F405908
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 321 | 173 | 321 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10502013|Ga0081539_105020132 |
| Length | 105 |
| Sequence | MRCRSCAPLPEQVRRAADLLERRWTVSILYVSHEGGAVRFNEFQQALGSIPPATLTQRLADLEEAGILEREVIDARPPRVEYRLTERGRQLRSLIDALDQFAQTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 2 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 3 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 42 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 101 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 106 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 107 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 108 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 112 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 113 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 114 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 115 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 117 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 118 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 122 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 125 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 126 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 127 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 128 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 129 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 130 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 131 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 132 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 133 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 135 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 136 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 137 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 138 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 155 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 156 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 157 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 158 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 159 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 160 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 163 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 164 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 165 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 166 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 167 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 168 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.72 |
| Rhizosphere | 90.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068869_100430081 | 3300005334 | Bacteria | 1091 |
| 2 | Ga0070680_100718138 | 3300005336 | Bacteria | 860 |
| 3 | Ga0070682_100606720 | 3300005337 | Bacteria | 865 |
| 4 | Ga0068868_100329667 | 3300005338 | Bacteria | 1302 |
| 5 | Ga0070691_10939463 | 3300005341 | Bacteria | 536 |
| 6 | Ga0070692_10402222 | 3300005345 | Bacteria | 865 |
| 7 | Ga0070668_102197835 | 3300005347 | Bacteria | 510 |
| 8 | Ga0070673_100301455 | 3300005364 | Bacteria | 1411 |
| 9 | Ga0070659_100377275 | 3300005366 | Bacteria | 1194 |
| 10 | Ga0070667_101342897 | 3300005367 | Unclassified | 670 |
| 11 | Ga0070703_10002960 | 3300005406 | Bacteria | 4853 |
| 12 | Ga0070709_10143920 | 3300005434 | Bacteria | 1640 |
| 13 | Ga0070709_10198088 | 3300005434 | Bacteria | 1421 |
| 14 | Ga0070709_10817186 | 3300005434 | Bacteria | 732 |
| 15 | Ga0070714_100029426 | 3300005435 | Bacteria | 4566 |
| 16 | Ga0070714_100045320 | 3300005435 | Bacteria | 3727 |
| 17 | Ga0070714_100936615 | 3300005435 | Bacteria | 842 |
| 18 | Ga0070713_100127221 | 3300005436 | Bacteria | 2242 |
| 19 | Ga0070713_101096448 | 3300005436 | Bacteria | 769 |
| 20 | Ga0070710_10184098 | 3300005437 | Bacteria | 1310 |
| 21 | Ga0070701_10253965 | 3300005438 | Bacteria | 1063 |
| 22 | Ga0070711_100016040 | 3300005439 | Bacteria | 4749 |
| 23 | Ga0070711_100051431 | 3300005439 | Bacteria | 2830 |
| 24 | Ga0070711_100116982 | 3300005439 | Bacteria | 1965 |
| 25 | Ga0070711_100620679 | 3300005439 | Bacteria | 904 |
| 26 | Ga0070705_100029902 | 3300005440 | Bacteria | 3002 |
| 27 | Ga0070705_100122311 | 3300005440 | Bacteria | 1682 |
| 28 | Ga0070700_100446687 | 3300005441 | Bacteria | 983 |
| 29 | Ga0070694_100235736 | 3300005444 | Bacteria | 1378 |
| 30 | Ga0070694_100700443 | 3300005444 | Bacteria | 823 |
| 31 | Ga0070694_101744579 | 3300005444 | Unclassified | 530 |
| 32 | Ga0070708_100042943 | 3300005445 | Bacteria | 3971 |
| 33 | Ga0070708_100315096 | 3300005445 | Bacteria | 1474 |
| 34 | Ga0070678_101307880 | 3300005456 | Bacteria | 675 |
| 35 | Ga0070662_100696903 | 3300005457 | Bacteria | 859 |
| 36 | Ga0070685_10765956 | 3300005466 | Bacteria | 709 |
| 37 | Ga0070706_100031837 | 3300005467 | Bacteria | 4863 |
| 38 | Ga0070706_100053124 | 3300005467 | Bacteria | 3739 |
| 39 | Ga0070706_100429445 | 3300005467 | Bacteria | 1229 |
| 40 | Ga0070707_100013757 | 3300005468 | Bacteria | 7578 |
| 41 | Ga0070707_100175483 | 3300005468 | Bacteria | 2089 |
| 42 | Ga0070707_100334794 | 3300005468 | Bacteria | 1471 |
| 43 | Ga0070707_100543716 | 3300005468 | Bacteria | 1124 |
| 44 | Ga0070707_100739818 | 3300005468 | Bacteria | 947 |
| 45 | Ga0070707_100954285 | 3300005468 | Bacteria | 823 |
| 46 | Ga0070698_100074158 | 3300005471 | Bacteria | 3408 |
| 47 | Ga0070698_100502321 | 3300005471 | Bacteria | 1150 |
| 48 | Ga0070699_100036286 | 3300005518 | Bacteria | 4265 |
| 49 | Ga0070699_100087114 | 3300005518 | Bacteria | 2726 |
| 50 | Ga0070699_100251296 | 3300005518 | Bacteria | 1580 |
| 51 | Ga0070699_100441178 | 3300005518 | Bacteria | 1180 |
| 52 | Ga0070699_100613124 | 3300005518 | Bacteria | 993 |
| 53 | Ga0070697_100088344 | 3300005536 | Bacteria | 2559 |
| 54 | Ga0070695_100151997 | 3300005545 | Bacteria | 1616 |
