F405847
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 321 | 178 | 317 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_100016225|Ga0070674_1000162253 |
| Length | 221 |
| Sequence | MSRLWAAEYARRMAANSDAAGGNGEGAPDAFLRAVEDLMSAPWRSELHVEELPAPQRIAPYSAAITADVIAGSEELGSGRFVLLHDPAGNNSWQGTFRCVTFARADIDPEMVTDPLLPSVGWSWLIDALESNDADYDAPSGTVTSVSSDSFGGMVSEPSRAEIEIRASWTPQLLADGSGLSPHLAGWAELLCTLAGLPPLPAGVVMMPSRRKPPSRSSRRH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 2 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 3 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 37 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 58 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 112 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 113 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 116 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 117 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 118 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 119 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 120 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 122 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 123 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 124 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 125 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 126 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 127 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 128 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 129 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 131 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 132 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 133 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 134 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 135 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 136 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 137 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 138 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 139 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 140 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 141 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 142 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 143 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 144 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 145 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 146 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 147 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 148 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 149 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 150 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 151 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 161 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 162 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 166 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 167 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 168 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 169 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 170 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 178 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.7 |
| Metatranscriptomes | 4.05 |
| Isolates | 1.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.36 |
| Rhizosphere | 93.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10026809 | 3300002067 | Bacteria | 1730 |
| 2 | JGI24735J21928_10070218 | 3300002067 | Bacteria | 1004 |
| 3 | JGI25407J50210_10036894 | 3300003373 | Bacteria | 1257 |
| 4 | Ga0070658_10000211 | 3300005327 | Bacteria | 51730 |
| 5 | Ga0070658_10001256 | 3300005327 | Bacteria | 21729 |
| 6 | Ga0070658_10063771 | 3300005327 | Bacteria | 3004 |
| 7 | Ga0070658_10474343 | 3300005327 | Bacteria | 1079 |
| 8 | Ga0070658_10540535 | 3300005327 | Bacteria | 1008 |
| 9 | Ga0068869_100071281 | 3300005334 | Bacteria | 2573 |
| 10 | Ga0068869_100231888 | 3300005334 | Bacteria | 1467 |
| 11 | Ga0070666_10024369 | 3300005335 | Bacteria | 3941 |
| 12 | Ga0070680_100002194 | 3300005336 | Bacteria | 14397 |
| 13 | Ga0070680_100013555 | 3300005336 | Bacteria | 6353 |
| 14 | Ga0070680_100101614 | 3300005336 | Bacteria | 2387 |
| 15 | Ga0070680_100177930 | 3300005336 | Bacteria | 1791 |
| 16 | Ga0070680_100222268 | 3300005336 | Bacteria | 1594 |
| 17 | Ga0070680_100548249 | 3300005336 | Bacteria | 991 |
| 18 | Ga0070680_100566579 | 3300005336 | Unclassified | 974 |
| 19 | Ga0070682_100031966 | 3300005337 | Bacteria | 3187 |
| 20 | Ga0070682_100262240 | 3300005337 | Bacteria | 1251 |
| 21 | Ga0068868_100003436 | 3300005338 | Bacteria | 11031 |
| 22 | Ga0068868_100189681 | 3300005338 | Bacteria | 1709 |
| 23 | Ga0070660_100010562 | 3300005339 | Bacteria | 6524 |
| 24 | Ga0070660_100050481 | 3300005339 | Bacteria | 3201 |
| 25 | Ga0070660_100053803 | 3300005339 | Bacteria | 3106 |
| 26 | Ga0070692_10023879 | 3300005345 | Bacteria | 3000 |
| 27 | Ga0070668_100070207 | 3300005347 | Bacteria | 2726 |
| 28 | Ga0070668_100431054 | 3300005347 | Bacteria | 1130 |
| 29 | Ga0070675_100516007 | 3300005354 | Bacteria | 1078 |
| 30 | Ga0070674_100016225 | 3300005356 | Bacteria | 4667 |
| 31 | Ga0070674_100451484 | 3300005356 | Bacteria | 1061 |
| 32 | Ga0070659_100000345 | 3300005366 | Bacteria | 35642 |
| 33 | Ga0070659_100046783 | 3300005366 | Bacteria | 3392 |
| 34 | Ga0070659_100283585 | 3300005366 | Bacteria | 1378 |
| 35 | Ga0070659_100441371 | 3300005366 | Bacteria | 1103 |
| 36 | Ga0070714_100000006 | 3300005435 | Bacteria | 293311 |
| 37 | Ga0070714_100310912 | 3300005435 | Bacteria | 1471 |
| 38 | Ga0070714_100877226 | 3300005435 | Bacteria | 871 |
| 39 | Ga0070700_100000011 | 3300005441 | Bacteria | 173076 |
| 40 | Ga0070678_100339124 | 3300005456 | Bacteria | 1289 |
| 41 | Ga0070662_100014721 | 3300005457 | Bacteria | 5228 |
| 42 | Ga0070681_10000253 | 3300005458 | Bacteria | 42312 |
| 43 | Ga0070681_10017309 | 3300005458 | Bacteria | 7203 |
| 44 | Ga0070681_10055441 | 3300005458 | Bacteria | 3946 |
| 45 | Ga0070681_10126912 | 3300005458 | Bacteria | 2484 |
| 46 | Ga0070681_10492381 | 3300005458 | Unclassified | 1139 |
| 47 | Ga0070681_10498375 | 3300005458 | Bacteria | 1131 |
| 48 | Ga0068867_100112198 | 3300005459 | Bacteria | 2096 |
| 49 | Ga0070679_100000006 | 3300005530 | Bacteria | 203959 |
| 50 | Ga0070679_100000620 | 3300005530 | Bacteria | 30190 |
| 51 | Ga0070679_100004859 | 3300005530 | Bacteria | 12403 |
| 52 | Ga0070679_100016522 | 3300005530 | Bacteria | 7124 |
| 53 | Ga0070679_100066501 | 3300005530 | Bacteria | 3593 |
| 54 | Ga0070684_100025432 | 3300005535 | Bacteria | 4976 |
| 55 | Ga0070684_100166660 | 3300005535 | Bacteria | 2000 |
| 56 | Ga0070684_100253127 | 3300005535 | Bacteria | 1610 |
| 57 | Ga0070684_100450246 | 3300005535 | Bacteria | 1190 |
| 58 | Ga0068853_100066444 | 3300005539 | Bacteria | 3132 |
| 59 | Ga0070696_100215122 | 3300005546 | Bacteria | 1440 |
| 60 | Ga0070665_100000583 | 3300005548 | Bacteria | 50878 |
| 61 | Ga0068855_101484189 | 3300005563 | Bacteria | 697 |
| 62 | Ga0068854_100530605 | 3300005578 | Bacteria | 995 |
| 63 | Ga0068854_100799579 | 3300005578 | Bacteria | 822 |
| 64 | Ga0068852_100588862 | 3300005616 | Bacteria | 1116 |
| 65 | Ga0068852_101028992 | 3300005616 | Bacteria | 843 |
| 66 | Ga0068866_10099765 | 3300005718 | Bacteria | 1600 |
| 67 | Ga0068863_100000675 | 3300005841 | Bacteria | 34506 |
| 68 | Ga0068860_100000214 | 3300005843 | Bacteria | 90752 |
| 69 | Ga0068860_100190274 | 3300005843 | Bacteria | 1986 |
| 70 | Ga0081455_10001195 | 3300005937 | Bacteria | 32533 |
| 71 | Ga0081455_10002586 | 3300005937 | Bacteria | 21452 |
| 72 | Ga0081455_10025081 | 3300005937 | Bacteria | 5510 |
| 73 | Ga0081538_10000345 | 3300005981 | Bacteria | 53019 |
| 74 | Ga0075432_10000136 | 3300006058 | Bacteria | 17018 |
| 75 | Ga0075432_10002507 | 3300006058 | Bacteria | 6111 |
| 76 | Ga0075428_100007594 | 3300006844 | Bacteria | 12017 |
| 77 | Ga0075428_100020609 | 3300006844 | Bacteria | 7301 |
| 78 | Ga0075430_100319964 | 3300006846 | Bacteria | 1282 |
| 79 | Ga0075430_100336967 | 3300006846 | Bacteria | 1246 |
| 80 | Ga0075431_100007883 | 3300006847 | Bacteria | 10611 |
| 81 | Ga0075433_10005216 | 3300006852 | Bacteria | 10178 |
| 82 | Ga0075433_10060765 | 3300006852 | Bacteria | 3309 |
| 83 | Ga0075434_100000691 | 3300006871 | Bacteria | 26321 |
| 84 | Ga0075434_100004539 | 3300006871 | Bacteria | 12535 |
| 85 | Ga0068865_100005191 | 3300006881 | Bacteria | 7875 |
| 86 | Ga0068865_100017156 | 3300006881 | Bacteria | 4651 |
| 87 | Ga0075436_100004002 | 3300006914 | Bacteria | 10109 |
| 88 | Ga0075435_100000613 | 3300007076 | Bacteria | 21900 |
| 89 | Ga0075435_100003206 | 3300007076 | Bacteria | 11074 |
| 90 | Ga0105240_10673637 | 3300009093 | Bacteria | 1132 |
| 91 | Ga0105240_10787195 | 3300009093 | Bacteria | 1031 |
| 92 | Ga0105240_10851473 | 3300009093 | Bacteria | 984 |
| 93 | Ga0111539_10007208 | 3300009094 | Bacteria | 14250 |
| 94 | Ga0111539_10036707 | 3300009094 | Bacteria | 5922 |
| 95 | Ga0105245_10046969 | 3300009098 | Bacteria | 3859 |
| 96 | Ga0105245_10172172 | 3300009098 | Bacteria | 2062 |
| 97 | Ga0105245_10192602 | 3300009098 | Bacteria | 1954 |
| 98 | Ga0105245_10791930 | 3300009098 | Bacteria | 986 |
| 99 | Ga0105247_10495409 | 3300009101 | Bacteria | 889 |
| 100 | Ga0114129_10037650 | 3300009147 | Bacteria | 6829 |
| 101 | Ga0105243_10005653 | 3300009148 | Bacteria | 9730 |
| 102 | Ga0105243_10137612 | 3300009148 | Bacteria | 2080 |
| 103 | Ga0105242_10015174 | 3300009176 | Bacteria | 5982 |
| 104 | Ga0105242_10019224 | 3300009176 | Bacteria | 5352 |
| 105 | Ga0105237_10042562 | 3300009545 | Bacteria | 4579 |
| 106 | Ga0105238_10225942 | 3300009551 | Bacteria | 1848 |
| 107 | Ga0105238_10406559 | 3300009551 | Bacteria | 1355 |
| 108 | Ga0105249_10045301 | 3300009553 | Bacteria | 4000 |
| 109 | Ga0105249_10931474 | 3300009553 | Bacteria | 936 |
| 110 | Ga0105239_10119717 | 3300010375 | Bacteria | 2922 |
| 111 | Ga0157314_1005249 | 3300012500 | Bacteria | 979 |
| 112 | Ga0157342_1007078 | 3300012507 | Bacteria | 1080 |
| 113 | Ga0157370_10320643 | 3300013104 | Unclassified | 1429 |
| 114 | Ga0157369_10001215 | 3300013105 | Bacteria | 32072 |
| 115 | Ga0157369_10061063 | 3300013105 | Bacteria | 4064 |
| 116 | Ga0157369_10368676 | 3300013105 | Bacteria | 1491 |
| 117 | Ga0157369_10477779 | 3300013105 | Unclassified | 1290 |
| 118 | Ga0157369_10506388 | 3300013105 | Bacteria | 1249 |
| 119 | Ga0157369_10628676 | 3300013105 | Unclassified | 1108 |
| 120 | Ga0157374_10538825 | 3300013296 | Bacteria | 1174 |
| 121 | Ga0157378_10695523 | 3300013297 | Bacteria | 1036 |
| 122 | Ga0163162_10029717 | 3300013306 | Bacteria | 5409 |
| 123 | Ga0163162_10090825 | 3300013306 | Bacteria | 3136 |
| 124 | Ga0157372_10000022 | 3300013307 | Bacteria | 206038 |
| 125 | Ga0157372_10251826 | 3300013307 | Bacteria | 2050 |
| 126 | Ga0157372_10605241 | 3300013307 | Bacteria | 1277 |
| 127 | Ga0163163_10277096 | 3300014325 | Bacteria | 1728 |
| 128 | Ga0157380_10180539 | 3300014326 | Bacteria | 1854 |
| 129 | Ga0163161_10006400 | 3300017792 | Bacteria | 8156 |
| 130 | Ga0163161_10075222 | 3300017792 | Bacteria | 2478 |
| 131 | Ga0163161_10213352 | 3300017792 | Bacteria | 1492 |
| 132 | Ga0197907_10222316 | 3300020069 | Bacteria | 4210 |
| 133 | Ga0197907_11276795 | 3300020069 | Bacteria | 1150 |
| 134 | Ga0197907_11297030 | 3300020069 | Bacteria | 2840 |
| 135 | Ga0197907_11371458 | 3300020069 | Bacteria | 1757 |
| 136 | Ga0206354_10019345 | 3300020081 | Bacteria | 1357 |
| 137 | Ga0206354_11339550 | 3300020081 | Bacteria | 2864 |
| 138 | Ga0206353_10269213 | 3300020082 | Bacteria | 1142 |
| 139 | Ga0206353_10380358 | 3300020082 | Bacteria | 1563 |
| 140 | Ga0206353_10407573 | 3300020082 | Bacteria | 14686 |
| 141 | Ga0206353_10774631 | 3300020082 | Bacteria | 1168 |
| 142 | Ga0206353_11104919 | 3300020082 | Unclassified | 1759 |
| 143 | Ga0224712_10099574 | 3300022467 | Bacteria | 1230 |
| 144 | Ga0224712_10376039 | 3300022467 | Bacteria | 674 |
| 145 | Ga0207642_10008272 | 3300025899 | Bacteria | 3559 |
| 146 | Ga0207688_10018909 | 3300025901 | Bacteria | 3748 |
| 147 | Ga0207680_10011618 | 3300025903 | Bacteria | 4455 |
| 148 | Ga0207647_10063153 | 3300025904 | Bacteria | 2253 |
| 149 | Ga0207647_10169095 | 3300025904 | Bacteria | 1273 |
| 150 | Ga0207705_10001002 | 3300025909 | Bacteria | 22949 |
| 151 | Ga0207705_10009110 | 3300025909 | Bacteria | 7235 |
| 152 | Ga0207705_10043295 | 3300025909 | Bacteria | 3234 |
| 153 | Ga0207705_10381262 | 3300025909 | Unclassified | 1089 |
| 154 | Ga0207707_10000646 | 3300025912 | Bacteria | 34453 |
| 155 | Ga0207707_10000733 | 3300025912 | Bacteria | 32475 |
| 156 | Ga0207707_10064426 | 3300025912 | Bacteria | 3190 |
| 157 | Ga0207707_10257793 | 3300025912 | Bacteria | 1514 |
| 158 | Ga0207707_10392284 | 3300025912 | Bacteria | 1192 |
| 159 | Ga0207695_10557871 | 3300025913 | Bacteria | 1027 |
| 160 | Ga0207671_10039215 | 3300025914 | Bacteria | 3508 |
| 161 | Ga0207660_10018566 | 3300025917 | Bacteria | 4638 |
| 162 | Ga0207660_10094445 | 3300025917 | Bacteria | 2223 |
| 163 | Ga0207660_10105996 | 3300025917 | Bacteria | 2107 |
| 164 | Ga0207660_10389084 | 3300025917 | Bacteria | 1122 |
| 165 | Ga0207657_10027862 | 3300025919 | Bacteria | 5166 |
| 166 | Ga0207657_10169344 | 3300025919 | Bacteria | 1770 |
| 167 | Ga0207657_10178866 | 3300025919 | Unclassified | 1715 |
| 168 | Ga0207652_10000012 | 3300025921 | Bacteria | 235382 |
| 169 | Ga0207652_10012386 | 3300025921 | Bacteria | 6891 |
| 170 | Ga0207652_10033692 | 3300025921 | Bacteria | 4314 |
| 171 | Ga0207652_10048591 | 3300025921 | Bacteria | 3627 |
| 172 | Ga0207652_10094508 | 3300025921 | Bacteria | 2632 |
| 173 | Ga0207652_10614692 | 3300025921 | Bacteria | 974 |
| 174 | Ga0207687_10079674 | 3300025927 | Bacteria | 2362 |
| 175 | Ga0207687_10144341 | 3300025927 | Bacteria | 1809 |
| 176 | Ga0207687_10436762 | 3300025927 | Bacteria | 1083 |
| 177 | Ga0207700_10116954 | 3300025928 | Bacteria | 2155 |
| 178 | Ga0207700_10835561 | 3300025928 | Bacteria | 824 |
| 179 | Ga0207664_10000032 | 3300025929 | Bacteria | 179232 |
| 180 | Ga0207690_10000396 | 3300025932 | Bacteria | 28762 |
| 181 | Ga0207690_10030553 | 3300025932 | Bacteria | 3438 |
| 182 | Ga0207690_10485537 | 3300025932 | Bacteria | 998 |
| 183 | Ga0207706_10006731 | 3300025933 | Bacteria | 10626 |
| 184 | Ga0207686_10009999 | 3300025934 | Bacteria | 5158 |
| 185 | Ga0207669_10048370 | 3300025937 | Bacteria | 2526 |
| 186 | Ga0207704_10110148 | 3300025938 | Bacteria | 1859 |
| 187 | Ga0207689_10354001 | 3300025942 | Bacteria | 1221 |
| 188 | Ga0207689_10684830 | 3300025942 | Bacteria | 864 |
| 189 | Ga0207661_10116413 | 3300025944 | Bacteria | 2269 |
| 190 | Ga0207667_10313377 | 3300025949 | Bacteria | 1603 |
| 191 | Ga0207712_10024988 | 3300025961 | Bacteria | 3964 |
| 192 | Ga0207668_10024801 | 3300025972 | Bacteria | 3875 |
| 193 | Ga0207668_10173319 | 3300025972 | Bacteria | 1694 |
| 194 | Ga0207640_10135772 | 3300025981 | Bacteria | 1785 |
| 195 | Ga0207677_10145768 | 3300026023 | Bacteria | 1819 |
| 196 | Ga0207703_10034916 | 3300026035 | