F406125

General Info

Members Datasets Scaffolds Average Seq Length
321 154 642 89

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0551890|Ga0495594_0551890_11_322
Length 103
Sequence LESGGRLIDEELLFMTPESVVQIIRQALMTTFWLAAPLLAIGFIAGLVISLVQIATSMQDNAFSTIPRLLAFLAGLLFLLPWMLQRTMSYTIALFGDLGRYAR

Samples

Sample ID Description Type Environment
1 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.31
Rhizosphere 96.88
Stem 0
Stem Tuber 0
Unclassified 20.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495594_0551890 3300046499 Unclassified 654
2 Ga0070676_10482103 3300005328 Bacteria 877
3 Ga0070683_100030882 3300005329 Bacteria 4867
4 Ga0070683_100063503 3300005329 Bacteria 3435
5 Ga0070683_100632443 3300005329 Unclassified 1025
6 Ga0070690_100638203 3300005330 Unclassified 812
7 Ga0068869_101947418 3300005334 Unclassified 527
8 Ga0070666_10387012 3300005335 Unclassified 1004
9 Ga0070666_10889298 3300005335 Bacteria 658
10 Ga0068868_100629885 3300005338 Bacteria 953
11 Ga0068868_101567595 3300005338 Bacteria 618
12 Ga0068868_102159951 3300005338 Bacteria 530
13 Ga0070689_101110942 3300005340 Bacteria 707
14 Ga0070687_100592963 3300005343 Bacteria 760
15 Ga0070675_101316553 3300005354 Bacteria 666
16 Ga0070671_101636308 3300005355 Unclassified 571
17 Ga0070673_100039361 3300005364 Bacteria 3617
18 Ga0070673_100873641 3300005364 Bacteria 833
19 Ga0070673_101195525 3300005364 Bacteria 712
20 Ga0070667_100222021 3300005367 Bacteria 1682
21 Ga0070714_101316681 3300005435 Bacteria 705
22 Ga0070678_100559706 3300005456 Bacteria 1016
23 Ga0070681_10229673 3300005458 Bacteria 1770
24 Ga0068867_101313698 3300005459 Unclassified 668
25 Ga0070685_10401277 3300005466 Unclassified 950
26 Ga0070707_100974947 3300005468 Bacteria 813
27 Ga0070699_100946823 3300005518 Unclassified 789
28 Ga0070684_100000028 3300005535 Bacteria 117820
29 Ga0070684_100257566 3300005535 Bacteria 1596
30 Ga0070684_100294574 3300005535 Unclassified 1488
31 Ga0070684_100319037 3300005535 Bacteria 1427
32 Ga0068853_102387977 3300005539 Unclassified 512
33 Ga0070672_100550957 3300005543 Bacteria 1001
34 Ga0070665_100547029 3300005548 Bacteria 1170
35 Ga0070665_101748664 3300005548 Unclassified 629
36 Ga0068855_100087586 3300005563 Bacteria 3598
37 Ga0068855_100346708 3300005563 Bacteria 1636
38 Ga0068857_100864263 3300005577 Bacteria 866
39 Ga0068857_101015447 3300005577 Bacteria 799
40 Ga0068856_100774665 3300005614 Bacteria 979
41 Ga0068856_101453697 3300005614 Bacteria 700
42 Ga0070702_101578299 3300005615 Bacteria 542
43 Ga0068852_100401685 3300005616 Bacteria 1348
44 Ga0068859_100563512 3300005617 Unclassified 1233
45 Ga0068859_101624613 3300005617 Bacteria 714
46 Ga0068859_102993807 3300005617 Bacteria 516
47 Ga0068864_100449114 3300005618 Bacteria 1233
48 Ga0068864_101606434 3300005618 Unclassified 654
49 Ga0068864_101875955 3300005618 Bacteria 605
50 Ga0068866_11411683 3300005718 Unclassified 509
51 Ga0068863_100050036 3300005841 Bacteria 3963
52 Ga0068863_100701093 3300005841 Bacteria 1006
53 Ga0068863_101036564 3300005841 Bacteria 824
54 Ga0068863_102102034 3300005841 Bacteria 575
55 Ga0068858_100002598 3300005842 Bacteria 18183
56 Ga0068858_100191012 3300005842 Bacteria 1935
57 Ga0068858_100458524 3300005842 Bacteria 1229
58 Ga0068858_101489461 3300005842 Bacteria 667
59 Ga0068860_100818910 3300005843 Bacteria 945
60 Ga0068860_100971299 3300005843 Unclassified 867
61 Ga0070716_100394114 3300006173 Bacteria 994
62 Ga0097621_100310570 3300006237 Bacteria 1395
63 Ga0097621_100342874 3300006237 Unclassified 1327
64 Ga0097621_100543554 3300006237 Unclassified 1057
65 Ga0068871_100210866 3300006358 Unclassified 1680
66 Ga0068871_100281557 3300006358 Bacteria 1455
67 Ga0068871_101010370 3300006358 Bacteria 775
68 Ga0068871_101013432 3300006358 Bacteria 774
69 Ga0075433_11143605 3300006852 Unclassified 676
70 Ga0075434_100920264 3300006871 Bacteria 889
71 Ga0068865_100914029 3300006881 Unclassified 764
72 Ga0068865_101280748 3300006881 Unclassified 651
73 Ga0068865_101596747 3300006881 Bacteria 586
74 Ga0097620_100563612 3300006931 Unclassified 1233
75 Ga0097620_101624749 3300006931 Bacteria 714
76 Ga0097620_102994970 3300006931 Bacteria 516
77 Ga0105240_10000788 3300009093 Bacteria 57440
78 Ga0105240_10378954 3300009093 Bacteria 1598
79 Ga0105240_11534917 3300009093 Unclassified 698
80 Ga0105240_12184758 3300009093 Unclassified 574
81 Ga0105240_12267053 3300009093 Unclassified 563
82 Ga0105245_10022079 3300009098 Bacteria 5587
83 Ga0105245_11200463 3300009098 Unclassified 806
84 Ga0105247_10775550 3300009101 Bacteria 729
85 Ga0114129_10067080 3300009147 Bacteria 5004
86 Ga0105241_10116877 3300009174 Bacteria 2142
87 Ga0105241_11406121 3300009174 Bacteria 668
88 Ga0105242_10260151 3300009176 Bacteria 1567
89 Ga0105242_11917236 3300009176 Unclassified 633
90 Ga0105242_12468811 3300009176 Unclassified 568
91 Ga0105242_12513644 3300009176 Bacteria 563
92 Ga0105248_10002164 3300009177 Bacteria 21740
93 Ga0105248_10006372 3300009177 Bacteria 12949
94 Ga0105248_10085337 3300009177 Unclassified 3553
95 Ga0105248_10209513 3300009177 Bacteria 2196
96 Ga0105248_10349762 3300009177 Bacteria 1664
97 Ga0105248_10912766 3300009177 Bacteria 992
98 Ga0105248_12402570 3300009177 Bacteria 600
99 Ga0105248_12506234 3300009177 Bacteria 588
100 Ga0105237_10008360 3300009545 Bacteria 11220
101 Ga0105237_10271778 3300009545 Bacteria 1698
102 Ga0105237_10329116 3300009545 Bacteria 1532
103 Ga0105237_10622047 3300009545 Bacteria 1087
104 Ga0105237_10727758 3300009545 Bacteria 999
105 Ga0105238_10000392 3300009551 Bacteria 46730
106 Ga0105238_10125669 3300009551 Bacteria 2543
107 Ga0105238_10213587 3300009551 Bacteria 1906
108 Ga0105238_10276163 3300009551 Bacteria 1661
109 Ga0105238_10780880 3300009551 Bacteria 970
110 Ga0105238_10915151 3300009551 Bacteria 896
111 Ga0105249_10101225 3300009553 Bacteria 2710
112 Ga0105249_10145396 3300009553 Bacteria 2277
113 Ga0105239_10035332 3300010375 Bacteria 5489
114 Ga0105239_10044211 3300010375 Bacteria 4883
115 Ga0105239_10158194 3300010375 Bacteria 2531
116 Ga0105239_10187268 3300010375 Bacteria 2316
117 Ga0105239_10338539 3300010375 Bacteria 1698
118 Ga0105239_11008970 3300010375 Bacteria 957
119 Ga0105239_11799576 3300010375 Bacteria 710
120 Ga0105246_10026610 3300011119 Bacteria 3782
121 Ga0105246_10944670 3300011119 Unclassified 777
122 Ga0105246_11310252 3300011119 Unclassified 672
123 Ga0157370_10088981 3300013104 Bacteria 2900
124 Ga0157370_10287529 3300013104 Bacteria 1519
125 Ga0157370_10853063 3300013104 Bacteria 828
126 Ga0157369_10026356 3300013105 Bacteria 6448
127 Ga0157369_10213735 3300013105 Bacteria 2021
128 Ga0157369_10571748 3300013105 Bacteria 1167
129 Ga0157369_10723513 3300013105 Bacteria 1025
130 Ga0157374_10165863 3300013296 Bacteria 2152
131 Ga0157374_10605517 3300013296 Bacteria 1106
132 Ga0157378_10638069 3300013297 Bacteria 1080
133 Ga0157378_11217554 3300013297 Unclassified 793
134 Ga0157378_12399413 3300013297 Bacteria 579
135 Ga0163162_10097276 3300013306 Bacteria 3032
136 Ga0163162_10282753 3300013306 Bacteria 1791
137 Ga0163162_10677965 3300013306 Bacteria 1153
138 Ga0157372_10655152 3300013307 Unclassified 1223
139 Ga0157372_11468605 3300013307 Bacteria 786
140 Ga0157375_10001820 3300013308 Bacteria 18284
141 Ga0157375_10519182 3300013308 Bacteria 1354
142 Ga0157375_12414552 3300013308 Bacteria 627
143 Ga0157375_13790527 3300013308 Bacteria 502
144 Ga0163163_10049302 3300014325 Bacteria 4144
145 Ga0163163_10285039 3300014325 Bacteria 1704
146 Ga0163163_10299113 3300014325 Bacteria 1662
147 Ga0163163_10351476 3300014325 Unclassified 1530
148 Ga0163163_10395894 3300014325 Bacteria 1439
149 Ga0163163_12165424 3300014325 Bacteria 615
150 Ga0157379_10941986 3300014968 Bacteria 821
151 Ga0157379_12589473 3300014968 Bacteria 508
152 Ga0157376_10069248 3300014969 Unclassified 2991
153 Ga0157376_10273235 3300014969 Bacteria 1588
154 Ga0157376_10848844 3300014969 Bacteria 928
155 Ga0157376_11369696 3300014969 Bacteria 738
156 Ga0163161_10316996 3300017792 Bacteria 1232
157 Ga0163161_10339091 3300017792 Bacteria 1192
158 Ga0213875_10024921 3300021388 Bacteria 2852
159 Ga0213875_10043200 3300021388 Unclassified 2117
160 Ga0213875_10548019 3300021388 Unclassified 557
161 Ga0207680_10451251 3300025903 Unclassified 913
162 Ga0207645_10130872 3300025907 Unclassified 1633
163 Ga0207705_11272118 3300025909 Bacteria 563
164 Ga0207654_10458313 3300025911 Bacteria 895
165 Ga0207695_10013146 3300025913 Bacteria 9882
166 Ga0207695_10336636 3300025913 Bacteria 1397
167 Ga0207695_10677863 3300025913 Bacteria 912
168 Ga0207695_11685880 3300025913 Unclassified 515
169 Ga0207671_10006171 3300025914 Bacteria 10768
170 Ga0207671_10211722 3300025914 Bacteria 1516
171 Ga0207671_10255005 3300025914 Bacteria 1379
172 Ga0207663_10585702 3300025916 Bacteria 875
173 Ga0207660_10086638 3300025917 Bacteria 2313
174 Ga0207652_11591170 3300025921 Bacteria 558
175 Ga0207694_10002132 3300025924 Bacteria 16259
176 Ga0207694_10359736 3300025924 Bacteria 1206
177 Ga0207694_10422951 3300025924 Bacteria 1110
178 Ga0207687_10013857 3300025927 Bacteria 5267
179 Ga0207687_11291212 3300025927 Bacteria 627
180 Ga0207687_11685846 3300025927 Unclassified 543
181 Ga0207700_10738170 3300025928 Bacteria 880
182 Ga0207644_10808399 3300025931 Bacteria 784
183 Ga0207686_10440759 3300025934 Bacteria 1000
184 Ga0207686_10494027 3300025934 Bacteria 948
185 Ga0207670_10455854 3300025936 Bacteria 1032
186 Ga0207704_10845304 3300025938 Bacteria 767
187 Ga0207704_10846273 3300025938 Bacteria 766
188 Ga0207665_10279201 3300025939 Bacteria 1243
189 Ga0207711_10001439 3300025941 Bacteria 22261
190 Ga0207711_10026153 3300025941 Bacteria 4895
191 Ga0207711_10236453 3300025941 Unclassified 1674
192 Ga0207711_10485218 3300025941 Bacteria 1151
193 Ga0207711_10868552 3300025941 Bacteria 839
194 Ga0207661_10000010 3300025944 Bacteria 375338
195 Ga0207661_10076700 3300025944 Bacteria 2746
196 Ga0207661_10084647 3300025944 Bacteria 2627
197 Ga0207661_10156554 3300025944 Bacteria 1974
198 Ga0207667_10070663 3300025949 Bacteria 3633
199 Ga0207667_10138506 3300025949 Bacteria 2506
200 Ga0207667_10273809 3300025949 Bacteria 1726
201 Ga0207651_10187635 3300025960 Bacteria 1646
202 Ga0207651_10379933 3300025960 Bacteria 1197
203 Ga0207712_10417405 3300025961 Bacteria 1131
204 Ga0207712_10850754 3300025961 Bacteria 804
205 Ga0207640_11418033 3300025981 Unclassified 623
206 Ga0207658_11065039 3300025986 Bacteria 738
207 Ga0207658_11072960 3300025986 Bacteria 735
208 Ga0207677_11087457 3300026023 Bacteria 728
209 Ga0207677_11597304 3300026023 Unclassified 604
210 Ga0207703_10013284 3300026035 Bacteria 6415
211 Ga0207703_10347518 3300026035 Bacteria 1365
212 Ga0207703_10819991 3300026035 Bacteria 889
213 Ga0207703_11727056 3300026035 Bacteria 602
214 Ga0207641_10415407 3300026088 Bacteria 1294
215 Ga0207641_10936813 3300026088 Unclassified 861
216 Ga0207648_10954872 3300026089 Bacteria 802
217 Ga0207648_11227933 3300026089 Bacteria 704
218 Ga0207676_10776498 3300026095 Bacteria 933
219 Ga0207674_11252268 3300026116 Unclassified 711
220 Ga0207683_10488842 3300026121 Bacteria 1136
221 Ga0207683_11046349 3300026121 Bacteria 757
222 Ga0207698_10578650 3300026142 Bacteria 1104
223 Ga0207698_10749682 3300026142 Bacteria 975
224 Ga0268266_10584512 3300028379 Bacteria 1072
225 Ga0268266_10744397 3300028379 Bacteria 946
226 Ga0268266_10983273 3300028379 Bacteria 817
227 Ga0268264_11557395 3300028381 Bacteria 671
228 Ga0265323_10005587 3300028653 Bacteria 5335
229 Ga0265338_10309938 3300028800 Bacteria 1145
230 Ga0265338_11005899 3300028800 Bacteria 564
231 Ga0265760_10050215 3300031090 Bacteria 1255
232 Ga0265330_10376675 3300031235 Bacteria 600
233 Ga0265339_10131875 3300031249 Bacteria 1277
234 Ga0265331_10057605 3300031250 Bacteria 1842
235 Ga0265316_10016955 3300031344 Bacteria 6306
236 Ga0265316_10166311 3300031344 Bacteria 1647
237 Ga0265316_10313142 3300031344 Bacteria 1141
238 Ga0265316_10373760 3300031344 Bacteria 1029
239 Ga0265316_10666382 3300031344 Bacteria 735
240 Ga0265314_10013424 3300031711 Bacteria 6616
241 Ga0265314_10379389 3300031711 Bacteria 770
242 Ga0265342_10275660 3300031712 Bacteria 891
243 Ga0373945_0358517 3300035116 Bacteria 633
244 Ga0373945_0488496 3300035116 Unclassified 548
245 Ga0373946_0636430 3300035171 Bacteria 555
246 Ga0373946_0781133 3300035171 Unclassified 502
247 Ga0373935_0436166 3300035692 Bacteria 945
248 Ga0373935_0621510 3300035692 Bacteria 791
249 Ga0373935_1057367 3300035692 Unclassified 604
250 Ga0373927_0003200 3300035695 Bacteria 11797
251 Ga0373927_0114698 3300035695 Bacteria 1756
252 Ga0373927_1119156 3300035695 Bacteria 519
253 Ga0373947_0004278 3300035725 Bacteria 8382
254 Ga0373947_0516714 3300035725 Bacteria 812
255 Ga0373947_0720518 3300035725 Bacteria 681
256 Ga0373937_0387251 3300036401 Bacteria 1326
257 Ga0373937_1431697 3300036401 Bacteria 639
258 Ga0373925_0000097 3300037068 Bacteria 94132
259 Ga0373925_0165816 3300037068 Bacteria 1742
260 Ga0373925_0568922 3300037068 Bacteria 932
261 Ga0373925_1021698 3300037068 Unclassified 681
262 Ga0436364_0356420 3300037853 Unclassified 683
263 Ga0436364_0749391 3300037853 Bacteria 2584
264 Ga0436364_0946379 3300037853 Bacteria 3040
265 Ga0436364_1417049 3300037853 Bacteria 2808
266 Ga0436365_0231085 3300039437 Bacteria 5242
267 Ga0436365_1561759 3300039437 Bacteria 2351
268 Ga0451577_0594644 3300042876 Bacteria 1004
269 Ga0466963_0394106 3300044694 Unclassified 976
270 Ga0451576_0210681 3300045051 Bacteria 2030
271 Ga0451576_1372294 3300045051 Bacteria 736
272 Ga0466958_0498798 3300045836 Archaea 790
273 Ga0495592_0402364 3300046454 Unclassified 867
274 Ga0495651_0006525 3300046462 Bacteria 8911
275 Ga0495651_0391704 3300046462 Bacteria 909
276 Ga0495580_0000132 3300046472 Bacteria 52529
277 Ga0495580_0012940 3300046472 Bacteria 6388
278 Ga0495580_0030956 3300046472 Bacteria 3870
279 Ga0495580_0033127 3300046472 Bacteria 3724
280 Ga0495639_0328944 3300046475 Unclassified 765
281 Ga0495662_0354102 3300046476 Unclassified 722
282 Ga0495664_0005554 3300046477 Bacteria 6932
283 Ga0495664_0201223 3300046477 Bacteria 1207
284 Ga0495664_0496552 3300046477 Unclassified 729
285 Ga0495608_0882885 3300046511 Bacteria 524
286 Ga0495630_0377159 3300046517 Bacteria 1086
287 Ga0495642_0560468 3300046528 Unclassified 507
288 Ga0495652_0348313 3300046529 Unclassified 1062
289 Ga0495665_0510925 3300046531 Bacteria 605
290 Ga0495640_0479853 3300046533 Unclassified 758
291 Ga0495586_0443614 3300046535 Bacteria 748
292 Ga0495587_0037773 3300046536 Unclassified 2898
293 Ga0495587_0040136 3300046536 Bacteria 2799
294 Ga0495587_0733341 3300046536 Bacteria 541
295 Ga0495645_0167405 3300046543 Unclassified 1515
296 Ga0495645_0438669 3300046543 Bacteria 826
297 Ga0495667_0011261 3300046559 Bacteria 6053
298 Ga0495667_0036398 3300046559 Unclassified 3286
299 Ga0495634_0837692 3300046642 Bacteria 523
300 Ga0495599_0688934 3300046678 Bacteria 590
301 Ga0495599_0794186 3300046678 Unclassified 541
302 Ga0495623_0015318 3300046679 Bacteria 4955
303 Ga0495623_0682540 3300046679 Unclassified 527
304 Ga0495613_0357448 3300046689 Bacteria 1002
305 Ga0495613_0794037 3300046689 Bacteria 618
306 Ga0495600_0269598 3300046809 Bacteria 1080
307 Ga0495581_0376151 3300047315 Bacteria 829
308 Ga0495604_0054122 3300047317 Bacteria 3098
309 Ga0495636_0351520 3300047318 Bacteria 696
310 Ga0495674_0243388 3300047319 Bacteria 1482
311 Ga0495680_0211534 3300047322 Bacteria 1388
312 Ga0495675_0176441 3300047444 Bacteria 1310
313 Ga0495675_0386827 3300047444 Bacteria 817
314 Ga0495684_0003399 3300047471 Bacteria 12487
315 Ga0495684_0097165 3300047471 Bacteria 2228
316 Ga0495684_0118202 3300047471 Unclassified 1998
317 Ga0495684_1070964 3300047471 Bacteria 507
318 Ga0495602_0014264 3300048088 Bacteria 8073
319 Ga0496113_0679860 3300048916 Bacteria 822
320 Ga0501082_0000067 3300060353 Bacteria 74904
321 Ga0466962_0174654 3300061719 Archaea 1047
322 Ga0495594_0551890
323 Ga0070676_10482103
324 Ga0070683_100030882
325 Ga0070683_100063503
326 Ga0070683_100632443
327 Ga0070690_100638203
328 Ga0068869_101947418
329 Ga0070666_10387012
330 Ga0070666_10889298
331 Ga0068868_100629885
332 Ga0068868_101567595
333 Ga0068868_102159951
334 Ga0070689_101110942
335 Ga0070687_100592963
336 Ga0070675_101316553
337 Ga0070671_101636308
338 Ga0070673_100039361
339 Ga0070673_100873641
340 Ga0070673_101195525
341 Ga0070667_100222021
342 Ga0070714_101316681
343 Ga0070678_100559706
344 Ga0070681_10229673
345 Ga0068867_101313698
346 Ga0070685_10401277
347 Ga0070707_100974947
348 Ga0070699_100946823
349 Ga0070684_100000028
350 Ga0070684_100257566
351 Ga0070684_100294574
352 Ga0070684_100319037
353 Ga0068853_102387977
354 Ga0070672_100550957
355 Ga0070665_100547029
356 Ga0070665_101748664
357 Ga0068855_100087586
358 Ga0068855_100346708
359 Ga0068857_100864263
360 Ga0068857_101015447
361 Ga0068856_100774665
362 Ga0068856_101453697
363 Ga0070702_101578299
364 Ga0068852_100401685
365 Ga0068859_100563512
366 Ga0068859_101624613
367 Ga0068859_102993807
368 Ga0068864_100449114
369 Ga0068864_101606434
370 Ga0068864_101875955
371 Ga0068866_11411683
372 Ga0068863_100050036
373 Ga0068863_100701093
374 Ga0068863_101036564
375 Ga0068863_102102034
376 Ga0068858_100002598
377 Ga0068858_100191012
378 Ga0068858_100458524
379 Ga0068858_101489461
380 Ga0068860_100818910
381 Ga0068860_100971299
382 Ga0070716_100394114
383 Ga0097621_100310570
384 Ga0097621_100342874
385 Ga0097621_100543554
386 Ga0068871_100210866
387 Ga0068871_100281557
388 Ga0068871_101010370
389 Ga0068871_101013432
390 Ga0075433_11143605
391 Ga0075434_100920264
392 Ga0068865_100914029
393 Ga0068865_101280748
394 Ga0068865_101596747
395 Ga0097620_100563612
396 Ga0097620_101624749
397 Ga0097620_102994970
398 Ga0105240_10000788
399 Ga0105240_10378954
400 Ga0105240_11534917
401 Ga0105240_12184758
402 Ga0105240_12267053
403 Ga0105245_10022079
404 Ga0105245_11200463
405 Ga0105247_10775550
406 Ga0114129_10067080
407 Ga0105241_10116877
408 Ga0105241_11406121
409 Ga0105242_10260151
410 Ga0105242_11917236
411 Ga0105242_12468811
412 Ga0105242_12513644
413 Ga0105248_10002164
414 Ga0105248_10006372
415 Ga0105248_10085337
416 Ga0105248_10209513
417 Ga0105248_10349762
418 Ga0105248_10912766
419 Ga0105248_12402570
420 Ga0105248_12506234
421 Ga0105237_10008360
422 Ga0105237_10271778
423 Ga0105237_10329116
424 Ga0105237_10622047
425 Ga0105237_10727758
426 Ga0105238_10000392
427 Ga0105238_10125669
428 Ga0105238_10213587
429 Ga0105238_10276163
430 Ga0105238_10780880
431 Ga0105238_10915151
432 Ga0105249_10101225
433 Ga0105249_10145396
434 Ga0105239_10035332
435 Ga0105239_10044211
436 Ga0105239_10158194
437 Ga0105239_10187268
438 Ga0105239_10338539
439 Ga0105239_11008970
440 Ga0105239_11799576
441 Ga0105246_10026610
442 Ga0105246_10944670
443 Ga0105246_11310252
444 Ga0157370_10088981
445 Ga0157370_10287529
446 Ga0157370_10853063
447 Ga0157369_10026356
448 Ga0157369_10213735
449 Ga0157369_10571748
450 Ga0157369_10723513
451 Ga0157374_10165863
452 Ga0157374_10605517
453 Ga0157378_10638069
454 Ga0157378_11217554
455 Ga0157378_12399413
456 Ga0163162_10097276
457 Ga0163162_10282753
458 Ga0163162_10677965
459 Ga0157372_10655152
460 Ga0157372_11468605
461 Ga0157375_10001820
462 Ga0157375_10519182
463 Ga0157375_12414552
464 Ga0157375_13790527
465 Ga0163163_10049302
466 Ga0163163_10285039
467 Ga0163163_10299113
468 Ga0163163_10351476
469 Ga0163163_10395894
470 Ga0163163_12165424
471 Ga0157379_10941986
472 Ga0157379_12589473
473 Ga0157376_10069248
474 Ga0157376_10273235
475 Ga0157376_10848844
476 Ga0157376_11369696
477 Ga0163161_10316996
478 Ga0163161_10339091
479 Ga0213875_10024921
480 Ga0213875_10043200
481 Ga0213875_10548019
482 Ga0207680_10451251
483 Ga0207645_10130872
484 Ga0207705_11272118
485 Ga0207654_10458313
486 Ga0207695_10013146
487 Ga0207695_10336636
488 Ga0207695_10677863
489 Ga0207695_11685880
490 Ga0207671_10006171
491 Ga0207671_10211722
492 Ga0207671_10255005
493 Ga0207663_10585702
494 Ga0207660_10086638
495 Ga0207652_11591170
496 Ga0207694_10002132
497 Ga0207694_10359736
498 Ga0207694_10422951
499 Ga0207687_10013857
500 Ga0207687_11291212
501 Ga0207687_11685846
502 Ga0207700_10738170
503 Ga0207644_10808399
504 Ga0207686_10440759
505 Ga0207686_10494027
506 Ga0207670_10455854
507 Ga0207704_10845304
508 Ga0207704_10846273
509 Ga0207665_10279201
510 Ga0207711_10001439
511 Ga0207711_10026153
512 Ga0207711_10236453
513 Ga0207711_10485218
514 Ga0207711_10868552
515 Ga0207661_10000010
516 Ga0207661_10076700
517 Ga0207661_10084647
518 Ga0207661_10156554
519 Ga0207667_10070663
520 Ga0207667_10138506
521 Ga0207667_10273809
522 Ga0207651_10187635
523 Ga0207651_10379933
524 Ga0207712_10417405
525 Ga0207712_10850754
526 Ga0207640_11418033
527 Ga0207658_11065039
528 Ga0207658_11072960
529 Ga0207677_11087457
530 Ga0207677_11597304
531 Ga0207703_10013284
532 Ga0207703_10347518
533 Ga0207703_10819991
534 Ga0207703_11727056
535 Ga0207641_10415407
536 Ga0207641_10936813
537 Ga0207648_10954872
538 Ga0207648_11227933
539 Ga0207676_10776498
540 Ga0207674_11252268
541 Ga0207683_10488842
542 Ga0207683_11046349
543 Ga0207698_10578650
544 Ga0207698_10749682
545 Ga0268266_10584512
546 Ga0268266_10744397
547 Ga0268266_10983273
548 Ga0268264_11557395
549 Ga0265323_10005587
550 Ga0265338_10309938
551 Ga0265338_11005899
552 Ga0265760_10050215
553 Ga0265330_10376675
554 Ga0265339_10131875
555 Ga0265331_10057605
556 Ga0265316_10016955
557 Ga0265316_10166311
558 Ga0265316_10313142
559 Ga0265316_10373760
560 Ga0265316_10666382
561 Ga0265314_10013424
562 Ga0265314_10379389
563 Ga0265342_10275660
564 Ga0373945_0358517
565 Ga0373945_0488496
566 Ga0373946_0636430
567 Ga0373946_0781133
568 Ga0373935_0436166
569 Ga0373935_0621510
570 Ga0373935_1057367
571 Ga0373927_0003200
572 Ga0373927_0114698
573 Ga0373927_1119156
574 Ga0373947_0004278
575 Ga0373947_0516714
576 Ga0373947_0720518
577 Ga0373937_0387251
578 Ga0373937_1431697
579 Ga0373925_0000097
580 Ga0373925_0165816
581 Ga0373925_0568922
582 Ga0373925_1021698
583 Ga0436364_0356420
584 Ga0436364_0749391
585 Ga0436364_0946379
586 Ga0436364_1417049
587 Ga0436365_0231085
588 Ga0436365_1561759
589 Ga0451577_0594644
590 Ga0466963_0394106
591 Ga0451576_0210681
592 Ga0451576_1372294
593 Ga0466958_0498798
594 Ga0495592_0402364
595 Ga0495651_0006525
596 Ga0495651_0391704
597 Ga0495580_0000132
598 Ga0495580_0012940
599 Ga0495580_0030956
600 Ga0495580_0033127
601 Ga0495639_0328944
602 Ga0495662_0354102
603 Ga0495664_0005554
604 Ga0495664_0201223
605 Ga0495664_0496552
606 Ga0495608_0882885
607 Ga0495630_0377159
608 Ga0495642_0560468
609 Ga0495652_0348313
610 Ga0495665_0510925
611 Ga0495640_0479853
612 Ga0495586_0443614
613 Ga0495587_0037773
614 Ga0495587_0040136
615 Ga0495587_0733341
616 Ga0495645_0167405
617 Ga0495645_0438669
618 Ga0495667_0011261
619 Ga0495667_0036398
620 Ga0495634_0837692
621 Ga0495599_0688934
622 Ga0495599_0794186
623 Ga0495623_0015318
624 Ga0495623_0682540
625 Ga0495613_0357448
626 Ga0495613_0794037
627 Ga0495600_0269598
628 Ga0495581_0376151
629 Ga0495604_0054122
630 Ga0495636_0351520
631 Ga0495674_0243388
632 Ga0495680_0211534
633 Ga0495675_0176441
634 Ga0495675_0386827
635 Ga0495684_0003399
636 Ga0495684_0097165
637 Ga0495684_0118202
638 Ga0495684_1070964
639 Ga0495602_0014264
640 Ga0496113_0679860
641 Ga0501082_0000067
642 Ga0466962_0174654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01313

Bac_export_3

Bacterial export proteins, family 3

19

92

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ena-assembly1.cif.gz_l tfiid-based pic-mediator holo-complex in pre-assembled state (pre-hpic-med) 0.8913 16 75
7n6g-assembly1.cif.gz_3I c1 of central pair 0.8755 6 88
6dkm-assembly3.cif.gz_E dhd131 0.8507 16 71
6zw5-assembly1.cif.gz_B c15 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.8384 4 88
8t8f-assembly1.cif.gz_E smc5/6 8mer 0.8379 4 88
ID Description Score Start End Superfamily
af_Q8IBS3_2_112_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.8821 11 77 1.10.287.40
af_B4FAI4_272_505_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.8752 4 88 1.20.1270.60
af_Q2QQX2_153_269_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8646 12 83 3.30.40.10
4abmB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.8603 10 76 1.10.287.1060
af_Q9NP81_58_171_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.8575 8 84 1.10.287.40
ID Description Score Start End GO Terms
AF-A0A427YFV7-F1-model_v4 Uncharacterized protein 0.9029 11 77
AF-A0A329CE65-F1-model_v4 Uncharacterized protein 0.9013 6 88
AF-A0A7W3C3S1-F1-model_v4 deleted 0.8967 9 88
AF-A0A7Y5TXD8-F1-model_v4 ABC transporter ATP-binding protein 0.8908 4 89 GO:0005524
AF-A0A4P1ARE4-F1-model_v4 deleted 0.8885 9 88

Map