| 55 | Ga0070695_100211844 | 3300005545 | Bacteria | 1391 |
| 56 | Ga0070695_101523607 | 3300005545 | Bacteria | 557 |
| 57 | Ga0070696_100008667 | 3300005546 | Bacteria | 6803 |
| 58 | Ga0070696_100050509 | 3300005546 | Bacteria | 2890 |
| 59 | Ga0070696_100986616 | 3300005546 | Bacteria | 703 |
| 60 | Ga0070704_100014607 | 3300005549 | Bacteria | 4908 |
| 61 | Ga0068855_100861326 | 3300005563 | Bacteria | 959 |
| 62 | Ga0070702_101240884 | 3300005615 | Bacteria | 603 |
| 63 | Ga0068861_100957219 | 3300005719 | Bacteria | 815 |
| 64 | Ga0068862_101708364 | 3300005844 | Unclassified | 638 |
| 65 | Ga0081455_10045678 | 3300005937 | Bacteria | 3808 |
| 66 | Ga0081455_10065700 | 3300005937 | Bacteria | 3033 |
| 67 | Ga0081538_10030865 | 3300005981 | Bacteria | 3628 |
| 68 | Ga0081539_10502013 | 3300005985 | Unclassified | 502 |
| 69 | Ga0070717_10097683 | 3300006028 | Bacteria | 2489 |
| 70 | Ga0070717_10830577 | 3300006028 | Bacteria | 841 |
| 71 | Ga0075432_10135726 | 3300006058 | Bacteria | 935 |
| 72 | Ga0070715_10034705 | 3300006163 | Bacteria | 2070 |
| 73 | Ga0070715_10191618 | 3300006163 | Bacteria | 1032 |
| 74 | Ga0070716_100014026 | 3300006173 | Bacteria | 4098 |
| 75 | Ga0070716_100025863 | 3300006173 | Bacteria | 3137 |
| 76 | Ga0070716_100188509 | 3300006173 | Bacteria | 1360 |
| 77 | Ga0070716_100931276 | 3300006173 | Unclassified | 682 |
| 78 | Ga0070712_100015322 | 3300006175 | Bacteria | 4933 |
| 79 | Ga0070712_100169345 | 3300006175 | Bacteria | 1693 |
| 80 | Ga0070712_100690274 | 3300006175 | Bacteria | 870 |
| 81 | Ga0070712_101772251 | 3300006175 | Bacteria | 541 |
| 82 | Ga0075433_10637613 | 3300006852 | Bacteria | 934 |
| 83 | Ga0075433_11032576 | 3300006852 | Bacteria | 716 |
| 84 | Ga0075434_100016157 | 3300006871 | Bacteria | 7173 |
| 85 | Ga0068865_100477403 | 3300006881 | Bacteria | 1036 |
| 86 | Ga0075436_100139283 | 3300006914 | Bacteria | 1704 |
| 87 | Ga0075436_101371973 | 3300006914 | Unclassified | 535 |
| 88 | Ga0075435_101611445 | 3300007076 | Unclassified | 569 |
| 89 | Ga0105250_10046671 | 3300009092 | Bacteria | 1737 |
| 90 | Ga0105245_11629897 | 3300009098 | Unclassified | 697 |
| 91 | Ga0114129_10431432 | 3300009147 | Bacteria | 1731 |
| 92 | Ga0114129_10803168 | 3300009147 | Bacteria | 1200 |
| 93 | Ga0114129_12116872 | 3300009147 | Unclassified | 678 |
| 94 | Ga0114129_13228510 | 3300009147 | Bacteria | 529 |
| 95 | Ga0105243_11117133 | 3300009148 | Bacteria | 797 |
| 96 | Ga0105243_12609490 | 3300009148 | Unclassified | 545 |
| 97 | Ga0105241_10058937 | 3300009174 | Bacteria | 2950 |
| 98 | Ga0105242_10426221 | 3300009176 | Bacteria | 1244 |
| 99 | Ga0105242_11552822 | 3300009176 | Unclassified | 694 |
| 100 | Ga0105249_10208918 | 3300009553 | Bacteria | 1914 |
| 101 | Ga0105249_13341800 | 3300009553 | Bacteria | 516 |
| 102 | Ga0105239_12715740 | 3300010375 | Bacteria | 578 |
| 103 | Ga0157324_1064621 | 3300012506 | Bacteria | 509 |
| 104 | Ga0157373_11032587 | 3300013100 | Bacteria | 614 |
| 105 | Ga0157369_10058210 | 3300013105 | Bacteria | 4168 |
| 106 | Ga0157374_11091311 | 3300013296 | Bacteria | 818 |
| 107 | Ga0163162_10183398 | 3300013306 | Bacteria | 2219 |
| 108 | Ga0157372_11422350 | 3300013307 | Bacteria | 799 |
| 109 | Ga0157375_10254131 | 3300013308 | Bacteria | 1918 |
| 110 | Ga0163163_11033080 | 3300014325 | Bacteria | 885 |
| 111 | Ga0157380_11802516 | 3300014326 | Unclassified | 671 |
| 112 | Ga0157377_10227670 | 3300014745 | Bacteria | 1197 |
| 113 | Ga0157379_10808314 | 3300014968 | Bacteria | 885 |
| 114 | Ga0157379_11096072 | 3300014968 | Unclassified | 762 |
| 115 | Ga0207653_10102075 | 3300025885 | Bacteria | 1015 |
| 116 | Ga0207653_10223934 | 3300025885 | Bacteria | 715 |
| 117 | Ga0207692_10051344 | 3300025898 | Bacteria | 2091 |
| 118 | Ga0207692_10200712 | 3300025898 | Bacteria | 1172 |
| 119 | Ga0207688_10150712 | 3300025901 | Bacteria | 1373 |
| 120 | Ga0207685_10001902 | 3300025905 | Bacteria | 4603 |
| 121 | Ga0207699_10076619 | 3300025906 | Bacteria | 2061 |
| 122 | Ga0207699_10179357 | 3300025906 | Bacteria | 1423 |
| 123 | Ga0207699_10196824 | 3300025906 | Bacteria | 1363 |
| 124 | Ga0207684_10015975 | 3300025910 | Bacteria | 6451 |
| 125 | Ga0207684_10183307 | 3300025910 | Bacteria | 1806 |
| 126 | Ga0207684_10535659 | 3300025910 | Bacteria | 1002 |
| 127 | Ga0207684_11171678 | 3300025910 | Bacteria | 637 |
| 128 | Ga0207671_10716844 | 3300025914 | Bacteria | 795 |
| 129 | Ga0207693_10000736 | 3300025915 | Bacteria | 29488 |
| 130 | Ga0207693_10002300 | 3300025915 | Bacteria | 16603 |
| 131 | Ga0207693_10023376 | 3300025915 | Bacteria | 4908 |
| 132 | Ga0207693_10249444 | 3300025915 | Bacteria | 1393 |
| 133 | Ga0207663_10072547 | 3300025916 | Bacteria | 2225 |
| 134 | Ga0207663_10551012 | 3300025916 | Bacteria | 901 |
| 135 | Ga0207663_10983843 | 3300025916 | Bacteria | 676 |
| 136 | Ga0207663_11667975 | 3300025916 | Bacteria | 513 |
| 137 | Ga0207660_11439077 | 3300025917 | Unclassified | 558 |
| 138 | Ga0207646_10003166 | 3300025922 | Bacteria | 18831 |
| 139 | Ga0207646_10034340 | 3300025922 | Bacteria | 4583 |
| 140 | Ga0207646_10329938 | 3300025922 | Bacteria | 1378 |
| 141 | Ga0207646_10455942 | 3300025922 | Bacteria | 1153 |
| 142 | Ga0207646_10532524 | 3300025922 | Bacteria | 1057 |
| 143 | Ga0207687_10593374 | 3300025927 | Bacteria | 933 |
| 144 | Ga0207700_10878479 | 3300025928 | Bacteria | 802 |
| 145 | Ga0207700_10976300 | 3300025928 | Unclassified | 758 |
| 146 | Ga0207664_10214336 | 3300025929 | Bacteria | 1667 |
| 147 | Ga0207664_10559735 | 3300025929 | Bacteria | 1026 |
| 148 | Ga0207644_11599088 | 3300025931 | Bacteria | 547 |
| 149 | Ga0207690_10532686 | 3300025932 | Bacteria | 953 |
| 150 | Ga0207706_10300745 | 3300025933 | Bacteria | 1398 |
| 151 | Ga0207686_10166310 | 3300025934 | Bacteria | 1551 |
| 152 | Ga0207686_10646636 | 3300025934 | Bacteria | 836 |
| 153 | Ga0207709_10890103 | 3300025935 | Unclassified | 723 |
| 154 | Ga0207704_11008618 | 3300025938 | Bacteria | 704 |
| 155 | Ga0207665_10066426 | 3300025939 | Bacteria | 2455 |
| 156 | Ga0207665_10094890 | 3300025939 | Bacteria | 2072 |
| 157 | Ga0207651_10623131 | 3300025960 | Bacteria | 945 |
| 158 | Ga0207712_10477875 | 3300025961 | Bacteria | 1062 |
| 159 | Ga0207668_11291198 | 3300025972 | Bacteria | 657 |
| 160 | Ga0207708_10355257 | 3300026075 | Bacteria | 1203 |
| 161 | Ga0207702_11315859 | 3300026078 | Bacteria | 717 |
| 162 | Ga0207675_100297782 | 3300026118 | Bacteria | 1570 |
| 163 | Ga0207683_10032319 | 3300026121 | Bacteria | 4546 |
| 164 | Ga0207683_11545757 | 3300026121 | Bacteria | 612 |
| 165 | Ga0268265_10209428 | 3300028380 | Bacteria | 1698 |
| 166 | Ga0268265_11226609 | 3300028380 | Bacteria | 748 |
| 167 | Ga0265318_10039202 | 3300028577 | Bacteria | 1809 |
| 168 | Ga0265338_10075984 | 3300028800 | Bacteria | 2848 |
| 169 | Ga0265338_10192714 | 3300028800 | Bacteria | 1544 |
| 170 | Ga0265338_10829142 | 3300028800 | Bacteria | 633 |
| 171 | Ga0265340_10012074 | 3300031247 | Bacteria | 4568 |
| 172 | Ga0265327_10016544 | 3300031251 | Bacteria | 4675 |
| 173 | Ga0307408_100476227 | 3300031548 | Bacteria | 1088 |
| 174 | Ga0265342_10477190 | 3300031712 | Bacteria | 638 |
| 175 | Ga0307405_10632989 | 3300031731 | Bacteria | 877 |
| 176 | Ga0307410_10345697 | 3300031852 | Bacteria | 1187 |
| 177 | Ga0307406_10079625 | 3300031901 | Bacteria | 2173 |
| 178 | Ga0307407_10350410 | 3300031903 | Bacteria | 1045 |
| 179 | Ga0307412_10055778 | 3300031911 | Bacteria | 2630 |
| 180 | Ga0307409_100053113 | 3300031995 | Bacteria | 3112 |
| 181 | Ga0307416_100009793 | 3300032002 | Bacteria | 6297 |
| 182 | Ga0307416_100224099 | 3300032002 | Bacteria | 1806 |
| 183 | Ga0307415_100159310 | 3300032126 | Bacteria | 1747 |
| 184 | Ga0307415_100210600 | 3300032126 | Bacteria | 1550 |
| 185 | Ga0373948_0002417 | 3300034817 | Bacteria | 2755 |
| 186 | Ga0373950_0004217 | 3300034818 | Bacteria | 2095 |
| 187 | Ga0373959_0001786 | 3300034820 | Bacteria | 3433 |
| 188 | Ga0373928_0010599 | 3300035084 | Bacteria | 1813 |
| 189 | Ga0373929_0001624 | 3300035085 | Bacteria | 4265 |
| 190 | Ga0373940_0002113 | 3300035088 | Bacteria | 3786 |
| 191 | Ga0373949_0002604 | 3300035090 | Bacteria | 4569 |
| 192 | Ga0373951_0001470 | 3300035091 | Bacteria | 6156 |
| 193 | Ga0373932_0011134 | 3300035112 | Bacteria | 2191 |
| 194 | Ga0373941_0005076 | 3300035115 | Bacteria | 3074 |
| 195 | Ga0373960_0060710 | 3300035121 | Bacteria | 1146 |
| 196 | Ga0373942_0001668 | 3300035207 | Bacteria | 5639 |
| 197 | Ga0373961_0002793 | 3300035241 | Bacteria | 4455 |
| 198 | Ga0373962_0007656 | 3300035242 | Bacteria | 2648 |
| 199 | Ga0373931_0006635 | 3300035691 | Bacteria | 5419 |
| 200 | Ga0395899_0005207 | 3300037312 | Bacteria | 10115 |
| 201 | Ga0395899_0011261 | 3300037312 | Bacteria | 6852 |
| 202 | Ga0395899_0027929 | 3300037312 | Bacteria | 4250 |
| 203 | Ga0395899_0030927 | 3300037312 | Bacteria | 4025 |
| 204 | Ga0395899_0036120 | 3300037312 | Bacteria | 3708 |
| 205 | Ga0395899_0048068 | 3300037312 | Bacteria | 3176 |
| 206 | Ga0395899_0098670 | 3300037312 | Bacteria | 2110 |
| 207 | Ga0395899_0111713 | 3300037312 | Bacteria | 1964 |
| 208 | Ga0395899_0177651 | 3300037312 | Bacteria | 1496 |
| 209 | Ga0395900_0002349 | 3300037418 | Bacteria | 20946 |
| 210 | Ga0395900_0007619 | 3300037418 | Bacteria | 11178 |
| 211 | Ga0395900_0019394 | 3300037418 | Bacteria | 6936 |
| 212 | Ga0395900_0025799 | 3300037418 | Bacteria | 6015 |
| 213 | Ga0395900_0114698 | 3300037418 | Bacteria | 2765 |
| 214 | Ga0395900_0201997 | 3300037418 | Bacteria | 2010 |
| 215 | Ga0395900_0219428 | 3300037418 | Bacteria | 1917 |
| 216 | Ga0395900_0236598 | 3300037418 | Bacteria | 1834 |
| 217 | Ga0395900_0313323 | 3300037418 | Bacteria | 1552 |
| 218 | Ga0395900_0331674 | 3300037418 | Bacteria | 1499 |
| 219 | Ga0395900_0532076 | 3300037418 | Bacteria | 1122 |
| 220 | Ga0395900_0750135 | 3300037418 | Bacteria | 906 |
| 221 | Ga0395898_0000723 | 3300037466 | Bacteria | 58117 |
| 222 | Ga0395898_0005448 | 3300037466 | Bacteria | 13753 |
| 223 | Ga0395898_0043328 | 3300037466 | Bacteria | 4434 |
| 224 | Ga0395898_0045451 | 3300037466 | Bacteria | 4316 |
| 225 | Ga0395898_0231016 | 3300037466 | Bacteria | 1764 |
| 226 | Ga0395898_0242086 | 3300037466 | Bacteria | 1720 |
| 227 | Ga0395898_0243180 | 3300037466 | Bacteria | 1716 |
| 228 | Ga0395898_0269538 | 3300037466 | Bacteria | 1624 |
| 229 | Ga0395898_0629328 | 3300037466 | Bacteria | 1015 |
| 230 | Ga0395898_1651048 | 3300037466 | Bacteria | 564 |
| 231 | Ga0395905_0001388 | 3300037471 | Bacteria | 29372 |
| 232 | Ga0395905_0006660 | 3300037471 | Bacteria | 11582 |
| 233 | Ga0395905_0019330 | 3300037471 | Bacteria | 6459 |
| 234 | Ga0395905_0060435 | 3300037471 | Bacteria | 3543 |
| 235 | Ga0395905_0093504 | 3300037471 | Bacteria | 2820 |
| 236 | Ga0395905_0164655 | 3300037471 | Bacteria | 2083 |
| 237 | Ga0395905_0170286 | 3300037471 | Bacteria | 2045 |
| 238 | Ga0395905_0239442 | 3300037471 | Bacteria | 1696 |
| 239 | Ga0395905_1518323 | 3300037471 | Unclassified | 574 |
| 240 | Ga0395901_0003745 | 3300038443 | Bacteria | 15320 |
| 241 | Ga0395901_0006183 | 3300038443 | Bacteria | 12132 |
| 242 | Ga0395901_0008786 | 3300038443 | Bacteria | 10221 |
| 243 | Ga0395901_0032341 | 3300038443 | Bacteria | 5398 |
| 244 | Ga0395901_0059041 | 3300038443 | Bacteria | 3990 |
| 245 | Ga0395901_0066883 | 3300038443 | Bacteria | 3742 |
| 246 | Ga0395901_0126932 | 3300038443 | Bacteria | 2680 |
| 247 | Ga0395901_0241872 | 3300038443 | Bacteria | 1882 |
| 248 | Ga0395901_0253014 | 3300038443 | Bacteria | 1835 |
| 249 | Ga0395901_0271012 | 3300038443 | Bacteria | 1765 |
| 250 | Ga0395901_0341347 | 3300038443 | Bacteria | 1547 |
| 251 | Ga0395901_0448116 | 3300038443 | Bacteria | 1320 |
| 252 | Ga0395901_0466207 | 3300038443 | Bacteria | 1290 |
| 253 | Ga0451800_0229800 | 3300041459 | Bacteria | 2218 |
| 254 | Ga0451807_0562377 | 3300041486 | Unclassified | 650 |
| 255 | Ga0451835_0031221 | 3300041492 | Bacteria | 2483 |
| 256 | Ga0451855_0752481 | 3300041511 | Bacteria | 2457 |
| 257 | Ga0451853_0367494 | 3300041512 | Bacteria | 832 |
| 258 | Ga0439434_0039960 | 3300042435 | Bacteria | 1440 |
| 259 | Ga0495605_0368021 | 3300046474 | Unclassified | 601 |
| 260 | Ga0495585_0075474 | 3300046492 | Bacteria | 1833 |
| 261 | Ga0495585_0114173 | 3300046492 | Bacteria | 1434 |
| 262 | Ga0495596_0097980 | 3300046500 | Bacteria | 1138 |
| 263 | Ga0495637_0103057 | 3300046520 | Bacteria | 1113 |
| 264 | Ga0495644_0031462 | 3300046523 | Bacteria | 2005 |
| 265 | Ga0495663_0057101 | 3300046525 | Bacteria | 1221 |
| 266 | Ga0495642_0034565 | 3300046528 | Bacteria | 2036 |
| 267 | Ga0495642_0112125 | 3300046528 | Bacteria | 1167 |
| 268 | Ga0495654_0394133 | 3300046530 | Unclassified | 551 |
| 269 | Ga0495598_0015125 | 3300046537 | Bacteria | 1942 |
| 270 | Ga0495598_0117053 | 3300046537 | Bacteria | 900 |
| 271 | Ga0495598_0468241 | 3300046537 | Bacteria | 501 |
| 272 | Ga0495609_0096319 | 3300046538 | Bacteria | 1284 |
| 273 | Ga0495656_0292956 | 3300046615 | Bacteria | 832 |
| 274 | Ga0495656_0525655 | 3300046615 | Bacteria | 629 |
| 275 | Ga0495668_0434829 | 3300046616 | Bacteria | 722 |
| 276 | Ga0495659_0241973 | 3300046664 | Bacteria | 750 |
| 277 | Ga0495659_0289994 | 3300046664 | Bacteria | 689 |
| 278 | Ga0495669_0669306 | 3300046684 | Unclassified | 505 |
| 279 | Ga0495589_0180768 | 3300046794 | Bacteria | 1000 |
| 280 | Ga0495589_0185777 | 3300046794 | Bacteria | 985 |
| 281 | Ga0495589_0603893 | 3300046794 | Bacteria | 500 |
| 282 | Ga0495677_0032461 | 3300047445 | Bacteria | 1902 |
| 283 | Ga0496102_0399308 | 3300048905 | Bacteria | 1292 |
| 284 | Ga0496102_0907960 | 3300048905 | Bacteria | 802 |
| 285 | Ga0496103_0006371 | 3300048906 | Bacteria | 7049 |
| 286 | Ga0496104_0010583 | 3300048907 | Bacteria | 8239 |
| 287 | Ga0496105_0112337 | 3300048908 | Bacteria | 2248 |
| 288 | Ga0496105_0188092 | 3300048908 | Bacteria | 1689 |
| 289 | Ga0496106_0563011 | 3300048909 | Bacteria | 914 |
| 290 | Ga0496107_0144182 | 3300048910 | Bacteria | 1760 |
| 291 | Ga0496108_0012690 | 3300048911 | Bacteria | 6863 |
| 292 | Ga0496108_0344356 | 3300048911 | Bacteria | 1300 |
| 293 | Ga0496108_0442292 | 3300048911 | Bacteria | 1136 |
| 294 | Ga0496108_0629306 | 3300048911 | Bacteria | 934 |
| 295 | Ga0496109_0227682 | 3300048912 | Bacteria | 1753 |
| 296 | Ga0496109_0303734 | 3300048912 | Bacteria | 1505 |
| 297 | Ga0496109_1427853 | 3300048912 | Bacteria | 627 |
| 298 | Ga0496110_0598757 | 3300048913 | Bacteria | 1000 |
| 299 | Ga0496111_0058277 | 3300048914 | Bacteria | 2796 |
| 300 | Ga0496112_0006011 | 3300048915 | Bacteria | 10594 |
| 301 | Ga0496112_0229097 | 3300048915 | Bacteria | 1813 |
| 302 | Ga0496112_0390236 | 3300048915 | Bacteria | 1332 |
| 303 | Ga0496112_0532939 | 3300048915 | Bacteria | 1108 |
| 304 | Ga0496113_0043368 | 3300048916 | Bacteria | 3328 |
| 305 | Ga0496113_0364554 | 3300048916 | Bacteria | 1159 |
| 306 | Ga0496114_0227711 | 3300048917 | Bacteria | 1637 |
| 307 | Ga0496114_0722933 | 3300048917 | Bacteria | 872 |
| 308 | Ga0496115_0198460 | 3300048918 | Bacteria | 1657 |
| 309 | Ga0501076_1363856 | 3300049592 | Bacteria | 583 |
| 310 | nmdc:mga05p37_153200_c1 | 3300050507 | Bacteria | 2818 |
| 311 | nmdc:mga05p37_1656649_c1 | 3300050507 | Bacteria | 626 |
| 312 | nmdc:mga05p37_195502_c1 | 3300050507 | Bacteria | 2453 |
| 313 | nmdc:mga05p37_555453_c1 | 3300050507 | Bacteria | 1306 |
| 314 | nmdc:mga0n895_2132608_c1 | 3300050512 | Unclassified | 517 |
| 315 | nmdc:mga0n895_43618_c1 | 3300050512 | Bacteria | 4371 |
| 316 | nmdc:mga0rr50_128029_c1 | 3300050513 | Bacteria | 2029 |
| 317 | nmdc:mga0rr50_141533_c1 | 3300050513 | Bacteria | 1936 |
| 318 | nmdc:mga08x19_283827_c1 | 3300050514 | Bacteria | 1148 |
| 319 | nmdc:mga08x19_90420_c1 | 3300050514 | Bacteria | 2020 |
| 320 | nmdc:mga0a205_85081_c1 | 3300050515 | Bacteria | 3055 |
| 321 | nmdc:mga0a205_95032_c1 | 3300050515 | Bacteria | 2880 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005434 | Ga0070709_10143920 | Ga0070709_101439202 | 90 |
| 2 | 3300005436 | Ga0070713_100127221 | Ga0070713_1001272212 | 90 |
| 3 | 3300005437 | Ga0070710_10184098 | Ga0070710_101840982 | 90 |
| 4 | 3300005439 | Ga0070711_100016040 | Ga0070711_1000160403 | 90 |
| 5 | 3300005440 | Ga0070705_100122311 | Ga0070705_1001223112 | 90 |
| 6 | 3300005444 | Ga0070694_100700443 | Ga0070694_1007004432 | 90 |
| 7 | 3300005445 | Ga0070708_100315096 | Ga0070708_1003150962 | 90 |
| 8 | 3300005467 | Ga0070706_100429445 | Ga0070706_1004294452 | 90 |
| 9 | 3300005468 | Ga0070707_100954285 | Ga0070707_1009542852 | 90 |
| 10 | 3300005471 | Ga0070698_100074158 | Ga0070698_1000741583 | 90 |
| 11 | 3300005518 | Ga0070699_100251296 | Ga0070699_1002512962 | 90 |
| 12 | 3300005536 | Ga0070697_100088344 | Ga0070697_1000883442 | 90 |
| 13 | 3300005546 | Ga0070696_100050509 | Ga0070696_1000505093 | 90 |
| 14 | 3300006028 | Ga0070717_10097683 | Ga0070717_100976832 | 90 |
| 15 | 3300006163 | Ga0070715_10034705 | Ga0070715_100347052 | 90 |
| 16 | 3300006173 | Ga0070716_100025863 | Ga0070716_1000258633 | 90 |
| 17 | 3300006175 | Ga0070712_100169345 | Ga0070712_1001693452 | 90 |
| 18 | 3300025898 | Ga0207692_10051344 | Ga0207692_100513442 | 90 |
| 19 | 3300025906 | Ga0207699_10076619 | Ga0207699_100766192 | 90 |
| 20 | 3300025915 | Ga0207693_10002300 | Ga0207693_1000230011 | 90 |
| 21 | 3300025916 | Ga0207663_10551012 | Ga0207663_105510122 | 90 |
| 22 | 3300025922 | Ga0207646_10329938 | Ga0207646_103299382 | 90 |
| 23 | 3300025928 | Ga0207700_10976300 | Ga0207700_109763002 | 90 |
| 24 | 3300025929 | Ga0207664_10559735 | Ga0207664_105597352 | 90 |
| 25 | 3300025939 | Ga0207665_10066426 | Ga0207665_100664263 | 90 |
| 26 | 3300048911 | Ga0496108_0344356 | Ga0496108_0344356_726_1013 | 90 |
| 27 | 3300025914 | Ga0207671_10716844 | Ga0207671_107168442 | 93 |
| 28 | 3300013105 | Ga0157369_10058210 | Ga0157369_100582102 | 94 |
| 29 | 3300006852 | Ga0075433_11032576 | Ga0075433_110325762 | 95 |
| 30 | 3300013100 | Ga0157373_11032587 | Ga0157373_110325872 | 95 |
| 31 | 3300037418 | Ga0395900_0114698 | Ga0395900_0114698_1127_1414 | 95 |
| 32 | 3300038443 | Ga0395901_0032341 | Ga0395901_0032341_3975_4262 | 95 |
| 33 | 3300042435 | Ga0439434_0039960 | Ga0439434_0039960_340_627 | 95 |
| 34 | 3300037466 | Ga0395898_0269538 | Ga0395898_0269538_1264_1566 | 97 |
| 35 | 3300038443 | Ga0395901_0253014 | Ga0395901_0253014_1224_1526 | 97 |
| 36 | 3300048912 | Ga0496109_1427853 | Ga0496109_1427853_126_434 | 102 |
| 37 | 3300048915 | Ga0496112_0006011 | Ga0496112_0006011_1648_1956 | 102 |
| 38 | 3300048916 | Ga0496113_0364554 | Ga0496113_0364554_232_540 | 102 |
| 39 | 3300005337 | Ga0070682_100606720 | Ga0070682_1006067201 | 103 |
| 40 | 3300005435 | Ga0070714_100936615 | Ga0070714_1009366152 | 103 |
| 41 | 3300012506 | Ga0157324_1064621 | Ga0157324_10646211 | 103 |
| 42 | 3300026121 | Ga0207683_11545757 | Ga0207683_115457572 | 103 |
| 43 | 3300028800 | Ga0265338_10829142 | Ga0265338_108291421 | 103 |
| 44 | 3300031548 | Ga0307408_100476227 | Ga0307408_1004762272 | 103 |
| 45 | 3300031911 | Ga0307412_10055778 | Ga0307412_100557784 | 103 |
| 46 | 3300032002 | Ga0307416_100224099 | Ga0307416_1002240992 | 103 |
| 47 | 3300032126 | Ga0307415_100210600 | Ga0307415_1002106002 | 103 |
| 48 | 3300041459 | Ga0451800_0229800 | Ga0451800_0229800_245_556 | 103 |
| 49 | 3300041492 | Ga0451835_0031221 | Ga0451835_0031221_281_592 | 103 |
| 50 | 3300041511 | Ga0451855_0752481 | Ga0451855_0752481_1658_1969 | 103 |
| 51 | 3300048911 | Ga0496108_0442292 | Ga0496108_0442292_734_1045 | 103 |
| 52 | 3300049592 | Ga0501076_1363856 | Ga0501076_1363856_90_404 | 103 |
| 53 | 3300005336 | Ga0070680_100718138 | Ga0070680_1007181382 | 104 |
| 54 | 3300005435 | Ga0070714_100045320 | Ga0070714_1000453202 | 104 |
| 55 | 3300005436 | Ga0070713_101096448 | Ga0070713_1010964481 | 104 |
| 56 | 3300005439 | Ga0070711_100620679 | Ga0070711_1006206791 | 104 |
| 57 | 3300005468 | Ga0070707_100334794 | Ga0070707_1003347942 | 104 |
| 58 | 3300005468 | Ga0070707_100739818 | Ga0070707_1007398181 | 104 |
| 59 | 3300005471 | Ga0070698_100502321 | Ga0070698_1005023212 | 104 |
| 60 | 3300005518 | Ga0070699_100441178 | Ga0070699_1004411782 | 104 |
| 61 | 3300005545 | Ga0070695_101523607 | Ga0070695_1015236071 | 104 |
| 62 | 3300005937 | Ga0081455_10045678 | Ga0081455_100456782 | 104 |
| 63 | 3300005937 | Ga0081455_10065700 | Ga0081455_100657002 | 104 |
| 64 | 3300005981 | Ga0081538_10030865 | Ga0081538_100308653 | 104 |
| 65 | 3300005985 | Ga0081539_10502013 | Ga0081539_105020132 | 104 |
| 66 | 3300006028 | Ga0070717_10830577 | Ga0070717_108305772 | 104 |
| 67 | 3300006175 | Ga0070712_100690274 | Ga0070712_1006902742 | 104 |
| 68 | 3300006175 | Ga0070712_101772251 | Ga0070712_1017722512 | 104 |
| 69 | 3300009147 | Ga0114129_10431432 | Ga0114129_104314322 | 104 |
| 70 | 3300009147 | Ga0114129_10803168 | Ga0114129_108031682 | 104 |
| 71 | 3300009553 | Ga0105249_13341800 | Ga0105249_133418001 | 104 |
| 72 | 3300013296 | Ga0157374_11091311 | Ga0157374_110913112 | 104 |
| 73 | 3300014325 | Ga0163163_11033080 | Ga0163163_110330802 | 104 |
| 74 | 3300014326 | Ga0157380_11802516 | Ga0157380_118025161 | 104 |
| 75 | 3300014968 | Ga0157379_10808314 | Ga0157379_108083142 | 104 |
| 76 | 3300025906 | Ga0207699_10179357 | Ga0207699_101793572 | 104 |
| 77 | 3300025910 | Ga0207684_10183307 | Ga0207684_101833072 | 104 |
| 78 | 3300025910 | Ga0207684_11171678 | Ga0207684_111716782 | 104 |
| 79 | 3300025915 | Ga0207693_10249444 | Ga0207693_102494442 | 104 |
| 80 | 3300025916 | Ga0207663_10983843 | Ga0207663_109838432 | 104 |
| 81 | 3300025917 | Ga0207660_11439077 | Ga0207660_114390772 | 104 |
| 82 | 3300025922 | Ga0207646_10034340 | Ga0207646_100343401 | 104 |
| 83 | 3300025922 | Ga0207646_10455942 | Ga0207646_104559422 | 104 |
| 84 | 3300025928 | Ga0207700_10878479 | Ga0207700_108784792 | 104 |
| 85 | 3300025931 | Ga0207644_11599088 | Ga0207644_115990881 | 104 |
| 86 | 3300025933 | Ga0207706_10300745 | Ga0207706_103007452 | 104 |
| 87 | 3300028380 | Ga0268265_11226609 | Ga0268265_112266091 | 104 |
| 88 | 3300028800 | Ga0265338_10192714 | Ga0265338_101927142 | 104 |
| 89 | 3300031251 | Ga0265327_10016544 | Ga0265327_100165444 | 104 |
| 90 | 3300037312 | Ga0395899_0005207 | Ga0395899_0005207_2563_2877 | 104 |
| 91 | 3300037312 | Ga0395899_0011261 | Ga0395899_0011261_16_333 | 104 |
| 92 | 3300037312 | Ga0395899_0027929 | Ga0395899_0027929_425_739 | 104 |
| 93 | 3300037312 | Ga0395899_0030927 | Ga0395899_0030927_2383_2697 | 104 |
| 94 | 3300037312 | Ga0395899_0036120 | Ga0395899_0036120_1718_2035 | 104 |
| 95 | 3300037312 | Ga0395899_0098670 | Ga0395899_0098670_76_393 | 104 |
| 96 | 3300037312 | Ga0395899_0111713 | Ga0395899_0111713_514_828 | 104 |
| 97 | 3300037312 | Ga0395899_0177651 | Ga0395899_0177651_42_356 | 104 |
| 98 | 3300037418 | Ga0395900_0002349 | Ga0395900_0002349_18446_18760 | 104 |
| 99 | 3300037418 | Ga0395900_0007619 | Ga0395900_0007619_8716_9030 | 104 |
| 100 | 3300037418 | Ga0395900_0019394 | Ga0395900_0019394_2384_2698 | 104 |
| 101 | 3300037418 | Ga0395900_0025799 | Ga0395900_0025799_1292_1609 | 104 |
| 102 | 3300037418 | Ga0395900_0201997 | Ga0395900_0201997_1440_1757 | 104 |
| 103 | 3300037418 | Ga0395900_0219428 | Ga0395900_0219428_751_1065 | 104 |
| 104 | 3300037418 | Ga0395900_0313323 | Ga0395900_0313323_642_956 | 104 |
| 105 | 3300037418 | Ga0395900_0331674 | Ga0395900_0331674_204_518 | 104 |
| 106 | 3300037418 | Ga0395900_0532076 | Ga0395900_0532076_753_1067 | 104 |
| 107 | 3300037466 | Ga0395898_0000723 | Ga0395898_0000723_3306_3620 | 104 |
| 108 | 3300037466 | Ga0395898_0005448 | Ga0395898_0005448_7741_8055 | 104 |
| 109 | 3300037466 | Ga0395898_0043328 | Ga0395898_0043328_3761_4075 | 104 |
| 110 | 3300037466 | Ga0395898_0045451 | Ga0395898_0045451_2560_2877 | 104 |
| 111 | 3300037466 | Ga0395898_0242086 | Ga0395898_0242086_710_1027 | 104 |
| 112 | 3300037466 | Ga0395898_0243180 | Ga0395898_0243180_950_1264 | 104 |
| 113 | 3300037466 | Ga0395898_0629328 | Ga0395898_0629328_490_807 | 104 |
| 114 | 3300037466 | Ga0395898_1651048 | Ga0395898_1651048_65_379 | 104 |
| 115 | 3300037471 | Ga0395905_0001388 | Ga0395905_0001388_17796_18110 | 104 |
| 116 | 3300037471 | Ga0395905_0006660 | Ga0395905_0006660_8807_9121 | 104 |
| 117 | 3300037471 | Ga0395905_0019330 | Ga0395905_0019330_1202_1516 | 104 |
| 118 | 3300037471 | Ga0395905_0060435 | Ga0395905_0060435_2194_2508 | 104 |
| 119 | 3300037471 | Ga0395905_0164655 | Ga0395905_0164655_992_1309 | 104 |
| 120 | 3300037471 | Ga0395905_0170286 | Ga0395905_0170286_506_823 | 104 |
| 121 | 3300038443 | Ga0395901_0003745 | Ga0395901_0003745_5957_6271 | 104 |
| 122 | 3300038443 | Ga0395901_0006183 | Ga0395901_0006183_9632_9946 | 104 |
| 123 | 3300038443 | Ga0395901_0008786 | Ga0395901_0008786_4157_4471 | 104 |
| 124 | 3300038443 | Ga0395901_0059041 | Ga0395901_0059041_3268_3582 | 104 |
| 125 | 3300038443 | Ga0395901_0066883 | Ga0395901_0066883_1385_1699 | 104 |
| 126 | 3300038443 | Ga0395901_0126932 | Ga0395901_0126932_254_571 | 104 |
| 127 | 3300038443 | Ga0395901_0271012 | Ga0395901_0271012_1318_1635 | 104 |
| 128 | 3300038443 | Ga0395901_0466207 | Ga0395901_0466207_950_1264 | 104 |
| 129 | 3300041486 | Ga0451807_0562377 | Ga0451807_0562377_201_515 | 104 |
| 130 | 3300041512 | Ga0451853_0367494 | Ga0451853_0367494_22_336 | 104 |
| 131 | 3300046474 | Ga0495605_0368021 | Ga0495605_0368021_122_436 | 104 |
| 132 | 3300046492 | Ga0495585_0075474 | Ga0495585_0075474_720_1034 | 104 |
| 133 | 3300046492 | Ga0495585_0114173 | Ga0495585_0114173_91_405 | 104 |
| 134 | 3300046500 | Ga0495596_0097980 | Ga0495596_0097980_779_1093 | 104 |
| 135 | 3300046520 | Ga0495637_0103057 | Ga0495637_0103057_327_641 | 104 |
| 136 | 3300046523 | Ga0495644_0031462 | Ga0495644_0031462_1482_1796 | 104 |
| 137 | 3300046525 | Ga0495663_0057101 | Ga0495663_0057101_616_930 | 104 |
| 138 | 3300046528 | Ga0495642_0034565 | Ga0495642_0034565_181_495 | 104 |
| 139 | 3300046528 | Ga0495642_0112125 | Ga0495642_0112125_488_802 | 104 |
| 140 | 3300046530 | Ga0495654_0394133 | Ga0495654_0394133_170_484 | 104 |
| 141 | 3300046537 | Ga0495598_0015125 | Ga0495598_0015125_75_389 | 104 |
| 142 | 3300046537 | Ga0495598_0117053 | Ga0495598_0117053_265_579 | 104 |
| 143 | 3300046537 | Ga0495598_0468241 | Ga0495598_0468241_163_477 | 104 |
| 144 | 3300046538 | Ga0495609_0096319 | Ga0495609_0096319_846_1160 | 104 |
| 145 | 3300046615 | Ga0495656_0292956 | Ga0495656_0292956_488_802 | 104 |
| 146 | 3300046615 | Ga0495656_0525655 | Ga0495656_0525655_45_359 | 104 |
| 147 | 3300046616 | Ga0495668_0434829 | Ga0495668_0434829_355_669 | 104 |
| 148 | 3300046664 | Ga0495659_0241973 | Ga0495659_0241973_26_340 | 104 |
| 149 | 3300046664 | Ga0495659_0289994 | Ga0495659_0289994_353_667 | 104 |
| 150 | 3300046684 | Ga0495669_0669306 | Ga0495669_0669306_76_390 | 104 |
| 151 | 3300046794 | Ga0495589_0180768 | Ga0495589_0180768_56_370 | 104 |
| 152 | 3300046794 | Ga0495589_0603893 | Ga0495589_0603893_153_467 | 104 |
| 153 | 3300047445 | Ga0495677_0032461 | Ga0495677_0032461_996_1310 | 104 |
| 154 | 3300048905 | Ga0496102_0907960 | Ga0496102_0907960_20_337 | 104 |
| 155 | 3300048908 | Ga0496105_0188092 | Ga0496105_0188092_172_489 | 104 |
| 156 | 3300048911 | Ga0496108_0629306 | Ga0496108_0629306_541_861 | 104 |
| 157 | 3300048912 | Ga0496109_0303734 | Ga0496109_0303734_1122_1436 | 104 |
| 158 | 3300048913 | Ga0496110_0598757 | Ga0496110_0598757_371_685 | 104 |
| 159 | 3300048914 | Ga0496111_0058277 | Ga0496111_0058277_829_1146 | 104 |
| 160 | 3300048915 | Ga0496112_0229097 | Ga0496112_0229097_352_666 | 104 |
| 161 | 3300048917 | Ga0496114_0722933 | Ga0496114_0722933_267_584 | 104 |
| 162 | 3300050507 | nmdc:mga05p37_1656649_c1 | nmdc:mga05p37_1656649_c1_262_576 | 104 |
| 163 | 3300050507 | nmdc:mga05p37_555453_c1 | nmdc:mga05p37_555453_c1_234_548 | 104 |
| 164 | 3300005334 | Ga0068869_100430081 | Ga0068869_1004300812 | 105 |
| 165 | 3300005338 | Ga0068868_100329667 | Ga0068868_1003296672 | 105 |
| 166 | 3300005341 | Ga0070691_10939463 | Ga0070691_109394631 | 105 |
| 167 | 3300005345 | Ga0070692_10402222 | Ga0070692_104022222 | 105 |
| 168 | 3300005347 | Ga0070668_102197835 | Ga0070668_1021978351 | 105 |
| 169 | 3300005364 | Ga0070673_100301455 | Ga0070673_1003014552 | 105 |
| 170 | 3300005366 | Ga0070659_100377275 | Ga0070659_1003772752 | 105 |
| 171 | 3300005367 | Ga0070667_101342897 | Ga0070667_1013428971 | 105 |
| 172 | 3300005406 | Ga0070703_10002960 | Ga0070703_100029603 | 105 |
| 173 | 3300005434 | Ga0070709_10198088 | Ga0070709_101980882 | 105 |
| 174 | 3300005434 | Ga0070709_10817186 | Ga0070709_108171861 | 105 |
| 175 | 3300005435 | Ga0070714_100029426 | Ga0070714_1000294262 | 105 |
| 176 | 3300005438 | Ga0070701_10253965 | Ga0070701_102539652 | 105 |
| 177 | 3300005439 | Ga0070711_100051431 | Ga0070711_1000514312 | 105 |
| 178 | 3300005439 | Ga0070711_100116982 | Ga0070711_1001169822 | 105 |
| 179 | 3300005440 | Ga0070705_100029902 | Ga0070705_1000299022 | 105 |
| 180 | 3300005441 | Ga0070700_100446687 | Ga0070700_1004466871 | 105 |
| 181 | 3300005444 | Ga0070694_100235736 | Ga0070694_1002357362 | 105 |
| 182 | 3300005444 | Ga0070694_101744579 | Ga0070694_1017445791 | 105 |
| 183 | 3300005445 | Ga0070708_100042943 | Ga0070708_1000429432 | 105 |
| 184 | 3300005456 | Ga0070678_101307880 | Ga0070678_1013078801 | 105 |
| 185 | 3300005457 | Ga0070662_100696903 | Ga0070662_1006969032 | 105 |
| 186 | 3300005466 | Ga0070685_10765956 | Ga0070685_107659562 | 105 |
| 187 | 3300005467 | Ga0070706_100031837 | Ga0070706_1000318371 | 105 |
| 188 | 3300005467 | Ga0070706_100053124 | Ga0070706_1000531242 | 105 |
| 189 | 3300005468 | Ga0070707_100013757 | Ga0070707_1000137578 | 105 |
| 190 | 3300005468 | Ga0070707_100175483 | Ga0070707_1001754832 | 105 |
| 191 | 3300005468 | Ga0070707_100543716 | Ga0070707_1005437162 | 105 |
| 192 | 3300005518 | Ga0070699_100036286 | Ga0070699_1000362863 | 105 |
| 193 | 3300005518 | Ga0070699_100087114 | Ga0070699_1000871142 | 105 |
| 194 | 3300005518 | Ga0070699_100613124 | Ga0070699_1006131241 | 105 |
| 195 | 3300005545 | Ga0070695_100151997 | Ga0070695_1001519971 | 105 |
| 196 | 3300005545 | Ga0070695_100211844 | Ga0070695_1002118442 | 105 |
| 197 | 3300005546 | Ga0070696_100008667 | Ga0070696_1000086674 | 105 |
| 198 | 3300005546 | Ga0070696_100986616 | Ga0070696_1009866162 | 105 |
| 199 | 3300005549 | Ga0070704_100014607 | Ga0070704_1000146072 | 105 |
| 200 | 3300005563 | Ga0068855_100861326 | Ga0068855_1008613262 | 105 |
| 201 | 3300005615 | Ga0070702_101240884 | Ga0070702_1012408841 | 105 |
| 202 | 3300005719 | Ga0068861_100957219 | Ga0068861_1009572192 | 105 |
| 203 | 3300005844 | Ga0068862_101708364 | Ga0068862_1017083641 | 105 |
| 204 | 3300006058 | Ga0075432_10135726 | Ga0075432_101357262 | 105 |
| 205 | 3300006163 | Ga0070715_10191618 | Ga0070715_101916182 | 105 |
| 206 | 3300006173 | Ga0070716_100014026 | Ga0070716_1000140263 | 105 |
| 207 | 3300006173 | Ga0070716_100188509 | Ga0070716_1001885092 | 105 |
| 208 | 3300006173 | Ga0070716_100931276 | Ga0070716_1009312762 | 105 |
| 209 | 3300006175 | Ga0070712_100015322 | Ga0070712_1000153222 | 105 |
| 210 | 3300006852 | Ga0075433_10637613 | Ga0075433_106376132 | 105 |
| 211 | 3300006871 | Ga0075434_100016157 | Ga0075434_1000161572 | 105 |
| 212 | 3300006881 | Ga0068865_100477403 | Ga0068865_1004774032 | 105 |
| 213 | 3300006914 | Ga0075436_100139283 | Ga0075436_1001392832 | 105 |
| 214 | 3300006914 | Ga0075436_101371973 | Ga0075436_1013719732 | 105 |
| 215 | 3300007076 | Ga0075435_101611445 | Ga0075435_1016114452 | 105 |
| 216 | 3300009092 | Ga0105250_10046671 | Ga0105250_100466711 | 105 |
| 217 | 3300009098 | Ga0105245_11629897 | Ga0105245_116298972 | 105 |
| 218 | 3300009147 | Ga0114129_12116872 | Ga0114129_121168722 | 105 |
| 219 | 3300009147 | Ga0114129_13228510 | Ga0114129_132285102 | 105 |
| 220 | 3300009148 | Ga0105243_11117133 | Ga0105243_111171331 | 105 |
| 221 | 3300009148 | Ga0105243_12609490 | Ga0105243_126094902 | 105 |
| 222 | 3300009174 | Ga0105241_10058937 | Ga0105241_100589371 | 105 |
| 223 | 3300009176 | Ga0105242_10426221 | Ga0105242_104262212 | 105 |
| 224 | 3300009176 | Ga0105242_11552822 | Ga0105242_115528222 | 105 |
| 225 | 3300009553 | Ga0105249_10208918 | Ga0105249_102089182 | 105 |
| 226 | 3300010375 | Ga0105239_12715740 | Ga0105239_127157402 | 105 |
| 227 | 3300013306 | Ga0163162_10183398 | Ga0163162_101833982 | 105 |
| 228 | 3300013307 | Ga0157372_11422350 | Ga0157372_114223502 | 105 |
| 229 | 3300013308 | Ga0157375_10254131 | Ga0157375_102541312 | 105 |
| 230 | 3300014745 | Ga0157377_10227670 | Ga0157377_102276702 | 105 |
| 231 | 3300014968 | Ga0157379_11096072 | Ga0157379_110960722 | 105 |
| 232 | 3300025885 | Ga0207653_10102075 | Ga0207653_101020752 | 105 |
| 233 | 3300025885 | Ga0207653_10223934 | Ga0207653_102239341 | 105 |
| 234 | 3300025898 | Ga0207692_10200712 | Ga0207692_102007122 | 105 |
| 235 | 3300025901 | Ga0207688_10150712 | Ga0207688_101507122 | 105 |
| 236 | 3300025905 | Ga0207685_10001902 | Ga0207685_100019022 | 105 |
| 237 | 3300025906 | Ga0207699_10196824 | Ga0207699_101968241 | 105 |
| 238 | 3300025910 | Ga0207684_10015975 | Ga0207684_100159752 | 105 |
| 239 | 3300025910 | Ga0207684_10535659 | Ga0207684_105356592 | 105 |
| 240 | 3300025915 | Ga0207693_10000736 | Ga0207693_100007367 | 105 |
| 241 | 3300025915 | Ga0207693_10023376 | Ga0207693_100233763 | 105 |
| 242 | 3300025916 | Ga0207663_10072547 | Ga0207663_100725471 | 105 |
| 243 | 3300025916 | Ga0207663_11667975 | Ga0207663_116679751 | 105 |
| 244 | 3300025922 | Ga0207646_10003166 | Ga0207646_100031668 | 105 |
| 245 | 3300025922 | Ga0207646_10532524 | Ga0207646_105325241 | 105 |
| 246 | 3300025927 | Ga0207687_10593374 | Ga0207687_105933742 | 105 |
| 247 | 3300025929 | Ga0207664_10214336 | Ga0207664_102143362 | 105 |
| 248 | 3300025932 | Ga0207690_10532686 | Ga0207690_105326861 | 105 |
| 249 | 3300025934 | Ga0207686_10166310 | Ga0207686_101663102 | 105 |
| 250 | 3300025934 | Ga0207686_10646636 | Ga0207686_106466362 | 105 |
| 251 | 3300025935 | Ga0207709_10890103 | Ga0207709_108901032 | 105 |
| 252 | 3300025938 | Ga0207704_11008618 | Ga0207704_110086181 | 105 |
| 253 | 3300025939 | Ga0207665_10094890 | Ga0207665_100948902 | 105 |
| 254 | 3300025960 | Ga0207651_10623131 | Ga0207651_106231312 | 105 |
| 255 | 3300025961 | Ga0207712_10477875 | Ga0207712_104778752 | 105 |
| 256 | 3300025972 | Ga0207668_11291198 | Ga0207668_112911982 | 105 |
| 257 | 3300026075 | Ga0207708_10355257 | Ga0207708_103552571 | 105 |
| 258 | 3300026078 | Ga0207702_11315859 | Ga0207702_113158591 | 105 |
| 259 | 3300026118 | Ga0207675_100297782 | Ga0207675_1002977822 | 105 |
| 260 | 3300026121 | Ga0207683_10032319 | Ga0207683_100323193 | 105 |
| 261 | 3300028380 | Ga0268265_10209428 | Ga0268265_102094282 | 105 |
| 262 | 3300028577 | Ga0265318_10039202 | Ga0265318_100392022 | 105 |
| 263 | 3300028800 | Ga0265338_10075984 | Ga0265338_100759842 | 105 |
| 264 | 3300031247 | Ga0265340_10012074 | Ga0265340_100120742 | 105 |
| 265 | 3300031712 | Ga0265342_10477190 | Ga0265342_104771902 | 105 |
| 266 | 3300031731 | Ga0307405_10632989 | Ga0307405_106329892 | 105 |
| 267 | 3300031852 | Ga0307410_10345697 | Ga0307410_103456972 | 105 |
| 268 | 3300031901 | Ga0307406_10079625 | Ga0307406_100796252 | 105 |
| 269 | 3300031903 | Ga0307407_10350410 | Ga0307407_103504102 | 105 |
| 270 | 3300031995 | Ga0307409_100053113 | Ga0307409_1000531132 | 105 |
| 271 | 3300032002 | Ga0307416_100009793 | Ga0307416_1000097932 | 105 |
| 272 | 3300032126 | Ga0307415_100159310 | Ga0307415_1001593102 | 105 |
| 273 | 3300034817 | Ga0373948_0002417 | Ga0373948_0002417_2392_2718 | 105 |
| 274 | 3300034818 | Ga0373950_0004217 | Ga0373950_0004217_37_363 | 105 |
| 275 | 3300034820 | Ga0373959_0001786 | Ga0373959_0001786_630_956 | 105 |
| 276 | 3300035084 | Ga0373928_0010599 | Ga0373928_0010599_1221_1547 | 105 |
| 277 | 3300035085 | Ga0373929_0001624 | Ga0373929_0001624_1635_1961 | 105 |
| 278 | 3300035088 | Ga0373940_0002113 | Ga0373940_0002113_108_434 | 105 |
| 279 | 3300035090 | Ga0373949_0002604 | Ga0373949_0002604_126_452 | 105 |
| 280 | 3300035091 | Ga0373951_0001470 | Ga0373951_0001470_2540_2866 | 105 |
| 281 | 3300035112 | Ga0373932_0011134 | Ga0373932_0011134_88_414 | 105 |
| 282 | 3300035115 | Ga0373941_0005076 | Ga0373941_0005076_299_625 | 105 |
| 283 | 3300035121 | Ga0373960_0060710 | Ga0373960_0060710_619_945 | 105 |
| 284 | 3300035207 | Ga0373942_0001668 | Ga0373942_0001668_233_559 | 105 |
| 285 | 3300035241 | Ga0373961_0002793 | Ga0373961_0002793_3829_4155 | 105 |
| 286 | 3300035242 | Ga0373962_0007656 | Ga0373962_0007656_2154_2480 | 105 |
| 287 | 3300035691 | Ga0373931_0006635 | Ga0373931_0006635_747_1073 | 105 |
| 288 | 3300037312 | Ga0395899_0048068 | Ga0395899_0048068_229_555 | 105 |
| 289 | 3300037418 | Ga0395900_0236598 | Ga0395900_0236598_242_571 | 105 |
| 290 | 3300037418 | Ga0395900_0750135 | Ga0395900_0750135_399_725 | 105 |
| 291 | 3300037466 | Ga0395898_0231016 | Ga0395898_0231016_399_725 | 105 |
| 292 | 3300037471 | Ga0395905_0093504 | Ga0395905_0093504_2073_2399 | 105 |
| 293 | 3300037471 | Ga0395905_0239442 | Ga0395905_0239442_945_1274 | 105 |
| 294 | 3300037471 | Ga0395905_1518323 | Ga0395905_1518323_56_382 | 105 |
| 295 | 3300038443 | Ga0395901_0241872 | Ga0395901_0241872_1004_1330 | 105 |
| 296 | 3300038443 | Ga0395901_0341347 | Ga0395901_0341347_786_1115 | 105 |
| 297 | 3300038443 | Ga0395901_0448116 | Ga0395901_0448116_961_1287 | 105 |
| 298 | 3300046794 | Ga0495589_0185777 | Ga0495589_0185777_649_975 | 105 |
| 299 | 3300048905 | Ga0496102_0399308 | Ga0496102_0399308_623_949 | 105 |
| 300 | 3300048906 | Ga0496103_0006371 | Ga0496103_0006371_6692_7018 | 105 |
| 301 | 3300048907 | Ga0496104_0010583 | Ga0496104_0010583_3658_3984 | 105 |
| 302 | 3300048908 | Ga0496105_0112337 | Ga0496105_0112337_231_557 | 105 |
| 303 | 3300048909 | Ga0496106_0563011 | Ga0496106_0563011_189_506 | 105 |
| 304 | 3300048910 | Ga0496107_0144182 | Ga0496107_0144182_1276_1602 | 105 |
| 305 | 3300048911 | Ga0496108_0012690 | Ga0496108_0012690_97_423 | 105 |
| 306 | 3300048912 | Ga0496109_0227682 | Ga0496109_0227682_300_626 | 105 |
| 307 | 3300048915 | Ga0496112_0390236 | Ga0496112_0390236_740_1066 | 105 |
| 308 | 3300048915 | Ga0496112_0532939 | Ga0496112_0532939_164_490 | 105 |
| 309 | 3300048916 | Ga0496113_0043368 | Ga0496113_0043368_2786_3112 | 105 |
| 310 | 3300048917 | Ga0496114_0227711 | Ga0496114_0227711_184_510 | 105 |
| 311 | 3300048918 | Ga0496115_0198460 | Ga0496115_0198460_204_530 | 105 |
| 312 | 3300050507 | nmdc:mga05p37_153200_c1 | nmdc:mga05p37_153200_c1_897_1223 | 105 |
| 313 | 3300050507 | nmdc:mga05p37_195502_c1 | nmdc:mga05p37_195502_c1_2100_2426 | 105 |
| 314 | 3300050512 | nmdc:mga0n895_2132608_c1 | nmdc:mga0n895_2132608_c1_99_425 | 105 |
| 315 | 3300050512 | nmdc:mga0n895_43618_c1 | nmdc:mga0n895_43618_c1_99_425 | 105 |
| 316 | 3300050513 | nmdc:mga0rr50_128029_c1 | nmdc:mga0rr50_128029_c1_1605_1931 | 105 |
| 317 | 3300050513 | nmdc:mga0rr50_141533_c1 | nmdc:mga0rr50_141533_c1_1397_1723 | 105 |
| 318 | 3300050514 | nmdc:mga08x19_283827_c1 | nmdc:mga08x19_283827_c1_131_457 | 105 |
| 319 | 3300050514 | nmdc:mga08x19_90420_c1 | nmdc:mga08x19_90420_c1_1596_1922 | 105 |
| 320 | 3300050515 | nmdc:mga0a205_85081_c1 | nmdc:mga0a205_85081_c1_1007_1333 | 105 |
| 321 | 3300050515 | nmdc:mga0a205_95032_c1 | nmdc:mga0a205_95032_c1_225_551 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kd3-assembly1.cif.gz_B | structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 | 0.9307 | 12 | 103 |
| 4a5m-assembly1.cif.gz_B | redox regulator hypr in its oxidized form | 0.9114 | 12 | 103 |
| 5hs9-assembly1.cif.gz_A | crystal structure of the quinone-bound yodb from b. subtilis | 0.9067 | 10 | 103 |
| 5hs7-assembly1.cif.gz_A | reduced form of the transcriptional regulator yodb from b. subtilis | 0.8927 | 8 | 102 |
| 2f2e-assembly1.cif.gz_A | crystal structure of pa1607, a putative transcription factor | 0.8922 | 2 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMG3_11_158_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9388 | 13 | 103 | 1.10.10.10 |
| 5hs9A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9067 | 10 | 103 | 1.10.10.10 |
| af_Q58793_322_389_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9053 | 20 | 83 | 1.10.10.10 |
| 2f2eB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8919 | 15 | 103 | 1.10.10.10 |
| 5hs9B00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8893 | 9 | 103 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1LI86-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9827 | 7 | 101 |
GO:0003677
|
| AF-A0A4V3D825-F1-model_v4 | HxlR family transcriptional regulator | 0.9764 | 5 | 103 |
GO:0003677
|
| AF-A0A7W0PX62-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9755 | 17 | 101 |
GO:0003677
|
| AF-A0A538A986-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9697 | 2 | 97 |
GO:0003677
|
| AF-A0A087CGQ0-F1-model_v4 | MarR family transcriptional regulator | 0.9675 | 19 | 103 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar