDVELAALASQHIHAHNTDYNLVAAVGVAYGITHHLTVSAELPYVRRDDLREGTHDHVGGVAVNGVEELGSVSGIGDLNLLAKYRLTEGTGPSLALIAGMKLPTGSTDRSSLGGERLETEHQPGTGSWDPIVGASASLPMGPLTLTASGIYQFSQRGSQDTRLGDRLQGGIALSHRFGAAPYMHSEGHNHHHGDELDEHEGAPKSSWDAFVELAGEWEGRQTIEGEVEDASGGKWSWIAPGVRYNAASGWSASMGVAIPVYQRIRASHPDNRFRLTLSLGRAF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 126 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 127 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 128 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 129 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 130 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 133 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 134 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 135 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 136 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.07 |
| Rhizosphere | 91.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10026188 | 3300001979 | Bacteria | 1956 |
| 2 | JGI24739J22299_10004515 | 3300001989 | Bacteria | 5323 |
| 3 | JGI24737J22298_10020575 | 3300001990 | Bacteria | 2107 |
| 4 | JGI24737J22298_10049279 | 3300001990 | Bacteria | 1281 |
| 5 | Ga0070658_10018600 | 3300005327 | Bacteria | 5564 |
| 6 | Ga0070658_10025675 | 3300005327 | Bacteria | 4721 |
| 7 | Ga0070658_10027785 | 3300005327 | Bacteria | 4541 |
| 8 | Ga0070658_10171914 | 3300005327 | Bacteria | 1820 |
| 9 | Ga0070676_10002563 | 3300005328 | Bacteria | 9347 |
| 10 | Ga0070676_10022656 | 3300005328 | Bacteria | 3525 |
| 11 | Ga0070676_10134121 | 3300005328 | Bacteria | 1569 |
| 12 | Ga0070676_10179262 | 3300005328 | Bacteria | 1376 |
| 13 | Ga0070683_100057675 | 3300005329 | Bacteria | 3608 |
| 14 | Ga0070683_100078455 | 3300005329 | Bacteria | 3089 |
| 15 | Ga0070690_100002202 | 3300005330 | Bacteria | 10426 |
| 16 | Ga0070690_100007634 | 3300005330 | Bacteria | 6196 |
| 17 | Ga0070670_100000350 | 3300005331 | Bacteria | 38698 |
| 18 | Ga0070670_100126916 | 3300005331 | Bacteria | 2202 |
| 19 | Ga0070677_10011483 | 3300005333 | Bacteria | 3056 |
| 20 | Ga0068869_100150205 | 3300005334 | Bacteria | 1806 |
| 21 | Ga0070666_10001765 | 3300005335 | Bacteria | 13184 |
| 22 | Ga0070666_10007443 | 3300005335 | Bacteria | 6751 |
| 23 | Ga0070666_10012055 | 3300005335 | Bacteria | 5443 |
| 24 | Ga0070666_10022434 | 3300005335 | Bacteria | 4098 |
| 25 | Ga0070680_100059059 | 3300005336 | Bacteria | 3137 |
| 26 | Ga0068868_100002214 | 3300005338 | Bacteria | 13431 |
| 27 | Ga0070660_100004780 | 3300005339 | Bacteria | 9365 |
| 28 | Ga0070660_100009808 | 3300005339 | Bacteria | 6750 |
| 29 | Ga0070660_100010328 | 3300005339 | Bacteria | 6594 |
| 30 | Ga0070660_100026725 | 3300005339 | Bacteria | 4301 |
| 31 | Ga0070660_100069750 | 3300005339 | Bacteria | 2742 |
| 32 | Ga0070660_100179705 | 3300005339 | Unclassified | 1712 |
| 33 | Ga0070660_100182339 | 3300005339 | Bacteria | 1699 |
| 34 | Ga0070661_100000353 | 3300005344 | Bacteria | 36189 |
| 35 | Ga0070661_100018670 | 3300005344 | Bacteria | 4934 |
| 36 | Ga0070661_100033608 | 3300005344 | Bacteria | 3716 |
| 37 | Ga0070692_10036666 | 3300005345 | Bacteria | 2489 |
| 38 | Ga0070668_100009798 | 3300005347 | Bacteria | 7103 |
| 39 | Ga0070675_100001470 | 3300005354 | Bacteria | 17369 |
| 40 | Ga0070671_100000469 | 3300005355 | Bacteria | 28112 |
| 41 | Ga0070671_100002050 | 3300005355 | Bacteria | 15531 |
| 42 | Ga0070671_100035254 | 3300005355 | Unclassified | 4145 |
| 43 | Ga0070674_100009053 | 3300005356 | Bacteria | 5950 |
| 44 | Ga0070674_100108154 | 3300005356 | Bacteria | 2037 |
| 45 | Ga0070674_100122533 | 3300005356 | Bacteria | 1927 |
| 46 | Ga0070673_100001044 | 3300005364 | Bacteria | 15715 |
| 47 | Ga0070673_100002148 | 3300005364 | Bacteria | 11943 |
| 48 | Ga0070673_100047163 | 3300005364 | Bacteria | 3351 |
| 49 | Ga0070673_100398957 | 3300005364 | Unclassified | 1229 |
| 50 | Ga0070659_100002552 | 3300005366 | Bacteria | 12953 |
| 51 | Ga0070659_100017167 | 3300005366 | Bacteria | 5441 |
| 52 | Ga0070659_100029980 | 3300005366 | Bacteria | 4207 |
| 53 | Ga0070659_100058120 | 3300005366 | Bacteria | 3051 |
| 54 | Ga0070659_100060886 | 3300005366 | Bacteria | 2983 |
| 55 | Ga0070659_100111999 | 3300005366 | Bacteria | 2204 |
| 56 | Ga0070667_100005527 | 3300005367 | Bacteria | 10552 |
| 57 | Ga0070667_100006651 | 3300005367 | Bacteria | 9609 |
| 58 | Ga0070667_100020407 | 3300005367 | Bacteria | 5501 |
| 59 | Ga0070667_100101381 | 3300005367 | Bacteria | 2487 |
| 60 | Ga0070663_100014523 | 3300005455 | Bacteria | 5058 |
| 61 | Ga0070663_100047890 | 3300005455 | Bacteria | 3029 |
| 62 | Ga0070663_100137652 | 3300005455 | Bacteria | 1861 |
| 63 | Ga0070663_100189413 | 3300005455 | Unclassified | 1600 |
| 64 | Ga0070678_100016394 | 3300005456 | Bacteria | 4739 |
| 65 | Ga0070678_100029984 | 3300005456 | Bacteria | 3732 |
| 66 | Ga0070678_100045208 | 3300005456 | Bacteria | 3148 |
| 67 | Ga0070678_100053586 | 3300005456 | Bacteria | 2934 |
| 68 | Ga0070662_100000611 | 3300005457 | Bacteria | 21817 |
| 69 | Ga0070662_100001103 | 3300005457 | Bacteria | 16461 |
| 70 | Ga0070662_100003172 | 3300005457 | Bacteria | 10217 |
| 71 | Ga0070662_100016901 | 3300005457 | Bacteria | 4905 |
| 72 | Ga0070681_10014906 | 3300005458 | Bacteria | 7729 |
| 73 | Ga0070681_10103659 | 3300005458 | Bacteria | 2788 |
| 74 | Ga0070681_10151835 | 3300005458 | Unclassified | 2242 |
| 75 | Ga0068867_100068074 | 3300005459 | Bacteria | 2656 |
| 76 | Ga0070679_100002274 | 3300005530 | Bacteria | 17357 |
| 77 | Ga0070679_100081154 | 3300005530 | Bacteria | 3232 |
| 78 | Ga0070679_100178831 | 3300005530 | Bacteria | 2094 |
| 79 | Ga0070684_100121179 | 3300005535 | Bacteria | 2353 |
| 80 | Ga0068853_100001382 | 3300005539 | Bacteria | 17525 |
| 81 | Ga0068853_100128291 | 3300005539 | Bacteria | 2268 |
| 82 | Ga0068853_100325633 | 3300005539 | Bacteria | 1425 |
| 83 | Ga0070672_100006163 | 3300005543 | Bacteria | 8027 |
| 84 | Ga0070672_100027932 | 3300005543 | Bacteria | 4214 |
| 85 | Ga0070672_100070281 | 3300005543 | Bacteria | 2782 |
| 86 | Ga0070672_100356672 | 3300005543 | Unclassified | 1247 |
| 87 | Ga0070665_100004805 | 3300005548 | Bacteria | 14043 |
| 88 | Ga0070665_100013302 | 3300005548 | Bacteria | 8285 |
| 89 | Ga0068855_100004984 | 3300005563 | Bacteria | 16204 |
| 90 | Ga0070664_100001162 | 3300005564 | Bacteria | 20890 |
| 91 | Ga0070664_100001687 | 3300005564 | Bacteria | 17694 |
| 92 | Ga0070664_100008160 | 3300005564 | Bacteria | 8467 |
| 93 | Ga0070664_100010793 | 3300005564 | Bacteria | 7408 |
| 94 | Ga0070664_100013458 | 3300005564 | Bacteria | 6662 |
| 95 | Ga0070664_100042270 | 3300005564 | Bacteria | 3848 |
| 96 | Ga0070664_100143617 | 3300005564 | Bacteria | 2103 |
| 97 | Ga0068857_100055434 | 3300005577 | Bacteria | 3518 |
| 98 | Ga0068857_100201444 | 3300005577 | Bacteria | 1815 |
| 99 | Ga0068854_100002015 | 3300005578 | Bacteria | 12440 |
| 100 | Ga0068854_100022275 | 3300005578 | Bacteria | 4312 |
| 101 | Ga0068856_100011430 | 3300005614 | Bacteria | 8612 |
| 102 | Ga0068852_100014671 | 3300005616 | Bacteria | 6042 |
| 103 | Ga0068852_100027650 | 3300005616 | Bacteria | 4625 |
| 104 | Ga0068852_100385496 | 3300005616 | Bacteria | 1376 |
| 105 | Ga0068859_100017396 | 3300005617 | Bacteria | 7223 |
| 106 | Ga0068859_100061635 | 3300005617 | Bacteria | 3780 |
| 107 | Ga0068859_100485219 | 3300005617 | Bacteria | 1331 |
| 108 | Ga0068864_100001075 | 3300005618 | Bacteria | 22935 |
| 109 | Ga0068864_100012325 | 3300005618 | Bacteria | 7066 |
| 110 | Ga0068864_100021179 | 3300005618 | Bacteria | 5445 |
| 111 | Ga0068866_10028690 | 3300005718 | Bacteria | 2654 |
| 112 | Ga0068851_10000728 | 3300005834 | Bacteria | 14046 |
| 113 | Ga0068851_10006700 | 3300005834 | Bacteria | 5270 |
| 114 | Ga0068863_100023634 | 3300005841 | Bacteria | 5868 |
| 115 | Ga0068863_100098766 | 3300005841 | Bacteria | 2773 |
| 116 | Ga0068863_100149253 | 3300005841 | Unclassified | 2236 |
| 117 | Ga0068858_100008732 | 3300005842 | Bacteria | 9730 |
| 118 | Ga0068858_100019438 | 3300005842 | Bacteria | 6353 |
| 119 | Ga0068862_100026931 | 3300005844 | Bacteria | 4835 |
| 120 | Ga0097621_100021317 | 3300006237 | Bacteria | 5010 |
| 121 | Ga0068871_100015362 | 3300006358 | Bacteria | 5727 |
| 122 | Ga0068871_100152960 | 3300006358 | Bacteria | 1968 |
| 123 | Ga0097620_100017395 | 3300006931 | Bacteria | 7223 |
| 124 | Ga0097620_100061634 | 3300006931 | Bacteria | 3780 |
| 125 | Ga0097620_100485289 | 3300006931 | Bacteria | 1331 |
| 126 | Ga0105245_10004406 | 3300009098 | Bacteria | 12454 |
| 127 | Ga0105245_10075255 | 3300009098 | Bacteria | 3074 |
| 128 | Ga0105243_10034264 | 3300009148 | Bacteria | 3929 |
| 129 | Ga0105242_10011440 | 3300009176 | Bacteria | 6823 |
| 130 | Ga0105248_10000928 | 3300009177 | Bacteria | 32626 |
| 131 | Ga0105248_10004025 | 3300009177 | Bacteria | 16256 |
| 132 | Ga0105248_10011130 | 3300009177 | Bacteria | 9927 |
| 133 | Ga0105248_10017334 | 3300009177 | Bacteria | 7938 |
| 134 | Ga0105248_10102769 | 3300009177 | Bacteria | 3221 |
| 135 | Ga0105238_10004102 | 3300009551 | Bacteria | 14455 |
| 136 | Ga0157373_10008388 | 3300013100 | Bacteria | 7677 |
| 137 | Ga0157373_10027702 | 3300013100 | Bacteria | 4088 |
| 138 | Ga0157371_10001453 | 3300013102 | Bacteria | 24579 |
| 139 | Ga0157371_10034750 | 3300013102 | Bacteria | 3614 |
| 140 | Ga0157371_10048407 | 3300013102 | Bacteria | 3021 |
| 141 | Ga0157370_10001823 | 3300013104 | Bacteria | 26240 |
| 142 | Ga0157369_10001208 | 3300013105 | Bacteria | 32161 |
| 143 | Ga0157369_10053188 | 3300013105 | Bacteria | 4378 |
| 144 | Ga0157374_10042657 | 3300013296 | Bacteria | 4186 |
| 145 | Ga0157374_10146109 | 3300013296 | Bacteria | 2297 |
| 146 | Ga0157378_10046674 | 3300013297 | Bacteria | 3850 |
| 147 | Ga0163162_10054968 | 3300013306 | Bacteria | 4006 |
| 148 | Ga0157372_10004254 | 3300013307 | Bacteria | 15307 |
| 149 | Ga0157375_10029033 | 3300013308 | Bacteria | 5195 |
| 150 | Ga0157375_10059046 | 3300013308 | Bacteria | 3798 |
| 151 | Ga0157375_10171006 | 3300013308 | Bacteria | 2320 |
| 152 | Ga0163163_10011557 | 3300014325 | Bacteria | 8017 |
| 153 | Ga0157379_10006016 | 3300014968 | Bacteria | 10460 |
| 154 | Ga0157376_10002864 | 3300014969 | Bacteria | 11812 |
| 155 | Ga0207656_10028475 | 3300025321 | Bacteria | 2294 |
| 156 | Ga0207682_10014995 | 3300025893 | Bacteria | 3018 |
| 157 | Ga0207642_10009490 | 3300025899 | Bacteria | 3387 |
| 158 | Ga0207688_10028956 | 3300025901 | Bacteria | 3047 |
| 159 | Ga0207680_10008173 | 3300025903 | Bacteria | 5127 |
| 160 | Ga0207680_10016904 | 3300025903 | Bacteria | 3842 |
| 161 | Ga0207680_10117700 | 3300025903 | Unclassified | 1733 |
| 162 | Ga0207647_10028069 | 3300025904 | Bacteria | 3661 |
| 163 | Ga0207645_10007949 | 3300025907 | Bacteria | 7446 |
| 164 | Ga0207645_10153665 | 3300025907 | Bacteria | 1503 |
| 165 | Ga0207645_10183482 | 3300025907 | Bacteria | 1373 |
| 166 | Ga0207705_10003299 | 3300025909 | Bacteria | 12286 |
| 167 | Ga0207707_10011793 | 3300025912 | Bacteria | 7604 |
| 168 | Ga0207707_10220566 | 3300025912 | Unclassified | 1651 |
| 169 | Ga0207707_10315997 | 3300025912 | Unclassified | 1349 |
| 170 | Ga0207660_10009063 | 3300025917 | Bacteria | 6445 |
| 171 | Ga0207660_10193965 | 3300025917 | Unclassified | 1583 |
| 172 | Ga0207657_10000048 | 3300025919 | Bacteria | 111458 |
| 173 | Ga0207657_10000868 | 3300025919 | Bacteria | 31880 |
| 174 | Ga0207657_10001537 | 3300025919 | Bacteria | 24722 |
| 175 | Ga0207657_10003045 | 3300025919 | Bacteria | 17927 |
| 176 | Ga0207657_10012796 | 3300025919 | Bacteria | 8258 |
| 177 | Ga0207657_10030143 | 3300025919 | Bacteria | 4929 |
| 178 | Ga0207649_10000959 | 3300025920 | Bacteria | 17899 |
| 179 | Ga0207649_10042438 | 3300025920 | Bacteria | 2775 |
| 180 | Ga0207649_10137749 | 3300025920 | Bacteria | 1666 |
| 181 | Ga0207652_10013974 | 3300025921 | Bacteria | 6501 |
| 182 | Ga0207681_10050759 | 3300025923 | Bacteria | 2807 |
| 183 | Ga0207694_10059298 | 3300025924 | Bacteria | 2976 |
| 184 | Ga0207650_10005483 | 3300025925 | Bacteria | 8659 |
| 185 | Ga0207659_10161550 | 3300025926 | Unclassified | 1759 |
| 186 | Ga0207687_10020379 | 3300025927 | Bacteria | 4398 |
| 187 | Ga0207644_10003923 | 3300025931 | Bacteria | 9648 |
| 188 | Ga0207644_10006596 | 3300025931 | Bacteria | 7562 |
| 189 | Ga0207644_10014343 | 3300025931 | Bacteria | 5300 |
| 190 | Ga0207644_10132966 | 3300025931 | Bacteria | 1907 |
| 191 | Ga0207690_10000816 | 3300025932 | Bacteria | 19990 |
| 192 | Ga0207690_10009409 | 3300025932 | Bacteria | 5804 |
| 193 | Ga0207706_10000381 | 3300025933 | Bacteria | 48362 |
| 194 | Ga0207706_10002600 | 3300025933 | Bacteria | 17573 |
| 195 | Ga0207706_10006075 | 3300025933 | Bacteria | 11222 |
| 196 | Ga0207706_10016743 | 3300025933 | Bacteria | 6617 |
| 197 | Ga0207706_10017222 | 3300025933 | Bacteria | 6514 |
| 198 | Ga0207686_10011881 | 3300025934 | Bacteria | 4779 |
| 199 | Ga0207669_10005450 | 3300025937 | Bacteria | 5710 |
| 200 | Ga0207669_10012863 | 3300025937 | Bacteria | 4132 |
| 201 | Ga0207704_10147927 | 3300025938 | Bacteria | 1653 |
| 202 | Ga0207691_10006382 | 3300025940 | Bacteria | 11387 |
| 203 | Ga0207691_10012242 | 3300025940 | Bacteria | 8222 |
| 204 | Ga0207691_10321196 | 3300025940 | Bacteria | 1327 |
| 205 | Ga0207711_10000243 | 3300025941 | Bacteria | 58447 |
| 206 | Ga0207711_10002866 | 3300025941 | Bacteria | 15126 |
| 207 | Ga0207689_10034851 | 3300025942 | Unclassified | 4180 |
| 208 | Ga0207689_10144200 | 3300025942 | Bacteria | 1962 |
| 209 | Ga0207679_10028198 | 3300025945 | Bacteria | 3892 |
| 210 | Ga0207679_10064359 | 3300025945 | Bacteria | 2740 |
| 211 | Ga0207679_10075885 | 3300025945 | Bacteria | 2552 |
| 212 | Ga0207679_10114132 | 3300025945 | Bacteria | 2138 |
| 213 | Ga0207679_10126646 | 3300025945 | Bacteria | 2042 |
| 214 | Ga0207667_10010559 | 3300025949 | Bacteria | 10790 |
| 215 | Ga0207651_10002647 | 3300025960 | Bacteria | 8562 |
| 216 | Ga0207651_10010863 | 3300025960 | Bacteria | 5066 |
| 217 | Ga0207651_10111952 | 3300025960 | Bacteria | 2051 |
| 218 | Ga0207651_10349265 | 3300025960 | Unclassified | 1245 |
| 219 | Ga0207668_10000150 | 3300025972 | Bacteria | 48022 |
| 220 | Ga0207640_10035270 | 3300025981 | Bacteria | 3129 |
| 221 | Ga0207658_10019158 | 3300025986 | Bacteria | 4732 |
| 222 | Ga0207658_10094739 | 3300025986 | Bacteria | 2324 |
| 223 | Ga0207677_10001278 | 3300026023 | Bacteria | 13512 |
| 224 | Ga0207677_10065576 | 3300026023 | Bacteria | 2534 |
| 225 | Ga0207703_10001643 | 3300026035 | Bacteria | 20120 |
| 226 | Ga0207639_10001098 | 3300026041 | Bacteria | 18397 |
| 227 | Ga0207639_10055072 | 3300026041 | Bacteria | 3042 |
| 228 | Ga0207678_10000357 | 3300026067 | Bacteria | 41546 |
| 229 | Ga0207678_10002532 | 3300026067 | Bacteria | 16661 |
| 230 | Ga0207678_10017319 | 3300026067 | Bacteria | 6325 |
| 231 | Ga0207678_10020153 | 3300026067 | Bacteria | 5856 |
| 232 | Ga0207678_10165274 | 3300026067 | Unclassified | 1890 |
| 233 | Ga0207702_10170455 | 3300026078 | Bacteria | 1995 |
| 234 | Ga0207641_10030712 | 3300026088 | Bacteria | 4451 |
| 235 | Ga0207641_10321168 | 3300026088 | Bacteria | 1468 |
| 236 | Ga0207641_10377867 | 3300026088 | Bacteria | 1356 |
| 237 | Ga0207648_10003766 | 3300026089 | Bacteria | 15844 |
| 238 | Ga0207648_10014617 | 3300026089 | Bacteria | 7248 |
| 239 | Ga0207648_10057327 | 3300026089 | Bacteria | 3398 |
| 240 | Ga0207676_10004053 | 3300026095 | Bacteria | 10333 |
| 241 | Ga0207676_10009061 | 3300026095 | Bacteria | 7087 |
| 242 | Ga0207676_10268670 | 3300026095 | Unclassified | 1543 |
| 243 | Ga0207674_10002612 | 3300026116 | Bacteria | 22594 |
| 244 | Ga0207674_10021715 | 3300026116 | Bacteria | 6909 |
| 245 | Ga0207683_10003677 | 3300026121 | Bacteria | 13324 |
| 246 | Ga0207683_10004412 | 3300026121 | Bacteria | 12166 |
| 247 | Ga0207683_10066996 | 3300026121 | Bacteria | 3167 |
| 248 | Ga0207698_10295568 | 3300026142 | Unclassified | 1505 |
| 249 | Ga0268266_10004977 | 3300028379 | Bacteria | 12565 |
| 250 | Ga0268266_10007425 | 3300028379 | Bacteria | 9892 |
| 251 | Ga0268266_10025866 | 3300028379 | Bacteria | 4993 |
| 252 | Ga0268266_10408941 | 3300028379 | Unclassified | 1284 |
| 253 | Ga0268265_10003997 | 3300028380 | Bacteria | 10380 |
| 254 | Ga0373931_0169360 | 3300035691 | Unclassified | 1286 |
| 255 | Ga0395899_0002038 | 3300037312 | Bacteria | 16634 |
| 256 | Ga0395899_0095580 | 3300037312 | Bacteria | 2149 |
| 257 | Ga0395899_0098192 | 3300037312 | Bacteria | 2116 |
| 258 | Ga0395899_0100232 | 3300037312 | Unclassified | 2092 |
| 259 | Ga0395900_0005857 | 3300037418 | Bacteria | 12832 |
| 260 | Ga0395900_0012640 | 3300037418 | Bacteria | 8632 |
| 261 | Ga0395900_0019732 | 3300037418 | Bacteria | 6871 |
| 262 | Ga0395900_0043153 | 3300037418 | Bacteria | 4647 |
| 263 | Ga0395900_0101614 | 3300037418 | Bacteria | 2953 |
| 264 | Ga0395900_0115483 | 3300037418 | Bacteria | 2754 |
| 265 | Ga0395900_0388301 | 3300037418 | Bacteria | 1362 |
| 266 | Ga0395898_0005548 | 3300037466 | Bacteria | 13612 |
| 267 | Ga0395898_0036595 | 3300037466 | Bacteria | 4873 |
| 268 | Ga0395898_0037459 | 3300037466 | Bacteria | 4811 |
| 269 | Ga0395898_0170383 | 3300037466 | Bacteria | 2081 |
| 270 | Ga0395905_0000204 | 3300037471 | Bacteria | 92152 |
| 271 | Ga0395905_0003297 | 3300037471 | Bacteria | 17333 |
| 272 | Ga0395905_0005840 | 3300037471 | Bacteria | 12508 |
| 273 | Ga0395905_0006460 | 3300037471 | Bacteria | 11799 |
| 274 | Ga0395905_0006483 | 3300037471 | Bacteria | 11777 |
| 275 | Ga0395905_0035581 | 3300037471 | Bacteria | 4676 |
| 276 | Ga0395905_0035859 | 3300037471 | Bacteria | 4658 |
| 277 | Ga0395905_0043166 | 3300037471 | Bacteria | 4230 |
| 278 | Ga0395905_0069154 | 3300037471 | Bacteria | 3307 |
| 279 | Ga0395905_0113564 | 3300037471 | Unclassified | 2545 |
| 280 | Ga0395905_0118355 | 3300037471 | Bacteria | 2490 |
| 281 | Ga0395905_0162354 | 3300037471 | Bacteria | 2099 |
| 282 | Ga0395901_0007192 | 3300038443 | Bacteria | 11225 |
| 283 | Ga0395901_0009524 | 3300038443 | Bacteria | 9856 |
| 284 | Ga0395901_0021731 | 3300038443 | Bacteria | 6574 |
| 285 | Ga0395901_0046698 | 3300038443 | Bacteria | 4499 |
| 286 | Ga0395901_0055684 | 3300038443 | Bacteria | 4113 |
| 287 | Ga0395901_0078326 | 3300038443 | Bacteria | 3451 |
| 288 | Ga0395901_0101430 | 3300038443 | Bacteria | 3020 |
| 289 | Ga0395901_0120179 | 3300038443 | Bacteria | 2761 |
| 290 | Ga0395901_0214925 | 3300038443 | Bacteria | 2011 |
| 291 | Ga0495621_0086374 | 3300046539 | Bacteria | 1177 |
| 292 | Ga0495668_0002958 | 3300046616 | Bacteria | 13346 |
| 293 | Ga0495669_0002043 | 3300046684 | Bacteria | 8278 |
| 294 | Ga0495669_0003311 | 3300046684 | Bacteria | 6628 |
| 295 | Ga0495669_0004483 | 3300046684 | Bacteria | 5768 |
| 296 | Ga0495677_0036401 | 3300047445 | Bacteria | 1798 |
| 297 | Ga0496100_0044020 | 3300048903 | Bacteria | 2857 |
| 298 | Ga0496101_0020972 | 3300048904 | Bacteria | 4484 |
| 299 | Ga0496101_0021336 | 3300048904 | Bacteria | 4450 |
| 300 | Ga0496102_0021417 | 3300048905 | Bacteria | 5717 |
| 301 | Ga0496103_0009399 | 3300048906 | Bacteria | 5792 |
| 302 | Ga0496104_0394557 | 3300048907 | Unclassified | 1296 |
| 303 | Ga0496106_0000666 | 3300048909 | Bacteria | 24598 |
| 304 | Ga0496106_0036999 | 3300048909 | Bacteria | 3650 |
| 305 | Ga0496107_0000181 | 3300048910 | Bacteria | 32803 |
| 306 | Ga0496107_0038081 | 3300048910 | Unclassified | 3451 |
| 307 | Ga0496108_0006821 | 3300048911 | Bacteria | 9239 |
| 308 | Ga0496108_0036526 | 3300048911 | Bacteria | 4088 |
| 309 | Ga0496109_0000774 | 3300048912 | Bacteria | 26581 |
| 310 | Ga0496109_0008802 | 3300048912 | Bacteria | 8596 |
| 311 | Ga0496109_0379860 | 3300048912 | Unclassified | 1334 |
| 312 | Ga0496110_0007962 | 3300048913 | Bacteria | 8488 |
| 313 | Ga0496110_0012164 | 3300048913 | Bacteria | 7070 |
| 314 | Ga0496110_0028038 | 3300048913 | Bacteria | 4832 |
| 315 | Ga0496111_0001460 | 3300048914 | Bacteria | 13524 |
| 316 | Ga0496111_0094761 | 3300048914 | Bacteria | 2189 |
| 317 | Ga0496111_0098006 | 3300048914 | Unclassified | 2152 |
| 318 | Ga0496112_0000354 | 3300048915 | Bacteria | 29882 |
| 319 | Ga0496112_0201212 | 3300048915 | Bacteria | 1951 |
| 320 | Ga0496113_0004786 | 3300048916 | Bacteria | 8365 |
| 321 | Ga0496113_0008615 | 3300048916 | Bacteria | 6651 |
| 322 | Ga0496114_0053618 | 3300048917 | Bacteria | 3361 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10171914 | Ga0070658_101719141 | 261 |
| 2 | 3300005616 | Ga0068852_100385496 | Ga0068852_1003854961 | 261 |
| 3 | 3300026067 | Ga0207678_10020153 | Ga0207678_100201532 | 261 |
| 4 | 3300001990 | JGI24737J22298_10020575 | JGI24737J22298_100205752 | 277 |
| 5 | 3300005364 | Ga0070673_100047163 | Ga0070673_1000471633 | 277 |
| 6 | 3300005366 | Ga0070659_100017167 | Ga0070659_1000171675 | 277 |
| 7 | 3300005543 | Ga0070672_100356672 | Ga0070672_1003566721 | 277 |
| 8 | 3300005618 | Ga0068864_100012325 | Ga0068864_1000123254 | 277 |
| 9 | 3300005841 | Ga0068863_100098766 | Ga0068863_1000987662 | 277 |
| 10 | 3300009177 | Ga0105248_10000928 | Ga0105248_1000092811 | 277 |
| 11 | 3300025940 | Ga0207691_10321196 | Ga0207691_103211962 | 277 |
| 12 | 3300025941 | Ga0207711_10000243 | Ga0207711_1000024343 | 277 |
| 13 | 3300026088 | Ga0207641_10321168 | Ga0207641_103211681 | 277 |
| 14 | 3300026095 | Ga0207676_10004053 | Ga0207676_1000405311 | 277 |
| 15 | 3300048904 | Ga0496101_0020972 | Ga0496101_0020972_3307_4347 | 277 |
| 16 | 3300048907 | Ga0496104_0394557 | Ga0496104_0394557_119_1159 | 277 |
| 17 | 3300048909 | Ga0496106_0000666 | Ga0496106_0000666_16798_17838 | 277 |
| 18 | 3300048910 | Ga0496107_0000181 | Ga0496107_0000181_6565_7605 | 277 |
| 19 | 3300048911 | Ga0496108_0006821 | Ga0496108_0006821_5171_6211 | 277 |
| 20 | 3300048912 | Ga0496109_0000774 | Ga0496109_0000774_19020_20060 | 277 |
| 21 | 3300048913 | Ga0496110_0028038 | Ga0496110_0028038_692_1732 | 277 |
| 22 | 3300048914 | Ga0496111_0001460 | Ga0496111_0001460_8214_9254 | 277 |
| 23 | 3300048915 | Ga0496112_0000354 | Ga0496112_0000354_21959_22999 | 277 |
| 24 | 3300048916 | Ga0496113_0004786 | Ga0496113_0004786_2624_3664 | 277 |
| 25 | 3300005564 | Ga0070664_100143617 | Ga0070664_1001436172 | 281 |
| 26 | 3300025945 | Ga0207679_10126646 | Ga0207679_101266462 | 281 |
| 27 | 3300005355 | Ga0070671_100000469 | Ga0070671_1000004696 | 282 |
| 28 | 3300025931 | Ga0207644_10006596 | Ga0207644_100065961 | 282 |
| 29 | 3300025932 | Ga0207690_10009409 | Ga0207690_100094094 | 282 |
| 30 | 3300005530 | Ga0070679_100178831 | Ga0070679_1001788313 | 286 |
| 31 | 3300005329 | Ga0070683_100057675 | Ga0070683_1000576755 | 288 |
| 32 | 3300005336 | Ga0070680_100059059 | Ga0070680_1000590595 | 288 |
| 33 | 3300005339 | Ga0070660_100010328 | Ga0070660_1000103281 | 288 |
| 34 | 3300005344 | Ga0070661_100000353 | Ga0070661_10000035324 | 288 |
| 35 | 3300005345 | Ga0070692_10036666 | Ga0070692_100366663 | 288 |
| 36 | 3300005366 | Ga0070659_100002552 | Ga0070659_1000025525 | 288 |
| 37 | 3300005457 | Ga0070662_100000611 | Ga0070662_1000006117 | 288 |
| 38 | 3300005458 | Ga0070681_10014906 | Ga0070681_100149066 | 288 |
| 39 | 3300005458 | Ga0070681_10103659 | Ga0070681_101036592 | 288 |
| 40 | 3300005530 | Ga0070679_100002274 | Ga0070679_10000227418 | 288 |
| 41 | 3300005530 | Ga0070679_100081154 | Ga0070679_1000811543 | 288 |
| 42 | 3300005535 | Ga0070684_100121179 | Ga0070684_1001211794 | 288 |
| 43 | 3300005539 | Ga0068853_100001382 | Ga0068853_10000138217 | 288 |
| 44 | 3300005563 | Ga0068855_100004984 | Ga0068855_10000498419 | 288 |
| 45 | 3300005564 | Ga0070664_100008160 | Ga0070664_1000081604 | 288 |
| 46 | 3300005577 | Ga0068857_100201444 | Ga0068857_1002014441 | 288 |
| 47 | 3300005578 | Ga0068854_100002015 | Ga0068854_1000020155 | 288 |
| 48 | 3300005614 | Ga0068856_100011430 | Ga0068856_1000114305 | 288 |
| 49 | 3300013100 | Ga0157373_10008388 | Ga0157373_100083886 | 288 |
| 50 | 3300013102 | Ga0157371_10001453 | Ga0157371_1000145323 | 288 |
| 51 | 3300013104 | Ga0157370_10001823 | Ga0157370_1000182314 | 288 |
| 52 | 3300013105 | Ga0157369_10001208 | Ga0157369_1000120820 | 288 |
| 53 | 3300013307 | Ga0157372_10004254 | Ga0157372_100042543 | 288 |
| 54 | 3300025912 | Ga0207707_10011793 | Ga0207707_100117935 | 288 |
| 55 | 3300025917 | Ga0207660_10009063 | Ga0207660_100090635 | 288 |
| 56 | 3300025919 | Ga0207657_10000048 | Ga0207657_1000004830 | 288 |
| 57 | 3300025920 | Ga0207649_10000959 | Ga0207649_100009595 | 288 |
| 58 | 3300025921 | Ga0207652_10013974 | Ga0207652_100139742 | 288 |
| 59 | 3300025932 | Ga0207690_10000816 | Ga0207690_100008167 | 288 |
| 60 | 3300025933 | Ga0207706_10000381 | Ga0207706_1000038120 | 288 |
| 61 | 3300025945 | Ga0207679_10028198 | Ga0207679_100281982 | 288 |
| 62 | 3300025949 | Ga0207667_10010559 | Ga0207667_100105592 | 288 |
| 63 | 3300025981 | Ga0207640_10035270 | Ga0207640_100352701 | 288 |
| 64 | 3300026041 | Ga0207639_10001098 | Ga0207639_1000109818 | 288 |
| 65 | 3300026078 | Ga0207702_10170455 | Ga0207702_101704553 | 288 |
| 66 | 3300026116 | Ga0207674_10021715 | Ga0207674_100217156 | 288 |
| 67 | 3300048917 | Ga0496114_0053618 | Ga0496114_0053618_77_1096 | 290 |
| 68 | 3300005539 | Ga0068853_100325633 | Ga0068853_1003256331 | 293 |
| 69 | 3300005841 | Ga0068863_100149253 | Ga0068863_1001492532 | 293 |
| 70 | 3300005356 | Ga0070674_100108154 | Ga0070674_1001081542 | 294 |
| 71 | 3300005543 | Ga0070672_100070281 | Ga0070672_1000702814 | 294 |
| 72 | 3300048915 | Ga0496112_0201212 | Ga0496112_0201212_511_1551 | 294 |
| 73 | 3300005844 | Ga0068862_100026931 | Ga0068862_1000269312 | 295 |
| 74 | 3300028380 | Ga0268265_10003997 | Ga0268265_100039974 | 295 |
| 75 | 3300037471 | Ga0395905_0003297 | Ga0395905_0003297_7237_8262 | 296 |
| 76 | 3300005458 | Ga0070681_10151835 | Ga0070681_101518352 | 297 |
| 77 | 3300025912 | Ga0207707_10220566 | Ga0207707_102205662 | 297 |
| 78 | 3300025919 | Ga0207657_10003045 | Ga0207657_100030452 | 297 |
| 79 | 3300005339 | Ga0070660_100069750 | Ga0070660_1000697502 | 298 |
| 80 | 3300005366 | Ga0070659_100058120 | Ga0070659_1000581202 | 298 |
| 81 | 3300005456 | Ga0070678_100029984 | Ga0070678_1000299843 | 298 |
| 82 | 3300025919 | Ga0207657_10030143 | Ga0207657_100301438 | 298 |
| 83 | 3300025960 | Ga0207651_10111952 | Ga0207651_101119522 | 298 |
| 84 | 3300026121 | Ga0207683_10003677 | Ga0207683_1000367715 | 298 |
| 85 | 3300005548 | Ga0070665_100004805 | Ga0070665_1000048057 | 299 |
| 86 | 3300028379 | Ga0268266_10004977 | Ga0268266_100049776 | 299 |
| 87 | 3300037471 | Ga0395905_0000204 | Ga0395905_0000204_73803_74861 | 299 |
| 88 | 3300005328 | Ga0070676_10002563 | Ga0070676_100025634 | 300 |
| 89 | 3300005334 | Ga0068869_100150205 | Ga0068869_1001502052 | 300 |
| 90 | 3300005347 | Ga0070668_100009798 | Ga0070668_1000097983 | 300 |
| 91 | 3300005356 | Ga0070674_100122533 | Ga0070674_1001225333 | 300 |
| 92 | 3300005367 | Ga0070667_100101381 | Ga0070667_1001013813 | 300 |
| 93 | 3300005456 | Ga0070678_100045208 | Ga0070678_1000452082 | 300 |
| 94 | 3300005459 | Ga0068867_100068074 | Ga0068867_1000680744 | 300 |
| 95 | 3300005543 | Ga0070672_100027932 | Ga0070672_1000279324 | 300 |
| 96 | 3300025907 | Ga0207645_10007949 | Ga0207645_100079496 | 300 |
| 97 | 3300025923 | Ga0207681_10050759 | Ga0207681_100507593 | 300 |
| 98 | 3300025942 | Ga0207689_10144200 | Ga0207689_101442002 | 300 |
| 99 | 3300025972 | Ga0207668_10000150 | Ga0207668_1000015012 | 300 |
| 100 | 3300025986 | Ga0207658_10094739 | Ga0207658_100947393 | 300 |
| 101 | 3300026089 | Ga0207648_10014617 | Ga0207648_100146174 | 300 |
| 102 | 3300025942 | Ga0207689_10034851 | Ga0207689_100348512 | 301 |
| 103 | 3300038443 | Ga0395901_0046698 | Ga0395901_0046698_226_1263 | 301 |
| 104 | 3300005327 | Ga0070658_10018600 | Ga0070658_100186008 | 302 |
| 105 | 3300005339 | Ga0070660_100004780 | Ga0070660_1000047808 | 302 |
| 106 | 3300005366 | Ga0070659_100111999 | Ga0070659_1001119992 | 302 |
| 107 | 3300005455 | Ga0070663_100047890 | Ga0070663_1000478902 | 302 |
| 108 | 3300009177 | Ga0105248_10017334 | Ga0105248_100173345 | 302 |
| 109 | 3300037471 | Ga0395905_0069154 | Ga0395905_0069154_2058_3116 | 302 |
| 110 | 3300037471 | Ga0395905_0118355 | Ga0395905_0118355_374_1387 | 302 |
| 111 | 3300046684 | Ga0495669_0004483 | Ga0495669_0004483_2275_3318 | 302 |
| 112 | 3300005339 | Ga0070660_100026725 | Ga0070660_1000267254 | 303 |
| 113 | 3300005339 | Ga0070660_100182339 | Ga0070660_1001823391 | 303 |
| 114 | 3300005564 | Ga0070664_100001162 | Ga0070664_1000011626 | 303 |
| 115 | 3300005539 | Ga0068853_100128291 | Ga0068853_1001282913 | 304 |
| 116 | 3300025933 | Ga0207706_10017222 | Ga0207706_100172229 | 304 |
| 117 | 3300005327 | Ga0070658_10027785 | Ga0070658_100277854 | 305 |
| 118 | 3300005331 | Ga0070670_100000350 | Ga0070670_1000003507 | 305 |
| 119 | 3300005333 | Ga0070677_10011483 | Ga0070677_100114834 | 305 |
| 120 | 3300005335 | Ga0070666_10007443 | Ga0070666_100074434 | 305 |
| 121 | 3300005354 | Ga0070675_100001470 | Ga0070675_10000147011 | 305 |
| 122 | 3300005355 | Ga0070671_100002050 | Ga0070671_1000020507 | 305 |
| 123 | 3300005364 | Ga0070673_100001044 | Ga0070673_1000010449 | 305 |
| 124 | 3300005367 | Ga0070667_100020407 | Ga0070667_1000204073 | 305 |
| 125 | 3300005455 | Ga0070663_100189413 | Ga0070663_1001894131 | 305 |
| 126 | 3300005456 | Ga0070678_100053586 | Ga0070678_1000535864 | 305 |
| 127 | 3300005457 | Ga0070662_100003172 | Ga0070662_1000031723 | 305 |
| 128 | 3300005543 | Ga0070672_100006163 | Ga0070672_1000061632 | 305 |
| 129 | 3300005564 | Ga0070664_100001687 | Ga0070664_10000168710 | 305 |
| 130 | 3300005618 | Ga0068864_100021179 | Ga0068864_1000211795 | 305 |
| 131 | 3300009177 | Ga0105248_10004025 | Ga0105248_1000402511 | 305 |
| 132 | 3300013308 | Ga0157375_10029033 | Ga0157375_100290334 | 305 |
| 133 | 3300025893 | Ga0207682_10014995 | Ga0207682_100149952 | 305 |
| 134 | 3300025903 | Ga0207680_10016904 | Ga0207680_100169042 | 305 |
| 135 | 3300025920 | Ga0207649_10042438 | Ga0207649_100424382 | 305 |
| 136 | 3300025925 | Ga0207650_10005483 | Ga0207650_100054835 | 305 |
| 137 | 3300025926 | Ga0207659_10161550 | Ga0207659_101615502 | 305 |
| 138 | 3300025931 | Ga0207644_10003923 | Ga0207644_100039232 | 305 |
| 139 | 3300025933 | Ga0207706_10016743 | Ga0207706_100167435 | 305 |
| 140 | 3300025937 | Ga0207669_10012863 | Ga0207669_100128633 | 305 |
| 141 | 3300025940 | Ga0207691_10006382 | Ga0207691_100063827 | 305 |
| 142 | 3300025945 | Ga0207679_10064359 | Ga0207679_100643592 | 305 |
| 143 | 3300025960 | Ga0207651_10002647 | Ga0207651_100026474 | 305 |
| 144 | 3300026095 | Ga0207676_10009061 | Ga0207676_100090614 | 305 |
| 145 | 3300026121 | Ga0207683_10066996 | Ga0207683_100669964 | 305 |
| 146 | 3300037312 | Ga0395899_0002038 | Ga0395899_0002038_5459_6553 | 305 |
| 147 | 3300037418 | Ga0395900_0388301 | Ga0395900_0388301_248_1342 | 305 |
| 148 | 3300046684 | Ga0495669_0002043 | Ga0495669_0002043_6693_7757 | 305 |
| 149 | 3300048912 | Ga0496109_0008802 | Ga0496109_0008802_4032_5096 | 305 |
| 150 | 3300048913 | Ga0496110_0007962 | Ga0496110_0007962_7094_8158 | 305 |
| 151 | 3300048914 | Ga0496111_0098006 | Ga0496111_0098006_31_1095 | 305 |
| 152 | 3300005617 | Ga0068859_100061635 | Ga0068859_1000616357 | 306 |
| 153 | 3300006931 | Ga0097620_100061634 | Ga0097620_1000616347 | 306 |
| 154 | 3300009177 | Ga0105248_10102769 | Ga0105248_101027695 | 306 |
| 155 | 3300026088 | Ga0207641_10377867 | Ga0207641_103778671 | 306 |
| 156 | 3300037471 | Ga0395905_0035859 | Ga0395905_0035859_2523_3533 | 306 |
| 157 | 3300038443 | Ga0395901_0078326 | Ga0395901_0078326_836_1846 | 306 |
| 158 | 3300037466 | Ga0395898_0005548 | Ga0395898_0005548_136_1230 | 308 |
| 159 | 3300009098 | Ga0105245_10075255 | Ga0105245_100752554 | 309 |
| 160 | 3300025912 | Ga0207707_10315997 | Ga0207707_103159971 | 309 |
| 161 | 3300025917 | Ga0207660_10193965 | Ga0207660_101939652 | 309 |
| 162 | 3300005328 | Ga0070676_10134121 | Ga0070676_101341211 | 313 |
| 163 | 3300005330 | Ga0070690_100007634 | Ga0070690_1000076348 | 313 |
| 164 | 3300005335 | Ga0070666_10001765 | Ga0070666_1000176511 | 313 |
| 165 | 3300005338 | Ga0068868_100002214 | Ga0068868_10000221413 | 313 |
| 166 | 3300005355 | Ga0070671_100035254 | Ga0070671_1000352542 | 313 |
| 167 | 3300005356 | Ga0070674_100009053 | Ga0070674_1000090538 | 313 |
| 168 | 3300005367 | Ga0070667_100005527 | Ga0070667_1000055276 | 313 |
| 169 | 3300005564 | Ga0070664_100013458 | Ga0070664_1000134586 | 313 |
| 170 | 3300005617 | Ga0068859_100485219 | Ga0068859_1004852191 | 313 |
| 171 | 3300005718 | Ga0068866_10028690 | Ga0068866_100286903 | 313 |
| 172 | 3300005842 | Ga0068858_100008732 | Ga0068858_1000087328 | 313 |
| 173 | 3300006931 | Ga0097620_100485289 | Ga0097620_1004852891 | 313 |
| 174 | 3300009177 | Ga0105248_10011130 | Ga0105248_100111308 | 313 |
| 175 | 3300013100 | Ga0157373_10027702 | Ga0157373_100277022 | 313 |
| 176 | 3300013308 | Ga0157375_10171006 | Ga0157375_101710064 | 313 |
| 177 | 3300025903 | Ga0207680_10008173 | Ga0207680_100081732 | 313 |
| 178 | 3300025907 | Ga0207645_10153665 | Ga0207645_101536652 | 313 |
| 179 | 3300025919 | Ga0207657_10000868 | Ga0207657_1000086832 | 313 |
| 180 | 3300025937 | Ga0207669_10005450 | Ga0207669_100054504 | 313 |
| 181 | 3300025941 | Ga0207711_10002866 | Ga0207711_1000286615 | 313 |
| 182 | 3300026023 | Ga0207677_10001278 | Ga0207677_100012789 | 313 |
| 183 | 3300026035 | Ga0207703_10001643 | Ga0207703_1000164310 | 313 |
| 184 | 3300026041 | Ga0207639_10055072 | Ga0207639_100550722 | 313 |
| 185 | 3300026067 | Ga0207678_10017319 | Ga0207678_100173193 | 313 |
| 186 | 3300037418 | Ga0395900_0043153 | Ga0395900_0043153_3067_4077 | 313 |
| 187 | 3300037466 | Ga0395898_0036595 | Ga0395898_0036595_2476_3486 | 313 |
| 188 | 3300038443 | Ga0395901_0021731 | Ga0395901_0021731_1388_2398 | 313 |
| 189 | 3300005327 | Ga0070658_10025675 | Ga0070658_100256755 | 314 |
| 190 | 3300005328 | Ga0070676_10022656 | Ga0070676_100226564 | 314 |
| 191 | 3300005330 | Ga0070690_100002202 | Ga0070690_1000022029 | 314 |
| 192 | 3300005331 | Ga0070670_100126916 | Ga0070670_1001269162 | 314 |
| 193 | 3300005335 | Ga0070666_10022434 | Ga0070666_100224342 | 314 |
| 194 | 3300005344 | Ga0070661_100033608 | Ga0070661_1000336084 | 314 |
| 195 | 3300005366 | Ga0070659_100029980 | Ga0070659_1000299804 | 314 |
| 196 | 3300005456 | Ga0070678_100016394 | Ga0070678_1000163945 | 314 |
| 197 | 3300005457 | Ga0070662_100001103 | Ga0070662_10000110316 | 314 |
| 198 | 3300005548 | Ga0070665_100013302 | Ga0070665_1000133024 | 314 |
| 199 | 3300005564 | Ga0070664_100010793 | Ga0070664_1000107933 | 314 |
| 200 | 3300005616 | Ga0068852_100014671 | Ga0068852_1000146717 | 314 |
| 201 | 3300005617 | Ga0068859_100017396 | Ga0068859_1000173967 | 314 |
| 202 | 3300005618 | Ga0068864_100001075 | Ga0068864_10000107522 | 314 |
| 203 | 3300005834 | Ga0068851_10000728 | Ga0068851_1000072814 | 314 |
| 204 | 3300005834 | Ga0068851_10006700 | Ga0068851_100067005 | 314 |
| 205 | 3300005841 | Ga0068863_100023634 | Ga0068863_1000236345 | 314 |
| 206 | 3300005842 | Ga0068858_100019438 | Ga0068858_1000194381 | 314 |
| 207 | 3300006237 | Ga0097621_100021317 | Ga0097621_1000213174 | 314 |
| 208 | 3300006358 | Ga0068871_100015362 | Ga0068871_1000153625 | 314 |
| 209 | 3300006358 | Ga0068871_100152960 | Ga0068871_1001529602 | 314 |
| 210 | 3300006931 | Ga0097620_100017395 | Ga0097620_1000173957 | 314 |
| 211 | 3300009098 | Ga0105245_10004406 | Ga0105245_100044064 | 314 |
| 212 | 3300009148 | Ga0105243_10034264 | Ga0105243_100342643 | 314 |
| 213 | 3300009176 | Ga0105242_10011440 | Ga0105242_100114409 | 314 |
| 214 | 3300009551 | Ga0105238_10004102 | Ga0105238_1000410212 | 314 |
| 215 | 3300013102 | Ga0157371_10034750 | Ga0157371_100347502 | 314 |
| 216 | 3300013105 | Ga0157369_10053188 | Ga0157369_100531884 | 314 |
| 217 | 3300013296 | Ga0157374_10042657 | Ga0157374_100426574 | 314 |
| 218 | 3300013296 | Ga0157374_10146109 | Ga0157374_101461092 | 314 |
| 219 | 3300013297 | Ga0157378_10046674 | Ga0157378_100466744 | 314 |
| 220 | 3300013306 | Ga0163162_10054968 | Ga0163162_100549684 | 314 |
| 221 | 3300013308 | Ga0157375_10059046 | Ga0157375_100590464 | 314 |
| 222 | 3300014325 | Ga0163163_10011557 | Ga0163163_100115577 | 314 |
| 223 | 3300014968 | Ga0157379_10006016 | Ga0157379_100060164 | 314 |
| 224 | 3300014969 | Ga0157376_10002864 | Ga0157376_100028646 | 314 |
| 225 | 3300025321 | Ga0207656_10028475 | Ga0207656_100284754 | 314 |
| 226 | 3300025899 | Ga0207642_10009490 | Ga0207642_100094905 | 314 |
| 227 | 3300025901 | Ga0207688_10028956 | Ga0207688_100289561 | 314 |
| 228 | 3300025903 | Ga0207680_10117700 | Ga0207680_101177002 | 314 |
| 229 | 3300025904 | Ga0207647_10028069 | Ga0207647_100280693 | 314 |
| 230 | 3300025909 | Ga0207705_10003299 | Ga0207705_100032991 | 314 |
| 231 | 3300025919 | Ga0207657_10012796 | Ga0207657_100127969 | 314 |
| 232 | 3300025924 | Ga0207694_10059298 | Ga0207694_100592982 | 314 |
| 233 | 3300025927 | Ga0207687_10020379 | Ga0207687_100203794 | 314 |
| 234 | 3300025931 | Ga0207644_10014343 | Ga0207644_100143436 | 314 |
| 235 | 3300025933 | Ga0207706_10002600 | Ga0207706_100026007 | 314 |
| 236 | 3300025934 | Ga0207686_10011881 | Ga0207686_100118813 | 314 |
| 237 | 3300025938 | Ga0207704_10147927 | Ga0207704_101479272 | 314 |
| 238 | 3300025940 | Ga0207691_10012242 | Ga0207691_100122428 | 314 |
| 239 | 3300025945 | Ga0207679_10075885 | Ga0207679_100758853 | 314 |
| 240 | 3300025960 | Ga0207651_10010863 | Ga0207651_100108636 | 314 |
| 241 | 3300026023 | Ga0207677_10065576 | Ga0207677_100655762 | 314 |
| 242 | 3300026067 | Ga0207678_10002532 | Ga0207678_1000253213 | 314 |
| 243 | 3300026088 | Ga0207641_10030712 | Ga0207641_100307128 | 314 |
| 244 | 3300026089 | Ga0207648_10003766 | Ga0207648_1000376613 | 314 |
| 245 | 3300026095 | Ga0207676_10268670 | Ga0207676_102686702 | 314 |
| 246 | 3300026121 | Ga0207683_10004412 | Ga0207683_100044124 | 314 |
| 247 | 3300026142 | Ga0207698_10295568 | Ga0207698_102955682 | 314 |
| 248 | 3300028379 | Ga0268266_10007425 | Ga0268266_100074255 | 314 |
| 249 | 3300028379 | Ga0268266_10408941 | Ga0268266_104089412 | 314 |
| 250 | 3300035691 | Ga0373931_0169360 | Ga0373931_0169360_174_1235 | 314 |
| 251 | 3300037312 | Ga0395899_0098192 | Ga0395899_0098192_891_1925 | 314 |
| 252 | 3300037418 | Ga0395900_0019732 | Ga0395900_0019732_2565_3626 | 314 |
| 253 | 3300037418 | Ga0395900_0101614 | Ga0395900_0101614_790_1821 | 314 |
| 254 | 3300037418 | Ga0395900_0115483 | Ga0395900_0115483_118_1152 | 314 |
| 255 | 3300037466 | Ga0395898_0170383 | Ga0395898_0170383_379_1410 | 314 |
| 256 | 3300037471 | Ga0395905_0006460 | Ga0395905_0006460_5834_6868 | 314 |
| 257 | 3300037471 | Ga0395905_0006483 | Ga0395905_0006483_3796_4827 | 314 |
| 258 | 3300037471 | Ga0395905_0043166 | Ga0395905_0043166_87_1148 | 314 |
| 259 | 3300037471 | Ga0395905_0113564 | Ga0395905_0113564_692_1729 | 314 |
| 260 | 3300038443 | Ga0395901_0009524 | Ga0395901_0009524_158_1192 | 314 |
| 261 | 3300038443 | Ga0395901_0055684 | Ga0395901_0055684_2108_3166 | 314 |
| 262 | 3300038443 | Ga0395901_0101430 | Ga0395901_0101430_560_1591 | 314 |
| 263 | 3300038443 | Ga0395901_0120179 | Ga0395901_0120179_805_1836 | 314 |
| 264 | 3300038443 | Ga0395901_0214925 | Ga0395901_0214925_864_1925 | 314 |
| 265 | 3300048904 | Ga0496101_0021336 | Ga0496101_0021336_2925_3986 | 314 |
| 266 | 3300048905 | Ga0496102_0021417 | Ga0496102_0021417_3687_4748 | 314 |
| 267 | 3300048906 | Ga0496103_0009399 | Ga0496103_0009399_1532_2593 | 314 |
| 268 | 3300048909 | Ga0496106_0036999 | Ga0496106_0036999_352_1413 | 314 |
| 269 | 3300048910 | Ga0496107_0038081 | Ga0496107_0038081_1334_2395 | 314 |
| 270 | 3300048911 | Ga0496108_0036526 | Ga0496108_0036526_2690_3751 | 314 |
| 271 | 3300048912 | Ga0496109_0379860 | Ga0496109_0379860_227_1288 | 314 |
| 272 | 3300048913 | Ga0496110_0012164 | Ga0496110_0012164_4117_5178 | 314 |
| 273 | 3300048914 | Ga0496111_0094761 | Ga0496111_0094761_954_2015 | 314 |
| 274 | 3300048916 | Ga0496113_0008615 | Ga0496113_0008615_4950_6011 | 314 |
| 275 | 3300001979 | JGI24740J21852_10026188 | JGI24740J21852_100261883 | 315 |
| 276 | 3300001989 | JGI24739J22299_10004515 | JGI24739J22299_100045154 | 315 |
| 277 | 3300001990 | JGI24737J22298_10049279 | JGI24737J22298_100492791 | 315 |
| 278 | 3300005328 | Ga0070676_10179262 | Ga0070676_101792621 | 315 |
| 279 | 3300005329 | Ga0070683_100078455 | Ga0070683_1000784554 | 315 |
| 280 | 3300005335 | Ga0070666_10012055 | Ga0070666_100120554 | 315 |
| 281 | 3300005339 | Ga0070660_100009808 | Ga0070660_1000098086 | 315 |
| 282 | 3300005339 | Ga0070660_100179705 | Ga0070660_1001797052 | 315 |
| 283 | 3300005344 | Ga0070661_100018670 | Ga0070661_1000186702 | 315 |
| 284 | 3300005364 | Ga0070673_100002148 | Ga0070673_1000021489 | 315 |
| 285 | 3300005364 | Ga0070673_100398957 | Ga0070673_1003989571 | 315 |
| 286 | 3300005366 | Ga0070659_100060886 | Ga0070659_1000608864 | 315 |
| 287 | 3300005367 | Ga0070667_100006651 | Ga0070667_1000066514 | 315 |
| 288 | 3300005455 | Ga0070663_100014523 | Ga0070663_1000145234 | 315 |
| 289 | 3300005455 | Ga0070663_100137652 | Ga0070663_1001376523 | 315 |
| 290 | 3300005457 | Ga0070662_100016901 | Ga0070662_1000169013 | 315 |
| 291 | 3300005564 | Ga0070664_100042270 | Ga0070664_1000422706 | 315 |
| 292 | 3300005577 | Ga0068857_100055434 | Ga0068857_1000554345 | 315 |
| 293 | 3300005578 | Ga0068854_100022275 | Ga0068854_1000222755 | 315 |
| 294 | 3300005616 | Ga0068852_100027650 | Ga0068852_1000276505 | 315 |
| 295 | 3300013102 | Ga0157371_10048407 | Ga0157371_100484072 | 315 |
| 296 | 3300025907 | Ga0207645_10183482 | Ga0207645_101834821 | 315 |
| 297 | 3300025919 | Ga0207657_10001537 | Ga0207657_1000153711 | 315 |
| 298 | 3300025920 | Ga0207649_10137749 | Ga0207649_101377492 | 315 |
| 299 | 3300025931 | Ga0207644_10132966 | Ga0207644_101329663 | 315 |
| 300 | 3300025933 | Ga0207706_10006075 | Ga0207706_100060753 | 315 |
| 301 | 3300025945 | Ga0207679_10114132 | Ga0207679_101141323 | 315 |
| 302 | 3300025960 | Ga0207651_10349265 | Ga0207651_103492651 | 315 |
| 303 | 3300025986 | Ga0207658_10019158 | Ga0207658_100191584 | 315 |
| 304 | 3300026067 | Ga0207678_10000357 | Ga0207678_1000035723 | 315 |
| 305 | 3300026067 | Ga0207678_10165274 | Ga0207678_101652741 | 315 |
| 306 | 3300026089 | Ga0207648_10057327 | Ga0207648_100573275 | 315 |
| 307 | 3300026116 | Ga0207674_10002612 | Ga0207674_100026124 | 315 |
| 308 | 3300028379 | Ga0268266_10025866 | Ga0268266_100258664 | 315 |
| 309 | 3300037312 | Ga0395899_0095580 | Ga0395899_0095580_145_1194 | 315 |
| 310 | 3300037312 | Ga0395899_0100232 | Ga0395899_0100232_214_1248 | 315 |
| 311 | 3300037418 | Ga0395900_0005857 | Ga0395900_0005857_1175_2224 | 315 |
| 312 | 3300037418 | Ga0395900_0012640 | Ga0395900_0012640_3583_4617 | 315 |
| 313 | 3300037466 | Ga0395898_0037459 | Ga0395898_0037459_2471_3520 | 315 |
| 314 | 3300037471 | Ga0395905_0005840 | Ga0395905_0005840_2747_3781 | 315 |
| 315 | 3300037471 | Ga0395905_0035581 | Ga0395905_0035581_3488_4525 | 315 |
| 316 | 3300037471 | Ga0395905_0162354 | Ga0395905_0162354_200_1249 | 315 |
| 317 | 3300038443 | Ga0395901_0007192 | Ga0395901_0007192_851_1900 | 315 |
| 318 | 3300046539 | Ga0495621_0086374 | Ga0495621_0086374_64_1101 | 315 |
| 319 | 3300046616 | Ga0495668_0002958 | Ga0495668_0002958_6013_7023 | 315 |
| 320 | 3300046684 | Ga0495669_0003311 | Ga0495669_0003311_3817_4827 | 315 |
| 321 | 3300047445 | Ga0495677_0036401 | Ga0495677_0036401_444_1454 | 315 |
| 322 | 3300048903 | Ga0496100_0044020 | Ga0496100_0044020_107_1171 | 315 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o68-assembly4.cif.gz_L | crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant | 0.7574 | 23 | 315 |
| 5o68-assembly2.cif.gz_F | crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant | 0.7457 | 2 | 315 |
| 5o68-assembly1.cif.gz_C | crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant | 0.7385 | 25 | 315 |
| 4rl8-assembly2.cif.gz_B | crystal structure of the cog4313 outer membrane channel from pseudomonas putida f1 | 0.7368 | 18 | 315 |
| 5o68-assembly3.cif.gz_I | crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant | 0.7327 | 23 | 315 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fqeA00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.667 | 26 | 315 | 2.40.160.40 |
| 4fqeA00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.6571 | 26 | 315 | 2.40.160.40 |
| 3qy3A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.6466 | 267 | 314 | 3.10.129.10 |
| 3qq2A00 | Mainly Beta;Beta Barrel;Lipocalin;Autotransporter beta-domain | 0.6092 | 26 | 313 | 2.40.128.130 |
| af_P76773_24_229_2.40.160.40 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.6083 | 24 | 315 | 2.40.160.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7H0GBW3-F1-model_v4 | deleted | 0.9509 | 1 | 315 |
|
| AF-A0A7H0GBW3-F1-model_v4 | deleted | 0.948 | 1 | 315 |
|
| AF-A0A832J2A4-F1-model_v4 | Transporter | 0.9381 | 101 | 315 |
|
| AF-A0A1D2U0A8-F1-model_v4 | Transporter | 0.9289 | 12 | 315 |
|
| AF-A0A1D2U0A8-F1-model_v4 | Transporter | 0.9258 | 12 | 315 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar