F405908

General Info

Members Datasets Scaffolds Average Seq Length
321 173 321 105

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10502013|Ga0081539_105020132
Length 105
Sequence MRCRSCAPLPEQVRRAADLLERRWTVSILYVSHEGGAVRFNEFQQALGSIPPATLTQRLADLEEAGILEREVIDARPPRVEYRLTERGRQLRSLIDALDQFAQTV

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
113 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
114 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
115 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
116 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
117 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
118 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
119 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
123 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
135 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
141 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
145 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.72
Rhizosphere 90.34
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100430081 3300005334 Bacteria 1091
2 Ga0070680_100718138 3300005336 Bacteria 860
3 Ga0070682_100606720 3300005337 Bacteria 865
4 Ga0068868_100329667 3300005338 Bacteria 1302
5 Ga0070691_10939463 3300005341 Bacteria 536
6 Ga0070692_10402222 3300005345 Bacteria 865
7 Ga0070668_102197835 3300005347 Bacteria 510
8 Ga0070673_100301455 3300005364 Bacteria 1411
9 Ga0070659_100377275 3300005366 Bacteria 1194
10 Ga0070667_101342897 3300005367 Unclassified 670
11 Ga0070703_10002960 3300005406 Bacteria 4853
12 Ga0070709_10143920 3300005434 Bacteria 1640
13 Ga0070709_10198088 3300005434 Bacteria 1421
14 Ga0070709_10817186 3300005434 Bacteria 732
15 Ga0070714_100029426 3300005435 Bacteria 4566
16 Ga0070714_100045320 3300005435 Bacteria 3727
17 Ga0070714_100936615 3300005435 Bacteria 842
18 Ga0070713_100127221 3300005436 Bacteria 2242
19 Ga0070713_101096448 3300005436 Bacteria 769
20 Ga0070710_10184098 3300005437 Bacteria 1310
21 Ga0070701_10253965 3300005438 Bacteria 1063
22 Ga0070711_100016040 3300005439 Bacteria 4749
23 Ga0070711_100051431 3300005439 Bacteria 2830
24 Ga0070711_100116982 3300005439 Bacteria 1965
25 Ga0070711_100620679 3300005439 Bacteria 904
26 Ga0070705_100029902 3300005440 Bacteria 3002
27 Ga0070705_100122311 3300005440 Bacteria 1682
28 Ga0070700_100446687 3300005441 Bacteria 983
29 Ga0070694_100235736 3300005444 Bacteria 1378
30 Ga0070694_100700443 3300005444 Bacteria 823
31 Ga0070694_101744579 3300005444 Unclassified 530
32 Ga0070708_100042943 3300005445 Bacteria 3971
33 Ga0070708_100315096 3300005445 Bacteria 1474
34 Ga0070678_101307880 3300005456 Bacteria 675
35 Ga0070662_100696903 3300005457 Bacteria 859
36 Ga0070685_10765956 3300005466 Bacteria 709
37 Ga0070706_100031837 3300005467 Bacteria 4863
38 Ga0070706_100053124 3300005467 Bacteria 3739
39 Ga0070706_100429445 3300005467 Bacteria 1229
40 Ga0070707_100013757 3300005468 Bacteria 7578
41 Ga0070707_100175483 3300005468 Bacteria 2089
42 Ga0070707_100334794 3300005468 Bacteria 1471
43 Ga0070707_100543716 3300005468 Bacteria 1124
44 Ga0070707_100739818 3300005468 Bacteria 947
45 Ga0070707_100954285 3300005468 Bacteria 823
46 Ga0070698_100074158 3300005471 Bacteria 3408
47 Ga0070698_100502321 3300005471 Bacteria 1150
48 Ga0070699_100036286 3300005518 Bacteria 4265
49 Ga0070699_100087114 3300005518 Bacteria 2726
50 Ga0070699_100251296 3300005518 Bacteria 1580
51 Ga0070699_100441178 3300005518 Bacteria 1180
52 Ga0070699_100613124 3300005518 Bacteria 993
53 Ga0070697_100088344 3300005536 Bacteria 2559
54 Ga0070695_100151997 3300005545 Bacteria 1616
55 Ga0070695_100211844 3300005545 Bacteria 1391
56 Ga0070695_101523607 3300005545 Bacteria 557
57 Ga0070696_100008667 3300005546 Bacteria 6803
58 Ga0070696_100050509 3300005546 Bacteria 2890
59 Ga0070696_100986616 3300005546 Bacteria 703
60 Ga0070704_100014607 3300005549 Bacteria 4908
61 Ga0068855_100861326 3300005563 Bacteria 959
62 Ga0070702_101240884 3300005615 Bacteria 603
63 Ga0068861_100957219 3300005719 Bacteria 815
64 Ga0068862_101708364 3300005844 Unclassified 638
65 Ga0081455_10045678 3300005937 Bacteria 3808
66 Ga0081455_10065700 3300005937 Bacteria 3033
67 Ga0081538_10030865 3300005981 Bacteria 3628
68 Ga0081539_10502013 3300005985 Unclassified 502
69 Ga0070717_10097683 3300006028 Bacteria 2489
70 Ga0070717_10830577 3300006028 Bacteria 841
71 Ga0075432_10135726 3300006058 Bacteria 935
72 Ga0070715_10034705 3300006163 Bacteria 2070
73 Ga0070715_10191618 3300006163 Bacteria 1032
74 Ga0070716_100014026 3300006173 Bacteria 4098
75 Ga0070716_100025863 3300006173 Bacteria 3137
76 Ga0070716_100188509 3300006173 Bacteria 1360
77 Ga0070716_100931276 3300006173 Unclassified 682
78 Ga0070712_100015322 3300006175 Bacteria 4933
79 Ga0070712_100169345 3300006175 Bacteria 1693
80 Ga0070712_100690274 3300006175 Bacteria 870
81 Ga0070712_101772251 3300006175 Bacteria 541
82 Ga0075433_10637613 3300006852 Bacteria 934
83 Ga0075433_11032576 3300006852 Bacteria 716
84 Ga0075434_100016157 3300006871 Bacteria 7173
85 Ga0068865_100477403 3300006881 Bacteria 1036
86 Ga0075436_100139283 3300006914 Bacteria 1704
87 Ga0075436_101371973 3300006914 Unclassified 535
88 Ga0075435_101611445 3300007076 Unclassified 569
89 Ga0105250_10046671 3300009092 Bacteria 1737
90 Ga0105245_11629897 3300009098 Unclassified 697
91 Ga0114129_10431432 3300009147 Bacteria 1731
92 Ga0114129_10803168 3300009147 Bacteria 1200
93 Ga0114129_12116872 3300009147 Unclassified 678
94 Ga0114129_13228510 3300009147 Bacteria 529
95 Ga0105243_11117133 3300009148 Bacteria 797
96 Ga0105243_12609490 3300009148 Unclassified 545
97 Ga0105241_10058937 3300009174 Bacteria 2950
98 Ga0105242_10426221 3300009176 Bacteria 1244
99 Ga0105242_11552822 3300009176 Unclassified 694
100 Ga0105249_10208918 3300009553 Bacteria 1914
101 Ga0105249_13341800 3300009553 Bacteria 516
102 Ga0105239_12715740 3300010375 Bacteria 578
103 Ga0157324_1064621 3300012506 Bacteria 509
104 Ga0157373_11032587 3300013100 Bacteria 614
105 Ga0157369_10058210 3300013105 Bacteria 4168
106 Ga0157374_11091311 3300013296 Bacteria 818
107 Ga0163162_10183398 3300013306 Bacteria 2219
108 Ga0157372_11422350 3300013307 Bacteria 799
109 Ga0157375_10254131 3300013308 Bacteria 1918
110 Ga0163163_11033080 3300014325 Bacteria 885
111 Ga0157380_11802516 3300014326 Unclassified 671
112 Ga0157377_10227670 3300014745 Bacteria 1197
113 Ga0157379_10808314 3300014968 Bacteria 885
114 Ga0157379_11096072 3300014968 Unclassified 762
115 Ga0207653_10102075 3300025885 Bacteria 1015
116 Ga0207653_10223934 3300025885 Bacteria 715
117 Ga0207692_10051344 3300025898 Bacteria 2091
118 Ga0207692_10200712 3300025898 Bacteria 1172
119 Ga0207688_10150712 3300025901 Bacteria 1373
120 Ga0207685_10001902 3300025905 Bacteria 4603
121 Ga0207699_10076619 3300025906 Bacteria 2061
122 Ga0207699_10179357 3300025906 Bacteria 1423
123 Ga0207699_10196824 3300025906 Bacteria 1363
124 Ga0207684_10015975 3300025910 Bacteria 6451
125 Ga0207684_10183307 3300025910 Bacteria 1806
126 Ga0207684_10535659 3300025910 Bacteria 1002
127 Ga0207684_11171678 3300025910 Bacteria 637
128 Ga0207671_10716844 3300025914 Bacteria 795
129 Ga0207693_10000736 3300025915 Bacteria 29488
130 Ga0207693_10002300 3300025915 Bacteria 16603
131 Ga0207693_10023376 3300025915 Bacteria 4908
132 Ga0207693_10249444 3300025915 Bacteria 1393
133 Ga0207663_10072547 3300025916 Bacteria 2225
134 Ga0207663_10551012 3300025916 Bacteria 901
135 Ga0207663_10983843 3300025916 Bacteria 676
136 Ga0207663_11667975 3300025916 Bacteria 513
137 Ga0207660_11439077 3300025917 Unclassified 558
138 Ga0207646_10003166 3300025922 Bacteria 18831
139 Ga0207646_10034340 3300025922 Bacteria 4583
140 Ga0207646_10329938 3300025922 Bacteria 1378
141 Ga0207646_10455942 3300025922 Bacteria 1153
142 Ga0207646_10532524 3300025922 Bacteria 1057
143 Ga0207687_10593374 3300025927 Bacteria 933
144 Ga0207700_10878479 3300025928 Bacteria 802
145 Ga0207700_10976300 3300025928 Unclassified 758
146 Ga0207664_10214336 3300025929 Bacteria 1667
147 Ga0207664_10559735 3300025929 Bacteria 1026
148 Ga0207644_11599088 3300025931 Bacteria 547
149 Ga0207690_10532686 3300025932 Bacteria 953
150 Ga0207706_10300745 3300025933 Bacteria 1398
151 Ga0207686_10166310 3300025934 Bacteria 1551
152 Ga0207686_10646636 3300025934 Bacteria 836
153 Ga0207709_10890103 3300025935 Unclassified 723
154 Ga0207704_11008618 3300025938 Bacteria 704
155 Ga0207665_10066426 3300025939 Bacteria 2455
156 Ga0207665_10094890 3300025939 Bacteria 2072
157 Ga0207651_10623131 3300025960 Bacteria 945
158 Ga0207712_10477875 3300025961 Bacteria 1062
159 Ga0207668_11291198 3300025972 Bacteria 657
160 Ga0207708_10355257 3300026075 Bacteria 1203
161 Ga0207702_11315859 3300026078 Bacteria 717
162 Ga0207675_100297782 3300026118 Bacteria 1570
163 Ga0207683_10032319 3300026121 Bacteria 4546
164 Ga0207683_11545757 3300026121 Bacteria 612
165 Ga0268265_10209428 3300028380 Bacteria 1698
166 Ga0268265_11226609 3300028380 Bacteria 748
167 Ga0265318_10039202 3300028577 Bacteria 1809
168 Ga0265338_10075984 3300028800 Bacteria 2848
169 Ga0265338_10192714 3300028800 Bacteria 1544
170 Ga0265338_10829142 3300028800 Bacteria 633
171 Ga0265340_10012074 3300031247 Bacteria 4568
172 Ga0265327_10016544 3300031251 Bacteria 4675
173 Ga0307408_100476227 3300031548 Bacteria 1088
174 Ga0265342_10477190 3300031712 Bacteria 638
175 Ga0307405_10632989 3300031731 Bacteria 877
176 Ga0307410_10345697 3300031852 Bacteria 1187
177 Ga0307406_10079625 3300031901 Bacteria 2173
178 Ga0307407_10350410 3300031903 Bacteria 1045
179 Ga0307412_10055778 3300031911 Bacteria 2630
180 Ga0307409_100053113 3300031995 Bacteria 3112
181 Ga0307416_100009793 3300032002 Bacteria 6297
182 Ga0307416_100224099 3300032002 Bacteria 1806
183 Ga0307415_100159310 3300032126 Bacteria 1747
184 Ga0307415_100210600 3300032126 Bacteria 1550
185 Ga0373948_0002417 3300034817 Bacteria 2755
186 Ga0373950_0004217 3300034818 Bacteria 2095
187 Ga0373959_0001786 3300034820 Bacteria 3433
188 Ga0373928_0010599 3300035084 Bacteria 1813
189 Ga0373929_0001624 3300035085 Bacteria 4265
190 Ga0373940_0002113 3300035088 Bacteria 3786
191 Ga0373949_0002604 3300035090 Bacteria 4569
192 Ga0373951_0001470 3300035091 Bacteria 6156
193 Ga0373932_0011134 3300035112 Bacteria 2191
194 Ga0373941_0005076 3300035115 Bacteria 3074
195 Ga0373960_0060710 3300035121 Bacteria 1146
196 Ga0373942_0001668 3300035207 Bacteria 5639
197 Ga0373961_0002793 3300035241 Bacteria 4455
198 Ga0373962_0007656 3300035242 Bacteria 2648
199 Ga0373931_0006635 3300035691 Bacteria 5419
200 Ga0395899_0005207 3300037312 Bacteria 10115
201 Ga0395899_0011261 3300037312 Bacteria 6852
202 Ga0395899_0027929 3300037312 Bacteria 4250
203 Ga0395899_0030927 3300037312 Bacteria 4025
204 Ga0395899_0036120 3300037312 Bacteria 3708
205 Ga0395899_0048068 3300037312 Bacteria 3176
206 Ga0395899_0098670 3300037312 Bacteria 2110
207 Ga0395899_0111713 3300037312 Bacteria 1964
208 Ga0395899_0177651 3300037312 Bacteria 1496
209 Ga0395900_0002349 3300037418 Bacteria 20946
210 Ga0395900_0007619 3300037418 Bacteria 11178
211 Ga0395900_0019394 3300037418 Bacteria 6936
212 Ga0395900_0025799 3300037418 Bacteria 6015
213 Ga0395900_0114698 3300037418 Bacteria 2765
214 Ga0395900_0201997 3300037418 Bacteria 2010
215 Ga0395900_0219428 3300037418 Bacteria 1917
216 Ga0395900_0236598 3300037418 Bacteria 1834
217 Ga0395900_0313323 3300037418 Bacteria 1552
218 Ga0395900_0331674 3300037418 Bacteria 1499
219 Ga0395900_0532076 3300037418 Bacteria 1122
220 Ga0395900_0750135 3300037418 Bacteria 906
221 Ga0395898_0000723 3300037466 Bacteria 58117
222 Ga0395898_0005448 3300037466 Bacteria 13753
223 Ga0395898_0043328 3300037466 Bacteria 4434
224 Ga0395898_0045451 3300037466 Bacteria 4316
225 Ga0395898_0231016 3300037466 Bacteria 1764
226 Ga0395898_0242086 3300037466 Bacteria 1720
227 Ga0395898_0243180 3300037466 Bacteria 1716
228 Ga0395898_0269538 3300037466 Bacteria 1624
229 Ga0395898_0629328 3300037466 Bacteria 1015
230 Ga0395898_1651048 3300037466 Bacteria 564
231 Ga0395905_0001388 3300037471 Bacteria 29372
232 Ga0395905_0006660 3300037471 Bacteria 11582
233 Ga0395905_0019330 3300037471 Bacteria 6459
234 Ga0395905_0060435 3300037471 Bacteria 3543
235 Ga0395905_0093504 3300037471 Bacteria 2820
236 Ga0395905_0164655 3300037471 Bacteria 2083
237 Ga0395905_0170286 3300037471 Bacteria 2045
238 Ga0395905_0239442 3300037471 Bacteria 1696
239 Ga0395905_1518323 3300037471 Unclassified 574
240 Ga0395901_0003745 3300038443 Bacteria 15320
241 Ga0395901_0006183 3300038443 Bacteria 12132
242 Ga0395901_0008786 3300038443 Bacteria 10221
243 Ga0395901_0032341 3300038443 Bacteria 5398
244 Ga0395901_0059041 3300038443 Bacteria 3990
245 Ga0395901_0066883 3300038443 Bacteria 3742
246 Ga0395901_0126932 3300038443 Bacteria 2680
247 Ga0395901_0241872 3300038443 Bacteria 1882
248 Ga0395901_0253014 3300038443 Bacteria 1835
249 Ga0395901_0271012 3300038443 Bacteria 1765
250 Ga0395901_0341347 3300038443 Bacteria 1547
251 Ga0395901_0448116 3300038443 Bacteria 1320
252 Ga0395901_0466207 3300038443 Bacteria 1290
253 Ga0451800_0229800 3300041459 Bacteria 2218
254 Ga0451807_0562377 3300041486 Unclassified 650
255 Ga0451835_0031221 3300041492 Bacteria 2483
256 Ga0451855_0752481 3300041511 Bacteria 2457
257 Ga0451853_0367494 3300041512 Bacteria 832
258 Ga0439434_0039960 3300042435 Bacteria 1440
259 Ga0495605_0368021 3300046474 Unclassified 601
260 Ga0495585_0075474 3300046492 Bacteria 1833
261 Ga0495585_0114173 3300046492 Bacteria 1434
262 Ga0495596_0097980 3300046500 Bacteria 1138
263 Ga0495637_0103057 3300046520 Bacteria 1113
264 Ga0495644_0031462 3300046523 Bacteria 2005
265 Ga0495663_0057101 3300046525 Bacteria 1221
266 Ga0495642_0034565 3300046528 Bacteria 2036
267 Ga0495642_0112125 3300046528 Bacteria 1167
268 Ga0495654_0394133 3300046530 Unclassified 551
269 Ga0495598_0015125 3300046537 Bacteria 1942
270 Ga0495598_0117053 3300046537 Bacteria 900
271 Ga0495598_0468241 3300046537 Bacteria 501
272 Ga0495609_0096319 3300046538 Bacteria 1284
273 Ga0495656_0292956 3300046615 Bacteria 832
274 Ga0495656_0525655 3300046615 Bacteria 629
275 Ga0495668_0434829 3300046616 Bacteria 722
276 Ga0495659_0241973 3300046664 Bacteria 750
277 Ga0495659_0289994 3300046664 Bacteria 689
278 Ga0495669_0669306 3300046684 Unclassified 505
279 Ga0495589_0180768 3300046794 Bacteria 1000
280 Ga0495589_0185777 3300046794 Bacteria 985
281 Ga0495589_0603893 3300046794 Bacteria 500
282 Ga0495677_0032461 3300047445 Bacteria 1902
283 Ga0496102_0399308 3300048905 Bacteria 1292
284 Ga0496102_0907960 3300048905 Bacteria 802
285 Ga0496103_0006371 3300048906 Bacteria 7049
286 Ga0496104_0010583 3300048907 Bacteria 8239
287 Ga0496105_0112337 3300048908 Bacteria 2248
288 Ga0496105_0188092 3300048908 Bacteria 1689
289 Ga0496106_0563011 3300048909 Bacteria 914
290 Ga0496107_0144182 3300048910 Bacteria 1760
291 Ga0496108_0012690 3300048911 Bacteria 6863
292 Ga0496108_0344356 3300048911 Bacteria 1300
293 Ga0496108_0442292 3300048911 Bacteria 1136
294 Ga0496108_0629306 3300048911 Bacteria 934
295 Ga0496109_0227682 3300048912 Bacteria 1753
296 Ga0496109_0303734 3300048912 Bacteria 1505
297 Ga0496109_1427853 3300048912 Bacteria 627
298 Ga0496110_0598757 3300048913 Bacteria 1000
299 Ga0496111_0058277 3300048914 Bacteria 2796
300 Ga0496112_0006011 3300048915 Bacteria 10594
301 Ga0496112_0229097 3300048915 Bacteria 1813
302 Ga0496112_0390236 3300048915 Bacteria 1332
303 Ga0496112_0532939 3300048915 Bacteria 1108
304 Ga0496113_0043368 3300048916 Bacteria 3328
305 Ga0496113_0364554 3300048916 Bacteria 1159
306 Ga0496114_0227711 3300048917 Bacteria 1637
307 Ga0496114_0722933 3300048917 Bacteria 872
308 Ga0496115_0198460 3300048918 Bacteria 1657
309 Ga0501076_1363856 3300049592 Bacteria 583
310 nmdc:mga05p37_153200_c1 3300050507 Bacteria 2818
311 nmdc:mga05p37_1656649_c1 3300050507 Bacteria 626
312 nmdc:mga05p37_195502_c1 3300050507 Bacteria 2453
313 nmdc:mga05p37_555453_c1 3300050507 Bacteria 1306
314 nmdc:mga0n895_2132608_c1 3300050512 Unclassified 517
315 nmdc:mga0n895_43618_c1 3300050512 Bacteria 4371
316 nmdc:mga0rr50_128029_c1 3300050513 Bacteria 2029
317 nmdc:mga0rr50_141533_c1 3300050513 Bacteria 1936
318 nmdc:mga08x19_283827_c1 3300050514 Bacteria 1148
319 nmdc:mga08x19_90420_c1 3300050514 Bacteria 2020
320 nmdc:mga0a205_85081_c1 3300050515 Bacteria 3055
321 nmdc:mga0a205_95032_c1 3300050515 Bacteria 2880

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10143920 Ga0070709_101439202 90
2 3300005436 Ga0070713_100127221 Ga0070713_1001272212 90
3 3300005437 Ga0070710_10184098 Ga0070710_101840982 90
4 3300005439 Ga0070711_100016040 Ga0070711_1000160403 90
5 3300005440 Ga0070705_100122311 Ga0070705_1001223112 90
6 3300005444 Ga0070694_100700443 Ga0070694_1007004432 90
7 3300005445 Ga0070708_100315096 Ga0070708_1003150962 90
8 3300005467 Ga0070706_100429445 Ga0070706_1004294452 90
9 3300005468 Ga0070707_100954285 Ga0070707_1009542852 90
10 3300005471 Ga0070698_100074158 Ga0070698_1000741583 90
11 3300005518 Ga0070699_100251296 Ga0070699_1002512962 90
12 3300005536 Ga0070697_100088344 Ga0070697_1000883442 90
13 3300005546 Ga0070696_100050509 Ga0070696_1000505093 90
14 3300006028 Ga0070717_10097683 Ga0070717_100976832 90
15 3300006163 Ga0070715_10034705 Ga0070715_100347052 90
16 3300006173 Ga0070716_100025863 Ga0070716_1000258633 90
17 3300006175 Ga0070712_100169345 Ga0070712_1001693452 90
18 3300025898 Ga0207692_10051344 Ga0207692_100513442 90
19 3300025906 Ga0207699_10076619 Ga0207699_100766192 90
20 3300025915 Ga0207693_10002300 Ga0207693_1000230011 90
21 3300025916 Ga0207663_10551012 Ga0207663_105510122 90
22 3300025922 Ga0207646_10329938 Ga0207646_103299382 90
23 3300025928 Ga0207700_10976300 Ga0207700_109763002 90
24 3300025929 Ga0207664_10559735 Ga0207664_105597352 90
25 3300025939 Ga0207665_10066426 Ga0207665_100664263 90
26 3300048911 Ga0496108_0344356 Ga0496108_0344356_726_1013 90
27 3300025914 Ga0207671_10716844 Ga0207671_107168442 93
28 3300013105 Ga0157369_10058210 Ga0157369_100582102 94
29 3300006852 Ga0075433_11032576 Ga0075433_110325762 95
30 3300013100 Ga0157373_11032587 Ga0157373_110325872 95
31 3300037418 Ga0395900_0114698 Ga0395900_0114698_1127_1414 95
32 3300038443 Ga0395901_0032341 Ga0395901_0032341_3975_4262 95
33 3300042435 Ga0439434_0039960 Ga0439434_0039960_340_627 95
34 3300037466 Ga0395898_0269538 Ga0395898_0269538_1264_1566 97
35 3300038443 Ga0395901_0253014 Ga0395901_0253014_1224_1526 97
36 3300048912 Ga0496109_1427853 Ga0496109_1427853_126_434 102
37 3300048915 Ga0496112_0006011 Ga0496112_0006011_1648_1956 102
38 3300048916 Ga0496113_0364554 Ga0496113_0364554_232_540 102
39 3300005337 Ga0070682_100606720 Ga0070682_1006067201 103
40 3300005435 Ga0070714_100936615 Ga0070714_1009366152 103
41 3300012506 Ga0157324_1064621 Ga0157324_10646211 103
42 3300026121 Ga0207683_11545757 Ga0207683_115457572 103
43 3300028800 Ga0265338_10829142 Ga0265338_108291421 103
44 3300031548 Ga0307408_100476227 Ga0307408_1004762272 103
45 3300031911 Ga0307412_10055778 Ga0307412_100557784 103
46 3300032002 Ga0307416_100224099 Ga0307416_1002240992 103
47 3300032126 Ga0307415_100210600 Ga0307415_1002106002 103
48 3300041459 Ga0451800_0229800 Ga0451800_0229800_245_556 103
49 3300041492 Ga0451835_0031221 Ga0451835_0031221_281_592 103
50 3300041511 Ga0451855_0752481 Ga0451855_0752481_1658_1969 103
51 3300048911 Ga0496108_0442292 Ga0496108_0442292_734_1045 103
52 3300049592 Ga0501076_1363856 Ga0501076_1363856_90_404 103
53 3300005336 Ga0070680_100718138 Ga0070680_1007181382 104
54 3300005435 Ga0070714_100045320 Ga0070714_1000453202 104
55 3300005436 Ga0070713_101096448 Ga0070713_1010964481 104
56 3300005439 Ga0070711_100620679 Ga0070711_1006206791 104
57 3300005468 Ga0070707_100334794 Ga0070707_1003347942 104
58 3300005468 Ga0070707_100739818 Ga0070707_1007398181 104
59 3300005471 Ga0070698_100502321 Ga0070698_1005023212 104
60 3300005518 Ga0070699_100441178 Ga0070699_1004411782 104
61 3300005545 Ga0070695_101523607 Ga0070695_1015236071 104
62 3300005937 Ga0081455_10045678 Ga0081455_100456782 104
63 3300005937 Ga0081455_10065700 Ga0081455_100657002 104
64 3300005981 Ga0081538_10030865 Ga0081538_100308653 104
65 3300005985 Ga0081539_10502013 Ga0081539_105020132 104
66 3300006028 Ga0070717_10830577 Ga0070717_108305772 104
67 3300006175 Ga0070712_100690274 Ga0070712_1006902742 104
68 3300006175 Ga0070712_101772251 Ga0070712_1017722512 104
69 3300009147 Ga0114129_10431432 Ga0114129_104314322 104
70 3300009147 Ga0114129_10803168 Ga0114129_108031682 104
71 3300009553 Ga0105249_13341800 Ga0105249_133418001 104
72 3300013296 Ga0157374_11091311 Ga0157374_110913112 104
73 3300014325 Ga0163163_11033080 Ga0163163_110330802 104
74 3300014326 Ga0157380_11802516 Ga0157380_118025161 104
75 3300014968 Ga0157379_10808314 Ga0157379_108083142 104
76 3300025906 Ga0207699_10179357 Ga0207699_101793572 104
77 3300025910 Ga0207684_10183307 Ga0207684_101833072 104
78 3300025910 Ga0207684_11171678 Ga0207684_111716782 104
79 3300025915 Ga0207693_10249444 Ga0207693_102494442 104
80 3300025916 Ga0207663_10983843 Ga0207663_109838432 104
81 3300025917 Ga0207660_11439077 Ga0207660_114390772 104
82 3300025922 Ga0207646_10034340 Ga0207646_100343401 104
83 3300025922 Ga0207646_10455942 Ga0207646_104559422 104
84 3300025928 Ga0207700_10878479 Ga0207700_108784792 104
85 3300025931 Ga0207644_11599088 Ga0207644_115990881 104
86 3300025933 Ga0207706_10300745 Ga0207706_103007452 104
87 3300028380 Ga0268265_11226609 Ga0268265_112266091 104
88 3300028800 Ga0265338_10192714 Ga0265338_101927142 104
89 3300031251 Ga0265327_10016544 Ga0265327_100165444 104
90 3300037312 Ga0395899_0005207 Ga0395899_0005207_2563_2877 104
91 3300037312 Ga0395899_0011261 Ga0395899_0011261_16_333 104
92 3300037312 Ga0395899_0027929 Ga0395899_0027929_425_739 104
93 3300037312 Ga0395899_0030927 Ga0395899_0030927_2383_2697 104
94 3300037312 Ga0395899_0036120 Ga0395899_0036120_1718_2035 104
95 3300037312 Ga0395899_0098670 Ga0395899_0098670_76_393 104
96 3300037312 Ga0395899_0111713 Ga0395899_0111713_514_828 104
97 3300037312 Ga0395899_0177651 Ga0395899_0177651_42_356 104
98 3300037418 Ga0395900_0002349 Ga0395900_0002349_18446_18760 104
99 3300037418 Ga0395900_0007619 Ga0395900_0007619_8716_9030 104
100 3300037418 Ga0395900_0019394 Ga0395900_0019394_2384_2698 104
101 3300037418 Ga0395900_0025799 Ga0395900_0025799_1292_1609 104
102 3300037418 Ga0395900_0201997 Ga0395900_0201997_1440_1757 104
103 3300037418 Ga0395900_0219428 Ga0395900_0219428_751_1065 104
104 3300037418 Ga0395900_0313323 Ga0395900_0313323_642_956 104
105 3300037418 Ga0395900_0331674 Ga0395900_0331674_204_518 104
106 3300037418 Ga0395900_0532076 Ga0395900_0532076_753_1067 104
107 3300037466 Ga0395898_0000723 Ga0395898_0000723_3306_3620 104
108 3300037466 Ga0395898_0005448 Ga0395898_0005448_7741_8055 104
109 3300037466 Ga0395898_0043328 Ga0395898_0043328_3761_4075 104
110 3300037466 Ga0395898_0045451 Ga0395898_0045451_2560_2877 104
111 3300037466 Ga0395898_0242086 Ga0395898_0242086_710_1027 104
112 3300037466 Ga0395898_0243180 Ga0395898_0243180_950_1264 104
113 3300037466 Ga0395898_0629328 Ga0395898_0629328_490_807 104
114 3300037466 Ga0395898_1651048 Ga0395898_1651048_65_379 104
115 3300037471 Ga0395905_0001388 Ga0395905_0001388_17796_18110 104
116 3300037471 Ga0395905_0006660 Ga0395905_0006660_8807_9121 104
117 3300037471 Ga0395905_0019330 Ga0395905_0019330_1202_1516 104
118 3300037471 Ga0395905_0060435 Ga0395905_0060435_2194_2508 104
119 3300037471 Ga0395905_0164655 Ga0395905_0164655_992_1309 104
120 3300037471 Ga0395905_0170286 Ga0395905_0170286_506_823 104
121 3300038443 Ga0395901_0003745 Ga0395901_0003745_5957_6271 104
122 3300038443 Ga0395901_0006183 Ga0395901_0006183_9632_9946 104
123 3300038443 Ga0395901_0008786 Ga0395901_0008786_4157_4471 104
124 3300038443 Ga0395901_0059041 Ga0395901_0059041_3268_3582 104
125 3300038443 Ga0395901_0066883 Ga0395901_0066883_1385_1699 104
126 3300038443 Ga0395901_0126932 Ga0395901_0126932_254_571 104
127 3300038443 Ga0395901_0271012 Ga0395901_0271012_1318_1635 104
128 3300038443 Ga0395901_0466207 Ga0395901_0466207_950_1264 104
129 3300041486 Ga0451807_0562377 Ga0451807_0562377_201_515 104
130 3300041512 Ga0451853_0367494 Ga0451853_0367494_22_336 104
131 3300046474 Ga0495605_0368021 Ga0495605_0368021_122_436 104
132 3300046492 Ga0495585_0075474 Ga0495585_0075474_720_1034 104
133 3300046492 Ga0495585_0114173 Ga0495585_0114173_91_405 104
134 3300046500 Ga0495596_0097980 Ga0495596_0097980_779_1093 104
135 3300046520 Ga0495637_0103057 Ga0495637_0103057_327_641 104
136 3300046523 Ga0495644_0031462 Ga0495644_0031462_1482_1796 104
137 3300046525 Ga0495663_0057101 Ga0495663_0057101_616_930 104
138 3300046528 Ga0495642_0034565 Ga0495642_0034565_181_495 104
139 3300046528 Ga0495642_0112125 Ga0495642_0112125_488_802 104
140 3300046530 Ga0495654_0394133 Ga0495654_0394133_170_484 104
141 3300046537 Ga0495598_0015125 Ga0495598_0015125_75_389 104
142 3300046537 Ga0495598_0117053 Ga0495598_0117053_265_579 104
143 3300046537 Ga0495598_0468241 Ga0495598_0468241_163_477 104
144 3300046538 Ga0495609_0096319 Ga0495609_0096319_846_1160 104
145 3300046615 Ga0495656_0292956 Ga0495656_0292956_488_802 104
146 3300046615 Ga0495656_0525655 Ga0495656_0525655_45_359 104
147 3300046616 Ga0495668_0434829 Ga0495668_0434829_355_669 104
148 3300046664 Ga0495659_0241973 Ga0495659_0241973_26_340 104
149 3300046664 Ga0495659_0289994 Ga0495659_0289994_353_667 104
150 3300046684 Ga0495669_0669306 Ga0495669_0669306_76_390 104
151 3300046794 Ga0495589_0180768 Ga0495589_0180768_56_370 104
152 3300046794 Ga0495589_0603893 Ga0495589_0603893_153_467 104
153 3300047445 Ga0495677_0032461 Ga0495677_0032461_996_1310 104
154 3300048905 Ga0496102_0907960 Ga0496102_0907960_20_337 104
155 3300048908 Ga0496105_0188092 Ga0496105_0188092_172_489 104
156 3300048911 Ga0496108_0629306 Ga0496108_0629306_541_861 104
157 3300048912 Ga0496109_0303734 Ga0496109_0303734_1122_1436 104
158 3300048913 Ga0496110_0598757 Ga0496110_0598757_371_685 104
159 3300048914 Ga0496111_0058277 Ga0496111_0058277_829_1146 104
160 3300048915 Ga0496112_0229097 Ga0496112_0229097_352_666 104
161 3300048917 Ga0496114_0722933 Ga0496114_0722933_267_584 104
162 3300050507 nmdc:mga05p37_1656649_c1 nmdc:mga05p37_1656649_c1_262_576 104
163 3300050507 nmdc:mga05p37_555453_c1 nmdc:mga05p37_555453_c1_234_548 104
164 3300005334 Ga0068869_100430081 Ga0068869_1004300812 105
165 3300005338 Ga0068868_100329667 Ga0068868_1003296672 105
166 3300005341 Ga0070691_10939463 Ga0070691_109394631 105
167 3300005345 Ga0070692_10402222 Ga0070692_104022222 105
168 3300005347 Ga0070668_102197835 Ga0070668_1021978351 105
169 3300005364 Ga0070673_100301455 Ga0070673_1003014552 105
170 3300005366 Ga0070659_100377275 Ga0070659_1003772752 105
171 3300005367 Ga0070667_101342897 Ga0070667_1013428971 105
172 3300005406 Ga0070703_10002960 Ga0070703_100029603 105
173 3300005434 Ga0070709_10198088 Ga0070709_101980882 105
174 3300005434 Ga0070709_10817186 Ga0070709_108171861 105
175 3300005435 Ga0070714_100029426 Ga0070714_1000294262 105
176 3300005438 Ga0070701_10253965 Ga0070701_102539652 105
177 3300005439 Ga0070711_100051431 Ga0070711_1000514312 105
178 3300005439 Ga0070711_100116982 Ga0070711_1001169822 105
179 3300005440 Ga0070705_100029902 Ga0070705_1000299022 105
180 3300005441 Ga0070700_100446687 Ga0070700_1004466871 105
181 3300005444 Ga0070694_100235736 Ga0070694_1002357362 105
182 3300005444 Ga0070694_101744579 Ga0070694_1017445791 105
183 3300005445 Ga0070708_100042943 Ga0070708_1000429432 105
184 3300005456 Ga0070678_101307880 Ga0070678_1013078801 105
185 3300005457 Ga0070662_100696903 Ga0070662_1006969032 105
186 3300005466 Ga0070685_10765956 Ga0070685_107659562 105
187 3300005467 Ga0070706_100031837 Ga0070706_1000318371 105
188 3300005467 Ga0070706_100053124 Ga0070706_1000531242 105
189 3300005468 Ga0070707_100013757 Ga0070707_1000137578 105
190 3300005468 Ga0070707_100175483 Ga0070707_1001754832 105
191 3300005468 Ga0070707_100543716 Ga0070707_1005437162 105
192 3300005518 Ga0070699_100036286 Ga0070699_1000362863 105
193 3300005518 Ga0070699_100087114 Ga0070699_1000871142 105
194 3300005518 Ga0070699_100613124 Ga0070699_1006131241 105
195 3300005545 Ga0070695_100151997 Ga0070695_1001519971 105
196 3300005545 Ga0070695_100211844 Ga0070695_1002118442 105
197 3300005546 Ga0070696_100008667 Ga0070696_1000086674 105
198 3300005546 Ga0070696_100986616 Ga0070696_1009866162 105
199 3300005549 Ga0070704_100014607 Ga0070704_1000146072 105
200 3300005563 Ga0068855_100861326 Ga0068855_1008613262 105
201 3300005615 Ga0070702_101240884 Ga0070702_1012408841 105
202 3300005719 Ga0068861_100957219 Ga0068861_1009572192 105
203 3300005844 Ga0068862_101708364 Ga0068862_1017083641 105
204 3300006058 Ga0075432_10135726 Ga0075432_101357262 105
205 3300006163 Ga0070715_10191618 Ga0070715_101916182 105
206 3300006173 Ga0070716_100014026 Ga0070716_1000140263 105
207 3300006173 Ga0070716_100188509 Ga0070716_1001885092 105
208 3300006173 Ga0070716_100931276 Ga0070716_1009312762 105
209 3300006175 Ga0070712_100015322 Ga0070712_1000153222 105
210 3300006852 Ga0075433_10637613 Ga0075433_106376132 105
211 3300006871 Ga0075434_100016157 Ga0075434_1000161572 105
212 3300006881 Ga0068865_100477403 Ga0068865_1004774032 105
213 3300006914 Ga0075436_100139283 Ga0075436_1001392832 105
214 3300006914 Ga0075436_101371973 Ga0075436_1013719732 105
215 3300007076 Ga0075435_101611445 Ga0075435_1016114452 105
216 3300009092 Ga0105250_10046671 Ga0105250_100466711 105
217 3300009098 Ga0105245_11629897 Ga0105245_116298972 105
218 3300009147 Ga0114129_12116872 Ga0114129_121168722 105
219 3300009147 Ga0114129_13228510 Ga0114129_132285102 105
220 3300009148 Ga0105243_11117133 Ga0105243_111171331 105
221 3300009148 Ga0105243_12609490 Ga0105243_126094902 105
222 3300009174 Ga0105241_10058937 Ga0105241_100589371 105
223 3300009176 Ga0105242_10426221 Ga0105242_104262212 105
224 3300009176 Ga0105242_11552822 Ga0105242_115528222 105
225 3300009553 Ga0105249_10208918 Ga0105249_102089182 105
226 3300010375 Ga0105239_12715740 Ga0105239_127157402 105
227 3300013306 Ga0163162_10183398 Ga0163162_101833982 105
228 3300013307 Ga0157372_11422350 Ga0157372_114223502 105
229 3300013308 Ga0157375_10254131 Ga0157375_102541312 105
230 3300014745 Ga0157377_10227670 Ga0157377_102276702 105
231 3300014968 Ga0157379_11096072 Ga0157379_110960722 105
232 3300025885 Ga0207653_10102075 Ga0207653_101020752 105
233 3300025885 Ga0207653_10223934 Ga0207653_102239341 105
234 3300025898 Ga0207692_10200712 Ga0207692_102007122 105
235 3300025901 Ga0207688_10150712 Ga0207688_101507122 105
236 3300025905 Ga0207685_10001902 Ga0207685_100019022 105
237 3300025906 Ga0207699_10196824 Ga0207699_101968241 105
238 3300025910 Ga0207684_10015975 Ga0207684_100159752 105
239 3300025910 Ga0207684_10535659 Ga0207684_105356592 105
240 3300025915 Ga0207693_10000736 Ga0207693_100007367 105
241 3300025915 Ga0207693_10023376 Ga0207693_100233763 105
242 3300025916 Ga0207663_10072547 Ga0207663_100725471 105
243 3300025916 Ga0207663_11667975 Ga0207663_116679751 105
244 3300025922 Ga0207646_10003166 Ga0207646_100031668 105
245 3300025922 Ga0207646_10532524 Ga0207646_105325241 105
246 3300025927 Ga0207687_10593374 Ga0207687_105933742 105
247 3300025929 Ga0207664_10214336 Ga0207664_102143362 105
248 3300025932 Ga0207690_10532686 Ga0207690_105326861 105
249 3300025934 Ga0207686_10166310 Ga0207686_101663102 105
250 3300025934 Ga0207686_10646636 Ga0207686_106466362 105
251 3300025935 Ga0207709_10890103 Ga0207709_108901032 105
252 3300025938 Ga0207704_11008618 Ga0207704_110086181 105
253 3300025939 Ga0207665_10094890 Ga0207665_100948902 105
254 3300025960 Ga0207651_10623131 Ga0207651_106231312 105
255 3300025961 Ga0207712_10477875 Ga0207712_104778752 105
256 3300025972 Ga0207668_11291198 Ga0207668_112911982 105
257 3300026075 Ga0207708_10355257 Ga0207708_103552571 105
258 3300026078 Ga0207702_11315859 Ga0207702_113158591 105
259 3300026118 Ga0207675_100297782 Ga0207675_1002977822 105
260 3300026121 Ga0207683_10032319 Ga0207683_100323193 105
261 3300028380 Ga0268265_10209428 Ga0268265_102094282 105
262 3300028577 Ga0265318_10039202 Ga0265318_100392022 105
263 3300028800 Ga0265338_10075984 Ga0265338_100759842 105
264 3300031247 Ga0265340_10012074 Ga0265340_100120742 105
265 3300031712 Ga0265342_10477190 Ga0265342_104771902 105
266 3300031731 Ga0307405_10632989 Ga0307405_106329892 105
267 3300031852 Ga0307410_10345697 Ga0307410_103456972 105
268 3300031901 Ga0307406_10079625 Ga0307406_100796252 105
269 3300031903 Ga0307407_10350410 Ga0307407_103504102 105
270 3300031995 Ga0307409_100053113 Ga0307409_1000531132 105
271 3300032002 Ga0307416_100009793 Ga0307416_1000097932 105
272 3300032126 Ga0307415_100159310 Ga0307415_1001593102 105
273 3300034817 Ga0373948_0002417 Ga0373948_0002417_2392_2718 105
274 3300034818 Ga0373950_0004217 Ga0373950_0004217_37_363 105
275 3300034820 Ga0373959_0001786 Ga0373959_0001786_630_956 105
276 3300035084 Ga0373928_0010599 Ga0373928_0010599_1221_1547 105
277 3300035085 Ga0373929_0001624 Ga0373929_0001624_1635_1961 105
278 3300035088 Ga0373940_0002113 Ga0373940_0002113_108_434 105
279 3300035090 Ga0373949_0002604 Ga0373949_0002604_126_452 105
280 3300035091 Ga0373951_0001470 Ga0373951_0001470_2540_2866 105
281 3300035112 Ga0373932_0011134 Ga0373932_0011134_88_414 105
282 3300035115 Ga0373941_0005076 Ga0373941_0005076_299_625 105
283 3300035121 Ga0373960_0060710 Ga0373960_0060710_619_945 105
284 3300035207 Ga0373942_0001668 Ga0373942_0001668_233_559 105
285 3300035241 Ga0373961_0002793 Ga0373961_0002793_3829_4155 105
286 3300035242 Ga0373962_0007656 Ga0373962_0007656_2154_2480 105
287 3300035691 Ga0373931_0006635 Ga0373931_0006635_747_1073 105
288 3300037312 Ga0395899_0048068 Ga0395899_0048068_229_555 105
289 3300037418 Ga0395900_0236598 Ga0395900_0236598_242_571 105
290 3300037418 Ga0395900_0750135 Ga0395900_0750135_399_725 105
291 3300037466 Ga0395898_0231016 Ga0395898_0231016_399_725 105
292 3300037471 Ga0395905_0093504 Ga0395905_0093504_2073_2399 105
293 3300037471 Ga0395905_0239442 Ga0395905_0239442_945_1274 105
294 3300037471 Ga0395905_1518323 Ga0395905_1518323_56_382 105
295 3300038443 Ga0395901_0241872 Ga0395901_0241872_1004_1330 105
296 3300038443 Ga0395901_0341347 Ga0395901_0341347_786_1115 105
297 3300038443 Ga0395901_0448116 Ga0395901_0448116_961_1287 105
298 3300046794 Ga0495589_0185777 Ga0495589_0185777_649_975 105
299 3300048905 Ga0496102_0399308 Ga0496102_0399308_623_949 105
300 3300048906 Ga0496103_0006371 Ga0496103_0006371_6692_7018 105
301 3300048907 Ga0496104_0010583 Ga0496104_0010583_3658_3984 105
302 3300048908 Ga0496105_0112337 Ga0496105_0112337_231_557 105
303 3300048909 Ga0496106_0563011 Ga0496106_0563011_189_506 105
304 3300048910 Ga0496107_0144182 Ga0496107_0144182_1276_1602 105
305 3300048911 Ga0496108_0012690 Ga0496108_0012690_97_423 105
306 3300048912 Ga0496109_0227682 Ga0496109_0227682_300_626 105
307 3300048915 Ga0496112_0390236 Ga0496112_0390236_740_1066 105
308 3300048915 Ga0496112_0532939 Ga0496112_0532939_164_490 105
309 3300048916 Ga0496113_0043368 Ga0496113_0043368_2786_3112 105
310 3300048917 Ga0496114_0227711 Ga0496114_0227711_184_510 105
311 3300048918 Ga0496115_0198460 Ga0496115_0198460_204_530 105
312 3300050507 nmdc:mga05p37_153200_c1 nmdc:mga05p37_153200_c1_897_1223 105
313 3300050507 nmdc:mga05p37_195502_c1 nmdc:mga05p37_195502_c1_2100_2426 105
314 3300050512 nmdc:mga0n895_2132608_c1 nmdc:mga0n895_2132608_c1_99_425 105
315 3300050512 nmdc:mga0n895_43618_c1 nmdc:mga0n895_43618_c1_99_425 105
316 3300050513 nmdc:mga0rr50_128029_c1 nmdc:mga0rr50_128029_c1_1605_1931 105
317 3300050513 nmdc:mga0rr50_141533_c1 nmdc:mga0rr50_141533_c1_1397_1723 105
318 3300050514 nmdc:mga08x19_283827_c1 nmdc:mga08x19_283827_c1_131_457 105
319 3300050514 nmdc:mga08x19_90420_c1 nmdc:mga08x19_90420_c1_1596_1922 105
320 3300050515 nmdc:mga0a205_85081_c1 nmdc:mga0a205_85081_c1_1007_1333 105
321 3300050515 nmdc:mga0a205_95032_c1 nmdc:mga0a205_95032_c1_225_551 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

19

105

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kd3-assembly1.cif.gz_B structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9307 12 103
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9114 12 103
5hs9-assembly1.cif.gz_A crystal structure of the quinone-bound yodb from b. subtilis 0.9067 10 103
5hs7-assembly1.cif.gz_A reduced form of the transcriptional regulator yodb from b. subtilis 0.8927 8 102
2f2e-assembly1.cif.gz_A crystal structure of pa1607, a putative transcription factor 0.8922 2 103
ID Description Score Start End Superfamily
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9388 13 103 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9067 10 103 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9053 20 83 1.10.10.10
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8919 15 103 1.10.10.10
5hs9B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8893 9 103 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W1LI86-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9827 7 101 GO:0003677
AF-A0A4V3D825-F1-model_v4 HxlR family transcriptional regulator 0.9764 5 103 GO:0003677
AF-A0A7W0PX62-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9755 17 101 GO:0003677
AF-A0A538A986-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9697 2 97 GO:0003677
AF-A0A087CGQ0-F1-model_v4 MarR family transcriptional regulator 0.9675 19 103 GO:0003677

Feature Viewer

pLDDT pTM Quality
92.08 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map