F405847

General Info

Members Datasets Scaffolds Average Seq Length
321 178 317 199

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100016225|Ga0070674_1000162253
Length 221
Sequence MSRLWAAEYARRMAANSDAAGGNGEGAPDAFLRAVEDLMSAPWRSELHVEELPAPQRIAPYSAAITADVIAGSEELGSGRFVLLHDPAGNNSWQGTFRCVTFARADIDPEMVTDPLLPSVGWSWLIDALESNDADYDAPSGTVTSVSSDSFGGMVSEPSRAEIEIRASWTPQLLADGSGLSPHLAGWAELLCTLAGLPPLPAGVVMMPSRRKPPSRSSRRH

Samples

Sample ID Description Type Environment
1 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
2 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
3 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
58 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
127 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
138 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
139 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
140 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
143 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.7
Metatranscriptomes 4.05
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.36
Rhizosphere 93.46
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10026809 3300002067 Bacteria 1730
2 JGI24735J21928_10070218 3300002067 Bacteria 1004
3 JGI25407J50210_10036894 3300003373 Bacteria 1257
4 Ga0070658_10000211 3300005327 Bacteria 51730
5 Ga0070658_10001256 3300005327 Bacteria 21729
6 Ga0070658_10063771 3300005327 Bacteria 3004
7 Ga0070658_10474343 3300005327 Bacteria 1079
8 Ga0070658_10540535 3300005327 Bacteria 1008
9 Ga0068869_100071281 3300005334 Bacteria 2573
10 Ga0068869_100231888 3300005334 Bacteria 1467
11 Ga0070666_10024369 3300005335 Bacteria 3941
12 Ga0070680_100002194 3300005336 Bacteria 14397
13 Ga0070680_100013555 3300005336 Bacteria 6353
14 Ga0070680_100101614 3300005336 Bacteria 2387
15 Ga0070680_100177930 3300005336 Bacteria 1791
16 Ga0070680_100222268 3300005336 Bacteria 1594
17 Ga0070680_100548249 3300005336 Bacteria 991
18 Ga0070680_100566579 3300005336 Unclassified 974
19 Ga0070682_100031966 3300005337 Bacteria 3187
20 Ga0070682_100262240 3300005337 Bacteria 1251
21 Ga0068868_100003436 3300005338 Bacteria 11031
22 Ga0068868_100189681 3300005338 Bacteria 1709
23 Ga0070660_100010562 3300005339 Bacteria 6524
24 Ga0070660_100050481 3300005339 Bacteria 3201
25 Ga0070660_100053803 3300005339 Bacteria 3106
26 Ga0070692_10023879 3300005345 Bacteria 3000
27 Ga0070668_100070207 3300005347 Bacteria 2726
28 Ga0070668_100431054 3300005347 Bacteria 1130
29 Ga0070675_100516007 3300005354 Bacteria 1078
30 Ga0070674_100016225 3300005356 Bacteria 4667
31 Ga0070674_100451484 3300005356 Bacteria 1061
32 Ga0070659_100000345 3300005366 Bacteria 35642
33 Ga0070659_100046783 3300005366 Bacteria 3392
34 Ga0070659_100283585 3300005366 Bacteria 1378
35 Ga0070659_100441371 3300005366 Bacteria 1103
36 Ga0070714_100000006 3300005435 Bacteria 293311
37 Ga0070714_100310912 3300005435 Bacteria 1471
38 Ga0070714_100877226 3300005435 Bacteria 871
39 Ga0070700_100000011 3300005441 Bacteria 173076
40 Ga0070678_100339124 3300005456 Bacteria 1289
41 Ga0070662_100014721 3300005457 Bacteria 5228
42 Ga0070681_10000253 3300005458 Bacteria 42312
43 Ga0070681_10017309 3300005458 Bacteria 7203
44 Ga0070681_10055441 3300005458 Bacteria 3946
45 Ga0070681_10126912 3300005458 Bacteria 2484
46 Ga0070681_10492381 3300005458 Unclassified 1139
47 Ga0070681_10498375 3300005458 Bacteria 1131
48 Ga0068867_100112198 3300005459 Bacteria 2096
49 Ga0070679_100000006 3300005530 Bacteria 203959
50 Ga0070679_100000620 3300005530 Bacteria 30190
51 Ga0070679_100004859 3300005530 Bacteria 12403
52 Ga0070679_100016522 3300005530 Bacteria 7124
53 Ga0070679_100066501 3300005530 Bacteria 3593
54 Ga0070684_100025432 3300005535 Bacteria 4976
55 Ga0070684_100166660 3300005535 Bacteria 2000
56 Ga0070684_100253127 3300005535 Bacteria 1610
57 Ga0070684_100450246 3300005535 Bacteria 1190
58 Ga0068853_100066444 3300005539 Bacteria 3132
59 Ga0070696_100215122 3300005546 Bacteria 1440
60 Ga0070665_100000583 3300005548 Bacteria 50878
61 Ga0068855_101484189 3300005563 Bacteria 697
62 Ga0068854_100530605 3300005578 Bacteria 995
63 Ga0068854_100799579 3300005578 Bacteria 822
64 Ga0068852_100588862 3300005616 Bacteria 1116
65 Ga0068852_101028992 3300005616 Bacteria 843
66 Ga0068866_10099765 3300005718 Bacteria 1600
67 Ga0068863_100000675 3300005841 Bacteria 34506
68 Ga0068860_100000214 3300005843 Bacteria 90752
69 Ga0068860_100190274 3300005843 Bacteria 1986
70 Ga0081455_10001195 3300005937 Bacteria 32533
71 Ga0081455_10002586 3300005937 Bacteria 21452
72 Ga0081455_10025081 3300005937 Bacteria 5510
73 Ga0081538_10000345 3300005981 Bacteria 53019
74 Ga0075432_10000136 3300006058 Bacteria 17018
75 Ga0075432_10002507 3300006058 Bacteria 6111
76 Ga0075428_100007594 3300006844 Bacteria 12017
77 Ga0075428_100020609 3300006844 Bacteria 7301
78 Ga0075430_100319964 3300006846 Bacteria 1282
79 Ga0075430_100336967 3300006846 Bacteria 1246
80 Ga0075431_100007883 3300006847 Bacteria 10611
81 Ga0075433_10005216 3300006852 Bacteria 10178
82 Ga0075433_10060765 3300006852 Bacteria 3309
83 Ga0075434_100000691 3300006871 Bacteria 26321
84 Ga0075434_100004539 3300006871 Bacteria 12535
85 Ga0068865_100005191 3300006881 Bacteria 7875
86 Ga0068865_100017156 3300006881 Bacteria 4651
87 Ga0075436_100004002 3300006914 Bacteria 10109
88 Ga0075435_100000613 3300007076 Bacteria 21900
89 Ga0075435_100003206 3300007076 Bacteria 11074
90 Ga0105240_10673637 3300009093 Bacteria 1132
91 Ga0105240_10787195 3300009093 Bacteria 1031
92 Ga0105240_10851473 3300009093 Bacteria 984
93 Ga0111539_10007208 3300009094 Bacteria 14250
94 Ga0111539_10036707 3300009094 Bacteria 5922
95 Ga0105245_10046969 3300009098 Bacteria 3859
96 Ga0105245_10172172 3300009098 Bacteria 2062
97 Ga0105245_10192602 3300009098 Bacteria 1954
98 Ga0105245_10791930 3300009098 Bacteria 986
99 Ga0105247_10495409 3300009101 Bacteria 889
100 Ga0114129_10037650 3300009147 Bacteria 6829
101 Ga0105243_10005653 3300009148 Bacteria 9730
102 Ga0105243_10137612 3300009148 Bacteria 2080
103 Ga0105242_10015174 3300009176 Bacteria 5982
104 Ga0105242_10019224 3300009176 Bacteria 5352
105 Ga0105237_10042562 3300009545 Bacteria 4579
106 Ga0105238_10225942 3300009551 Bacteria 1848
107 Ga0105238_10406559 3300009551 Bacteria 1355
108 Ga0105249_10045301 3300009553 Bacteria 4000
109 Ga0105249_10931474 3300009553 Bacteria 936
110 Ga0105239_10119717 3300010375 Bacteria 2922
111 Ga0157314_1005249 3300012500 Bacteria 979
112 Ga0157342_1007078 3300012507 Bacteria 1080
113 Ga0157370_10320643 3300013104 Unclassified 1429
114 Ga0157369_10001215 3300013105 Bacteria 32072
115 Ga0157369_10061063 3300013105 Bacteria 4064
116 Ga0157369_10368676 3300013105 Bacteria 1491
117 Ga0157369_10477779 3300013105 Unclassified 1290
118 Ga0157369_10506388 3300013105 Bacteria 1249
119 Ga0157369_10628676 3300013105 Unclassified 1108
120 Ga0157374_10538825 3300013296 Bacteria 1174
121 Ga0157378_10695523 3300013297 Bacteria 1036
122 Ga0163162_10029717 3300013306 Bacteria 5409
123 Ga0163162_10090825 3300013306 Bacteria 3136
124 Ga0157372_10000022 3300013307 Bacteria 206038
125 Ga0157372_10251826 3300013307 Bacteria 2050
126 Ga0157372_10605241 3300013307 Bacteria 1277
127 Ga0163163_10277096 3300014325 Bacteria 1728
128 Ga0157380_10180539 3300014326 Bacteria 1854
129 Ga0163161_10006400 3300017792 Bacteria 8156
130 Ga0163161_10075222 3300017792 Bacteria 2478
131 Ga0163161_10213352 3300017792 Bacteria 1492
132 Ga0197907_10222316 3300020069 Bacteria 4210
133 Ga0197907_11276795 3300020069 Bacteria 1150
134 Ga0197907_11297030 3300020069 Bacteria 2840
135 Ga0197907_11371458 3300020069 Bacteria 1757
136 Ga0206354_10019345 3300020081 Bacteria 1357
137 Ga0206354_11339550 3300020081 Bacteria 2864
138 Ga0206353_10269213 3300020082 Bacteria 1142
139 Ga0206353_10380358 3300020082 Bacteria 1563
140 Ga0206353_10407573 3300020082 Bacteria 14686
141 Ga0206353_10774631 3300020082 Bacteria 1168
142 Ga0206353_11104919 3300020082 Unclassified 1759
143 Ga0224712_10099574 3300022467 Bacteria 1230
144 Ga0224712_10376039 3300022467 Bacteria 674
145 Ga0207642_10008272 3300025899 Bacteria 3559
146 Ga0207688_10018909 3300025901 Bacteria 3748
147 Ga0207680_10011618 3300025903 Bacteria 4455
148 Ga0207647_10063153 3300025904 Bacteria 2253
149 Ga0207647_10169095 3300025904 Bacteria 1273
150 Ga0207705_10001002 3300025909 Bacteria 22949
151 Ga0207705_10009110 3300025909 Bacteria 7235
152 Ga0207705_10043295 3300025909 Bacteria 3234
153 Ga0207705_10381262 3300025909 Unclassified 1089
154 Ga0207707_10000646 3300025912 Bacteria 34453
155 Ga0207707_10000733 3300025912 Bacteria 32475
156 Ga0207707_10064426 3300025912 Bacteria 3190
157 Ga0207707_10257793 3300025912 Bacteria 1514
158 Ga0207707_10392284 3300025912 Bacteria 1192
159 Ga0207695_10557871 3300025913 Bacteria 1027
160 Ga0207671_10039215 3300025914 Bacteria 3508
161 Ga0207660_10018566 3300025917 Bacteria 4638
162 Ga0207660_10094445 3300025917 Bacteria 2223
163 Ga0207660_10105996 3300025917 Bacteria 2107
164 Ga0207660_10389084 3300025917 Bacteria 1122
165 Ga0207657_10027862 3300025919 Bacteria 5166
166 Ga0207657_10169344 3300025919 Bacteria 1770
167 Ga0207657_10178866 3300025919 Unclassified 1715
168 Ga0207652_10000012 3300025921 Bacteria 235382
169 Ga0207652_10012386 3300025921 Bacteria 6891
170 Ga0207652_10033692 3300025921 Bacteria 4314
171 Ga0207652_10048591 3300025921 Bacteria 3627
172 Ga0207652_10094508 3300025921 Bacteria 2632
173 Ga0207652_10614692 3300025921 Bacteria 974
174 Ga0207687_10079674 3300025927 Bacteria 2362
175 Ga0207687_10144341 3300025927 Bacteria 1809
176 Ga0207687_10436762 3300025927 Bacteria 1083
177 Ga0207700_10116954 3300025928 Bacteria 2155
178 Ga0207700_10835561 3300025928 Bacteria 824
179 Ga0207664_10000032 3300025929 Bacteria 179232
180 Ga0207690_10000396 3300025932 Bacteria 28762
181 Ga0207690_10030553 3300025932 Bacteria 3438
182 Ga0207690_10485537 3300025932 Bacteria 998
183 Ga0207706_10006731 3300025933 Bacteria 10626
184 Ga0207686_10009999 3300025934 Bacteria 5158
185 Ga0207669_10048370 3300025937 Bacteria 2526
186 Ga0207704_10110148 3300025938 Bacteria 1859
187 Ga0207689_10354001 3300025942 Bacteria 1221
188 Ga0207689_10684830 3300025942 Bacteria 864
189 Ga0207661_10116413 3300025944 Bacteria 2269
190 Ga0207667_10313377 3300025949 Bacteria 1603
191 Ga0207712_10024988 3300025961 Bacteria 3964
192 Ga0207668_10024801 3300025972 Bacteria 3875
193 Ga0207668_10173319 3300025972 Bacteria 1694
194 Ga0207640_10135772 3300025981 Bacteria 1785
195 Ga0207677_10145768 3300026023 Bacteria 1819
196 Ga0207703_10034916 3300026035 Bacteria 3994
197 Ga0207639_10358365 3300026041 Bacteria 1304
198 Ga0207678_10049326 3300026067 Bacteria 3638
199 Ga0207708_10000009 3300026075 Bacteria 235909
200 Ga0207641_10002292 3300026088 Bacteria 17819
201 Ga0207675_100016336 3300026118 Bacteria 6929
202 Ga0207675_100039675 3300026118 Bacteria 4394
203 Ga0207683_10531400 3300026121 Bacteria 1087
204 Ga0207698_10201802 3300026142 Bacteria 1781
205 Ga0207698_10550496 3300026142 Bacteria 1131
206 Ga0207428_10001525 3300027907 Bacteria 24188
207 Ga0207428_10001695 3300027907 Bacteria 22620
208 Ga0268266_10005006 3300028379 Bacteria 12517
209 Ga0268266_10796234 3300028379 Bacteria 913
210 Ga0268264_10000027 3300028381 Bacteria 440852
211 Ga0268264_10101147 3300028381 Bacteria 2505
212 Ga0307515_10172501 3300028794 Bacteria 2149
213 Ga0307408_100002326 3300031548 Bacteria 13452
214 Ga0316575_10031747 3300031665 Bacteria 2067
215 Ga0316576_10009042 3300031727 Bacteria 6407
216 Ga0316576_10014000 3300031727 Bacteria 5349
217 Ga0316578_10031062 3300031728 Bacteria 3041
218 Ga0316578_10227566 3300031728 Bacteria 1120
219 Ga0307405_10001218 3300031731 Bacteria 10690
220 Ga0316577_10020974 3300031733 Bacteria 3621
221 Ga0307413_10002389 3300031824 Bacteria 7626
222 Ga0307410_10003463 3300031852 Bacteria 7918
223 Ga0307410_10009695 3300031852 Bacteria 5416
224 Ga0307410_10521282 3300031852 Unclassified 981
225 Ga0307406_10002288 3300031901 Bacteria 10422
226 Ga0307407_10019682 3300031903 Bacteria 3441
227 Ga0307407_10171909 3300031903 Unclassified 1428
228 Ga0307412_10115363 3300031911 Unclassified 1925
229 Ga0307409_100000130 3300031995 Bacteria 28215
230 Ga0307409_100029471 3300031995 Bacteria 3928
231 Ga0307416_100000200 3300032002 Bacteria 31298
232 Ga0307416_100027506 3300032002 Bacteria 4213
233 Ga0307416_100258336 3300032002 Bacteria 1701
234 Ga0307416_100455415 3300032002 Bacteria 1333
235 Ga0307414_10004701 3300032004 Bacteria 7449
236 Ga0307414_10022442 3300032004 Bacteria 3981
237 Ga0307411_10002355 3300032005 Bacteria 8307
238 Ga0307411_10130990 3300032005 Bacteria 1833
239 Ga0307415_100000526 3300032126 Bacteria 16689
240 Ga0307415_100250955 3300032126 Bacteria 1437
241 Ga0316583_10007084 3300032133 Bacteria 4032
242 Ga0316580_10014947 3300032139 Bacteria 2372
243 Ga0316574_0017525 3300035398 Bacteria 4193
244 Ga0316574_0098004 3300035398 Bacteria 1874
245 Ga0373937_0283811 3300036401 Bacteria 1564
246 Ga0316584_0012587 3300036712 Bacteria 5970
247 Ga0316581_0009052 3300037588 Bacteria 2727
248 Ga0436365_1802072 3300039437 Bacteria 1902
249 Ga0436363_1460611 3300039450 Bacteria 1321
250 Ga0436362_1286520 3300039453 Bacteria 2041
251 Ga0451853_2162514 3300041512 Bacteria 1384
252 Ga0439448_0005056 3300042005 Bacteria 3747
253 Ga0439448_0031994 3300042005 Bacteria 1673
254 Ga0439448_0111294 3300042005 Unclassified 936
255 Ga0439450_027884 3300042008 Unclassified 1253
256 Ga0439455_0086796 3300042012 Bacteria 855
257 Ga0439463_045197 3300042016 Bacteria 1121
258 Ga0439444_0016737 3300042437 Bacteria 1251
259 Ga0439464_0006326 3300042439 Bacteria 3082
260 Ga0439460_0115555 3300042461 Unclassified 874
261 Ga0439440_0001677 3300042993 Bacteria 4070
262 Ga0439440_0006381 3300042993 Bacteria 2371
263 Ga0439440_0019589 3300042993 Bacteria 1511
264 Ga0439440_0051038 3300042993 Bacteria 1033
265 Ga0466969_0139049 3300044656 Bacteria 1123
266 Ga0466969_0232470 3300044656 Bacteria 837
267 Ga0466966_0046257 3300044684 Bacteria 2779
268 Ga0466966_0099781 3300044684 Bacteria 1796
269 Ga0466966_0159689 3300044684 Bacteria 1373
270 Ga0466961_0061658 3300044693 Bacteria 2383
271 Ga0466961_0083882 3300044693 Bacteria 2015
272 Ga0466961_0090543 3300044693 Bacteria 1932
273 Ga0466961_0114532 3300044693 Bacteria 1695
274 Ga0466963_0001518 3300044694 Bacteria 12562
275 Ga0466963_0014932 3300044694 Bacteria 4800
276 Ga0466971_0115647 3300044719 Bacteria 1240
277 Ga0466970_0451796 3300044765 Bacteria 737
278 Ga0466959_0178955 3300045049 Bacteria 1484
279 Ga0466959_0205335 3300045049 Bacteria 1371
280 Ga0466959_0295544 3300045049 Bacteria 1110
281 Ga0466958_0044621 3300045836 Bacteria 2672
282 Ga0466958_0147573 3300045836 Unclassified 1483
283 Ga0466967_0083346 3300045976 Bacteria 2891
284 Ga0466967_0148429 3300045976 Bacteria 2189
285 Ga0466967_0736857 3300045976 Bacteria 977
286 Ga0495631_0085967 3300046518 Bacteria 1355
287 Ga0495656_0027519 3300046615 Bacteria 2272
288 Ga0495657_0109805 3300046675 Bacteria 1749
289 Ga0495613_0195591 3300046689 Bacteria 1428
290 Ga0495670_0018245 3300046691 Bacteria 3455
291 Ga0495677_0056174 3300047445 Bacteria 1454
292 Ga0496101_0450802 3300048904 Bacteria 1015
293 Ga0496104_0803236 3300048907 Unclassified 847
294 Ga0496105_0138787 3300048908 Bacteria 2002
295 Ga0496108_0002210 3300048911 Bacteria 15576
296 Ga0496108_0131723 3300048911 Bacteria 2149
297 Ga0496109_0002634 3300048912 Bacteria 15048
298 Ga0496109_0108027 3300048912 Bacteria 2586
299 Ga0496110_0008379 3300048913 Bacteria 8317
300 Ga0496110_0025224 3300048913 Bacteria 5078
301 Ga0496111_0068747 3300048914 Bacteria 2575
302 Ga0496113_0003357 3300048916 Bacteria 9561
303 Ga0496113_0246462 3300048916 Bacteria 1426
304 Ga0496114_0043737 3300048917 Bacteria 3714
305 Ga0496115_0179671 3300048918 Bacteria 1750
306 Ga0496126_0000006 3300048929 Bacteria 798804
307 Ga0501034_0629985 3300049571 Bacteria 976
308 Ga0501070_1028000 3300049586 Bacteria 638
309 nmdc:mga0qj67_17178_c1 3300050509 Bacteria 5498
310 nmdc:mga06r32_27694_c1 3300050510 Bacteria 5297
311 nmdc:mga08y16_13487_c1 3300050511 Bacteria 8600
312 nmdc:mga08y16_42386_c1 3300050511 Bacteria 4768
313 nmdc:mga0n895_14852_c1 3300050512 Bacteria 7087
314 nmdc:mga0n895_15551_c1 3300050512 Bacteria 6944
315 nmdc:mga0rr50_3919_c1 3300050513 Bacteria 8657
316 nmdc:mga0a205_30542_c1 3300050515 Bacteria 5160
317 nmdc:mga0a205_8935_c2 3300050515 Bacteria 4858

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042005 Ga0439448_0111294 Ga0439448_0111294_357_881 156
2 3300036401 Ga0373937_0283811 Ga0373937_0283811_1053_1550 163
3 3300005337 Ga0070682_100031966 Ga0070682_1000319663 164
4 3300005356 Ga0070674_100451484 Ga0070674_1004514841 164
5 3300005366 Ga0070659_100046783 Ga0070659_1000467832 164
6 3300005459 Ga0068867_100112198 Ga0068867_1001121983 164
7 3300005539 Ga0068853_100066444 Ga0068853_1000664442 164
8 3300005937 Ga0081455_10002586 Ga0081455_100025869 164
9 3300006058 Ga0075432_10000136 Ga0075432_100001366 164
10 3300006844 Ga0075428_100020609 Ga0075428_1000206093 164
11 3300006846 Ga0075430_100319964 Ga0075430_1003199642 164
12 3300006847 Ga0075431_100007883 Ga0075431_1000078838 164
13 3300006852 Ga0075433_10005216 Ga0075433_100052164 164
14 3300006871 Ga0075434_100004539 Ga0075434_1000045395 164
15 3300006881 Ga0068865_100005191 Ga0068865_1000051911 164
16 3300006881 Ga0068865_100017156 Ga0068865_1000171563 164
17 3300007076 Ga0075435_100003206 Ga0075435_1000032067 164
18 3300017792 Ga0163161_10006400 Ga0163161_100064006 164
19 3300025901 Ga0207688_10018909 Ga0207688_100189093 164
20 3300025932 Ga0207690_10030553 Ga0207690_100305533 164
21 3300025933 Ga0207706_10006731 Ga0207706_100067316 164
22 3300025937 Ga0207669_10048370 Ga0207669_100483702 164
23 3300025938 Ga0207704_10110148 Ga0207704_101101482 164
24 3300025949 Ga0207667_10313377 Ga0207667_103133771 164
25 3300026041 Ga0207639_10358365 Ga0207639_103583652 164
26 3300026067 Ga0207678_10049326 Ga0207678_100493262 164
27 3300026118 Ga0207675_100039675 Ga0207675_1000396754 164
28 3300027907 Ga0207428_10001525 Ga0207428_1000152519 164
29 3300031852 Ga0307410_10521282 Ga0307410_105212822 164
30 3300032002 Ga0307416_100258336 Ga0307416_1002583362 164
31 3300045049 Ga0466959_0178955 Ga0466959_0178955_608_1204 164
32 3300006058 Ga0075432_10002507 Ga0075432_100025073 167
33 3300006852 Ga0075433_10060765 Ga0075433_100607652 167
34 3300006871 Ga0075434_100000691 Ga0075434_10000069120 167
35 3300006914 Ga0075436_100004002 Ga0075436_1000040026 167
36 3300007076 Ga0075435_100000613 Ga0075435_1000006133 167
37 3300009094 Ga0111539_10007208 Ga0111539_100072087 167
38 3300027907 Ga0207428_10001695 Ga0207428_1000169523 167
39 3300050511 nmdc:mga08y16_13487_c1 nmdc:mga08y16_13487_c1_5200_5826 167
40 3300050512 nmdc:mga0n895_15551_c1 nmdc:mga0n895_15551_c1_3702_4328 167
41 3300050515 nmdc:mga0a205_8935_c2 nmdc:mga0a205_8935_c2_982_1608 167
42 3300039437 Ga0436365_1802072 Ga0436365_1802072_470_1117 168
43 3300039450 Ga0436363_1460611 Ga0436363_1460611_158_805 168
44 3300039453 Ga0436362_1286520 Ga0436362_1286520_280_927 168
45 3300003373 JGI25407J50210_10036894 JGI25407J50210_100368941 169
46 3300005981 Ga0081538_10000345 Ga0081538_1000034530 169
47 3300044693 Ga0466961_0114532 Ga0466961_0114532_744_1340 169
48 3300005327 Ga0070658_10474343 Ga0070658_104743432 171
49 3300005339 Ga0070660_100053803 Ga0070660_1000538032 171
50 3300005366 Ga0070659_100441371 Ga0070659_1004413711 171
51 3300005435 Ga0070714_100877226 Ga0070714_1008772262 171
52 3300005535 Ga0070684_100025432 Ga0070684_1000254325 171
53 3300013105 Ga0157369_10628676 Ga0157369_106286762 171
54 3300025909 Ga0207705_10043295 Ga0207705_100432953 171
55 3300025919 Ga0207657_10169344 Ga0207657_101693442 171
56 3300025932 Ga0207690_10485537 Ga0207690_104855371 171
57 3300042005 Ga0439448_0031994 Ga0439448_0031994_754_1380 171
58 3300009545 Ga0105237_10042562 Ga0105237_100425625 173
59 3300025914 Ga0207671_10039215 Ga0207671_100392153 173
60 3300044656 Ga0466969_0232470 Ga0466969_0232470_11_538 175
61 3300005336 Ga0070680_100002194 Ga0070680_1000021945 176
62 3300005458 Ga0070681_10000253 Ga0070681_1000025311 176
63 3300005530 Ga0070679_100000006 Ga0070679_10000000638 176
64 3300005535 Ga0070684_100166660 Ga0070684_1001666602 176
65 3300025912 Ga0207707_10000646 Ga0207707_1000064622 176
66 3300025917 Ga0207660_10018566 Ga0207660_100185665 176
67 3300025921 Ga0207652_10000012 Ga0207652_10000012151 176
68 iso_pu_bacteria 2863067949 2863071895 177
69 iso_pu_bacteria 2866552031 2866553604 177
70 iso_pu_bacteria 8056207758 8056211459 177
71 3300005546 Ga0070696_100215122 Ga0070696_1002151222 178
72 3300028794 Ga0307515_10172501 Ga0307515_101725012 181
73 iso_pu_bacteria 2643221681 2644456840 181
74 3300005327 Ga0070658_10000211 Ga0070658_1000021120 182
75 3300005327 Ga0070658_10001256 Ga0070658_1000125612 182
76 3300005327 Ga0070658_10063771 Ga0070658_100637713 182
77 3300005336 Ga0070680_100013555 Ga0070680_1000135558 182
78 3300005336 Ga0070680_100101614 Ga0070680_1001016143 182
79 3300005336 Ga0070680_100177930 Ga0070680_1001779303 182
80 3300005336 Ga0070680_100222268 Ga0070680_1002222682 182
81 3300005339 Ga0070660_100010562 Ga0070660_1000105628 182
82 3300005366 Ga0070659_100283585 Ga0070659_1002835852 182
83 3300005456 Ga0070678_100339124 Ga0070678_1003391241 182
84 3300005458 Ga0070681_10017309 Ga0070681_100173094 182
85 3300005458 Ga0070681_10126912 Ga0070681_101269122 182
86 3300005458 Ga0070681_10492381 Ga0070681_104923811 182
87 3300005530 Ga0070679_100000620 Ga0070679_10000062024 182
88 3300005530 Ga0070679_100004859 Ga0070679_1000048598 182
89 3300005530 Ga0070679_100066501 Ga0070679_1000665013 182
90 3300005535 Ga0070684_100253127 Ga0070684_1002531272 182
91 3300005563 Ga0068855_101484189 Ga0068855_1014841891 182
92 3300009093 Ga0105240_10787195 Ga0105240_107871952 182
93 3300009098 Ga0105245_10172172 Ga0105245_101721722 182
94 3300009176 Ga0105242_10019224 Ga0105242_100192244 182
95 3300013105 Ga0157369_10001215 Ga0157369_1000121517 182
96 3300013105 Ga0157369_10506388 Ga0157369_105063882 182
97 3300013296 Ga0157374_10538825 Ga0157374_105388252 182
98 3300013297 Ga0157378_10695523 Ga0157378_106955231 182
99 3300013307 Ga0157372_10605241 Ga0157372_106052412 182
100 3300014325 Ga0163163_10277096 Ga0163163_102770962 182
101 3300020069 Ga0197907_10222316 Ga0197907_102223165 182
102 3300020069 Ga0197907_11297030 Ga0197907_112970303 182
103 3300020081 Ga0206354_11339550 Ga0206354_113395503 182
104 3300020082 Ga0206353_10407573 Ga0206353_104075736 182
105 3300020082 Ga0206353_11104919 Ga0206353_111049192 182
106 3300022467 Ga0224712_10376039 Ga0224712_103760391 182
107 3300025909 Ga0207705_10001002 Ga0207705_1000100213 182
108 3300025909 Ga0207705_10009110 Ga0207705_100091106 182
109 3300025909 Ga0207705_10381262 Ga0207705_103812622 182
110 3300025912 Ga0207707_10000733 Ga0207707_100007334 182
111 3300025912 Ga0207707_10064426 Ga0207707_100644262 182
112 3300025912 Ga0207707_10392284 Ga0207707_103922842 182
113 3300025913 Ga0207695_10557871 Ga0207695_105578712 182
114 3300025917 Ga0207660_10094445 Ga0207660_100944452 182
115 3300025917 Ga0207660_10105996 Ga0207660_101059962 182
116 3300025919 Ga0207657_10027862 Ga0207657_100278626 182
117 3300025919 Ga0207657_10178866 Ga0207657_101788662 182
118 3300025921 Ga0207652_10012386 Ga0207652_100123865 182
119 3300025921 Ga0207652_10048591 Ga0207652_100485912 182
120 3300025921 Ga0207652_10094508 Ga0207652_100945083 182
121 3300025927 Ga0207687_10144341 Ga0207687_101443412 182
122 3300044684 Ga0466966_0159689 Ga0466966_0159689_449_1048 182
123 3300044765 Ga0466970_0451796 Ga0466970_0451796_76_672 182
124 3300045049 Ga0466959_0295544 Ga0466959_0295544_146_742 182
125 3300046689 Ga0495613_0195591 Ga0495613_0195591_548_1147 182
126 3300048904 Ga0496101_0450802 Ga0496101_0450802_266_856 182
127 3300048907 Ga0496104_0803236 Ga0496104_0803236_128_727 182
128 3300048908 Ga0496105_0138787 Ga0496105_0138787_1061_1660 182
129 3300048911 Ga0496108_0131723 Ga0496108_0131723_885_1484 182
130 3300048912 Ga0496109_0108027 Ga0496109_0108027_402_1001 182
131 3300048913 Ga0496110_0008379 Ga0496110_0008379_848_1447 182
132 3300048914 Ga0496111_0068747 Ga0496111_0068747_645_1244 182
133 3300048918 Ga0496115_0179671 Ga0496115_0179671_124_714 182
134 3300049571 Ga0501034_0629985 Ga0501034_0629985_364_963 182
135 3300049586 Ga0501070_1028000 Ga0501070_1028000_20_619 182
136 3300005327 Ga0070658_10540535 Ga0070658_105405351 183
137 3300005336 Ga0070680_100548249 Ga0070680_1005482491 183
138 3300005336 Ga0070680_100566579 Ga0070680_1005665792 183
139 3300005339 Ga0070660_100050481 Ga0070660_1000504813 183
140 3300005345 Ga0070692_10023879 Ga0070692_100238792 183
141 3300005458 Ga0070681_10055441 Ga0070681_100554414 183
142 3300005458 Ga0070681_10498375 Ga0070681_104983752 183
143 3300005530 Ga0070679_100016522 Ga0070679_1000165223 183
144 3300005937 Ga0081455_10001195 Ga0081455_1000119524 183
145 3300005937 Ga0081455_10025081 Ga0081455_100250812 183
146 3300006844 Ga0075428_100007594 Ga0075428_1000075944 183
147 3300006846 Ga0075430_100336967 Ga0075430_1003369672 183
148 3300009098 Ga0105245_10791930 Ga0105245_107919301 183
149 3300013104 Ga0157370_10320643 Ga0157370_103206432 183
150 3300013105 Ga0157369_10061063 Ga0157369_100610633 183
151 3300013105 Ga0157369_10477779 Ga0157369_104777792 183
152 3300017792 Ga0163161_10213352 Ga0163161_102133522 183
153 3300020081 Ga0206354_10019345 Ga0206354_100193451 183
154 3300020082 Ga0206353_10380358 Ga0206353_103803581 183
155 3300020082 Ga0206353_10774631 Ga0206353_107746312 183
156 3300022467 Ga0224712_10099574 Ga0224712_100995742 183
157 3300025912 Ga0207707_10257793 Ga0207707_102577931 183
158 3300025917 Ga0207660_10389084 Ga0207660_103890842 183
159 3300025921 Ga0207652_10033692 Ga0207652_100336923 183
160 3300025921 Ga0207652_10614692 Ga0207652_106146922 183
161 3300025928 Ga0207700_10835561 Ga0207700_108355611 183
162 3300025932 Ga0207690_10000396 Ga0207690_100003968 183
163 3300026121 Ga0207683_10531400 Ga0207683_105314002 183
164 3300031665 Ga0316575_10031747 Ga0316575_100317473 183
165 3300031727 Ga0316576_10009042 Ga0316576_100090422 183
166 3300031727 Ga0316576_10014000 Ga0316576_100140002 183
167 3300031728 Ga0316578_10031062 Ga0316578_100310621 183
168 3300031728 Ga0316578_10227566 Ga0316578_102275662 183
169 3300031733 Ga0316577_10020974 Ga0316577_100209743 183
170 3300032002 Ga0307416_100455415 Ga0307416_1004554152 183
171 3300032133 Ga0316583_10007084 Ga0316583_100070843 183
172 3300032139 Ga0316580_10014947 Ga0316580_100149473 183
173 3300035398 Ga0316574_0017525 Ga0316574_0017525_3399_3998 183
174 3300035398 Ga0316574_0098004 Ga0316574_0098004_1080_1679 183
175 3300036712 Ga0316584_0012587 Ga0316584_0012587_3939_4538 183
176 3300037588 Ga0316581_0009052 Ga0316581_0009052_109_708 183
177 3300041512 Ga0451853_2162514 Ga0451853_2162514_331_918 183
178 3300042008 Ga0439450_027884 Ga0439450_027884_248_859 183
179 3300042439 Ga0439464_0006326 Ga0439464_0006326_1120_1731 183
180 3300042993 Ga0439440_0001677 Ga0439440_0001677_301_912 183
181 3300042993 Ga0439440_0006381 Ga0439440_0006381_403_1014 183
182 3300042993 Ga0439440_0051038 Ga0439440_0051038_254_865 183
183 3300044693 Ga0466961_0083882 Ga0466961_0083882_592_1200 183
184 3300044693 Ga0466961_0090543 Ga0466961_0090543_960_1577 183
185 3300045049 Ga0466959_0205335 Ga0466959_0205335_294_893 183
186 3300045836 Ga0466958_0147573 Ga0466958_0147573_582_1184 183
187 3300045976 Ga0466967_0736857 Ga0466967_0736857_152_760 183
188 3300046675 Ga0495657_0109805 Ga0495657_0109805_124_711 183
189 3300048911 Ga0496108_0002210 Ga0496108_0002210_10081_10668 183
190 3300048912 Ga0496109_0002634 Ga0496109_0002634_8722_9309 183
191 3300048913 Ga0496110_0025224 Ga0496110_0025224_3914_4501 183
192 3300048916 Ga0496113_0246462 Ga0496113_0246462_268_855 183
193 3300048917 Ga0496114_0043737 Ga0496114_0043737_1960_2547 183
194 3300005334 Ga0068869_100231888 Ga0068869_1002318882 184
195 3300005338 Ga0068868_100189681 Ga0068868_1001896812 184
196 3300005347 Ga0070668_100070207 Ga0070668_1000702072 184
197 3300005718 Ga0068866_10099765 Ga0068866_100997652 184
198 3300005843 Ga0068860_100190274 Ga0068860_1001902742 184
199 3300009094 Ga0111539_10036707 Ga0111539_100367074 184
200 3300009098 Ga0105245_10046969 Ga0105245_100469693 184
201 3300009147 Ga0114129_10037650 Ga0114129_100376502 184
202 3300009148 Ga0105243_10005653 Ga0105243_100056536 184
203 3300009148 Ga0105243_10137612 Ga0105243_101376122 184
204 3300009176 Ga0105242_10015174 Ga0105242_100151742 184
205 3300009551 Ga0105238_10406559 Ga0105238_104065592 184
206 3300009553 Ga0105249_10045301 Ga0105249_100453013 184
207 3300010375 Ga0105239_10119717 Ga0105239_101197172 184
208 3300012500 Ga0157314_1005249 Ga0157314_10052492 184
209 3300012507 Ga0157342_1007078 Ga0157342_10070781 184
210 3300013306 Ga0163162_10029717 Ga0163162_100297175 184
211 3300013306 Ga0163162_10090825 Ga0163162_100908252 184
212 3300013307 Ga0157372_10000022 Ga0157372_1000002280 184
213 3300013307 Ga0157372_10251826 Ga0157372_102518262 184
214 3300014326 Ga0157380_10180539 Ga0157380_101805392 184
215 3300017792 Ga0163161_10075222 Ga0163161_100752222 184
216 3300025899 Ga0207642_10008272 Ga0207642_100082722 184
217 3300025927 Ga0207687_10079674 Ga0207687_100796742 184
218 3300025942 Ga0207689_10354001 Ga0207689_103540012 184
219 3300025981 Ga0207640_10135772 Ga0207640_101357722 184
220 3300026023 Ga0207677_10145768 Ga0207677_101457682 184
221 3300026118 Ga0207675_100016336 Ga0207675_1000163366 184
222 3300026142 Ga0207698_10201802 Ga0207698_102018022 184
223 3300028381 Ga0268264_10101147 Ga0268264_101011472 184
224 3300031548 Ga0307408_100002326 Ga0307408_10000232613 184
225 3300031731 Ga0307405_10001218 Ga0307405_100012185 184
226 3300031824 Ga0307413_10002389 Ga0307413_100023894 184
227 3300031852 Ga0307410_10003463 Ga0307410_100034632 184
228 3300031852 Ga0307410_10009695 Ga0307410_100096953 184
229 3300031901 Ga0307406_10002288 Ga0307406_1000228810 184
230 3300031903 Ga0307407_10019682 Ga0307407_100196823 184
231 3300031903 Ga0307407_10171909 Ga0307407_101719092 184
232 3300031911 Ga0307412_10115363 Ga0307412_101153631 184
233 3300031995 Ga0307409_100000130 Ga0307409_10000013028 184
234 3300031995 Ga0307409_100029471 Ga0307409_1000294713 184
235 3300032002 Ga0307416_100000200 Ga0307416_1000002004 184
236 3300032002 Ga0307416_100027506 Ga0307416_1000275063 184
237 3300032004 Ga0307414_10004701 Ga0307414_100047015 184
238 3300032004 Ga0307414_10022442 Ga0307414_100224424 184
239 3300032005 Ga0307411_10002355 Ga0307411_1000235510 184
240 3300032005 Ga0307411_10130990 Ga0307411_101309902 184
241 3300032126 Ga0307415_100000526 Ga0307415_1000005264 184
242 3300032126 Ga0307415_100250955 Ga0307415_1002509551 184
243 3300042005 Ga0439448_0005056 Ga0439448_0005056_946_1572 184
244 3300042012 Ga0439455_0086796 Ga0439455_0086796_68_694 184
245 3300042016 Ga0439463_045197 Ga0439463_045197_185_811 184
246 3300042437 Ga0439444_0016737 Ga0439444_0016737_383_1009 184
247 3300042461 Ga0439460_0115555 Ga0439460_0115555_120_746 184
248 3300042993 Ga0439440_0019589 Ga0439440_0019589_760_1386 184
249 3300046518 Ga0495631_0085967 Ga0495631_0085967_63_692 184
250 3300046615 Ga0495656_0027519 Ga0495656_0027519_644_1273 184
251 3300047445 Ga0495677_0056174 Ga0495677_0056174_543_1172 184
252 3300050509 nmdc:mga0qj67_17178_c1 nmdc:mga0qj67_17178_c1_4407_5033 184
253 3300050510 nmdc:mga06r32_27694_c1 nmdc:mga06r32_27694_c1_725_1351 184
254 3300050511 nmdc:mga08y16_42386_c1 nmdc:mga08y16_42386_c1_1495_2121 184
255 3300050512 nmdc:mga0n895_14852_c1 nmdc:mga0n895_14852_c1_5046_5672 184
256 3300050513 nmdc:mga0rr50_3919_c1 nmdc:mga0rr50_3919_c1_5753_6379 184
257 3300050515 nmdc:mga0a205_30542_c1 nmdc:mga0a205_30542_c1_904_1530 184
258 3300020069 Ga0197907_11371458 Ga0197907_113714583 185
259 3300020082 Ga0206353_10269213 Ga0206353_102692132 185
260 3300002067 JGI24735J21928_10070218 JGI24735J21928_100702182 186
261 3300005535 Ga0070684_100450246 Ga0070684_1004502462 186
262 3300009093 Ga0105240_10673637 Ga0105240_106736372 186
263 3300013105 Ga0157369_10368676 Ga0157369_103686762 186
264 3300020069 Ga0197907_11276795 Ga0197907_112767952 186
265 3300025904 Ga0207647_10063153 Ga0207647_100631532 186
266 3300025944 Ga0207661_10116413 Ga0207661_101164133 186
267 3300044694 Ga0466963_0001518 Ga0466963_0001518_8423_9037 186
268 3300045836 Ga0466958_0044621 Ga0466958_0044621_334_948 186
269 3300045976 Ga0466967_0148429 Ga0466967_0148429_1401_2015 186
270 3300046691 Ga0495670_0018245 Ga0495670_0018245_173_805 187
271 3300048929 Ga0496126_0000006 Ga0496126_0000006_322300_322899 187
272 3300005334 Ga0068869_100071281 Ga0068869_1000712814 188
273 3300005338 Ga0068868_100003436 Ga0068868_1000034364 188
274 3300005366 Ga0070659_100000345 Ga0070659_1000003454 188
275 3300009093 Ga0105240_10851473 Ga0105240_108514732 188
276 3300009551 Ga0105238_10225942 Ga0105238_102259422 188
277 3300025942 Ga0207689_10684830 Ga0207689_106848301 188
278 3300048916 Ga0496113_0003357 Ga0496113_0003357_2380_3000 188
279 3300005354 Ga0070675_100516007 Ga0070675_1005160072 189
280 3300005356 Ga0070674_100016225 Ga0070674_1000162253 189
281 3300005457 Ga0070662_100014721 Ga0070662_1000147215 189
282 3300005578 Ga0068854_100530605 Ga0068854_1005306051 189
283 3300005616 Ga0068852_101028992 Ga0068852_1010289922 189
284 3300025934 Ga0207686_10009999 Ga0207686_100099995 189
285 3300025961 Ga0207712_10024988 Ga0207712_100249884 189
286 3300025972 Ga0207668_10173319 Ga0207668_101733191 189
287 3300044656 Ga0466969_0139049 Ga0466969_0139049_393_1007 189
288 3300025904 Ga0207647_10169095 Ga0207647_101690952 191
289 3300044694 Ga0466963_0014932 Ga0466963_0014932_2081_2695 192
290 3300044719 Ga0466971_0115647 Ga0466971_0115647_333_947 192
291 3300005435 Ga0070714_100310912 Ga0070714_1003109121 196
292 3300005578 Ga0068854_100799579 Ga0068854_1007995791 196
293 3300044684 Ga0466966_0046257 Ga0466966_0046257_1550_2182 196
294 3300044684 Ga0466966_0099781 Ga0466966_0099781_267_890 196
295 3300044693 Ga0466961_0061658 Ga0466961_0061658_823_1446 196
296 3300025928 Ga0207700_10116954 Ga0207700_101169542 197
297 3300005335 Ga0070666_10024369 Ga0070666_100243692 202
298 3300005347 Ga0070668_100431054 Ga0070668_1004310542 202
299 3300005441 Ga0070700_100000011 Ga0070700_10000001176 202
300 3300005548 Ga0070665_100000583 Ga0070665_10000058347 202
301 3300005841 Ga0068863_100000675 Ga0068863_10000067517 202
302 3300005843 Ga0068860_100000214 Ga0068860_10000021471 202
303 3300009101 Ga0105247_10495409 Ga0105247_104954091 202
304 3300009553 Ga0105249_10931474 Ga0105249_109314742 202
305 3300025903 Ga0207680_10011618 Ga0207680_100116185 202
306 3300025972 Ga0207668_10024801 Ga0207668_100248012 202
307 3300026035 Ga0207703_10034916 Ga0207703_100349162 202
308 3300026075 Ga0207708_10000009 Ga0207708_10000009197 202
309 3300026088 Ga0207641_10002292 Ga0207641_1000229217 202
310 3300028379 Ga0268266_10005006 Ga0268266_1000500612 202
311 3300028381 Ga0268264_10000027 Ga0268264_10000027195 202
312 3300002067 JGI24735J21928_10026809 JGI24735J21928_100268092 203
313 3300005337 Ga0070682_100262240 Ga0070682_1002622402 203
314 3300005435 Ga0070714_100000006 Ga0070714_100000006160 203
315 3300005616 Ga0068852_100588862 Ga0068852_1005888622 203
316 3300009098 Ga0105245_10192602 Ga0105245_101926021 203
317 3300025927 Ga0207687_10436762 Ga0207687_104367621 203
318 3300025929 Ga0207664_10000032 Ga0207664_1000003255 203
319 3300026142 Ga0207698_10550496 Ga0207698_105504961 203
320 3300028379 Ga0268266_10796234 Ga0268266_107962341 203
321 3300045976 Ga0466967_0083346 Ga0466967_0083346_553_1203 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11452

DUF3000

Protein of unknown function (DUF3000)

27

205

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bky-assembly1.cif.gz_A crystal structure of the alba1:alba2 heterodimer from sulfolobus solfataricus 0.6639 138 169
5mus-assembly1.cif.gz_B structure of the c-terminal domain of a reptarenavirus l protein 0.595 45 100
8i2f-assembly2.cif.gz_C crystal structure of bacillus subtilis lyte catalytic domain in complex with isea 0.5904 44 88
2ihw-assembly1.cif.gz_A crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), apo form 0.5586 138 190
1nfh-assembly1.cif.gz_B-2 structure of a sir2 substrate, alba, reveals a mechanism for deactylation-induced enhancement of dna-binding 0.5435 124 166
ID Description Score Start End Superfamily
af_O86317_22_202_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9096 25 198 3.30.1460.10
af_O86317_22_202_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.8711 25 198 3.30.1460.10
4f6aA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6927 62 98 3.40.630.30
af_F6PBY5_48_260_3.40.570.10 Alpha Beta;3-Layer(aba) Sandwich;Extracellular Endonuclease; Chain A;Extracellular Endonuclease, subunit A 0.6843 60 104 3.40.570.10
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.6418 117 158 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7G1NUW6-F1-model_v4 DUF3000 domain-containing protein 0.9521 24 196
AF-A0A7W9UTU0-F1-model_v4 DUF3000 domain-containing protein 0.949 24 197
AF-A0A2W6B1S7-F1-model_v4 DUF3000 domain-containing protein 0.948 21 203
AF-A0A7K0VWQ8-F1-model_v4 DUF3000 family protein 0.9479 23 143
AF-A0A7V9ITQ3-F1-model_v4 DUF3000 domain-containing protein 0.9471 24 201

Feature Viewer

pLDDT pTM Quality
86.01 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map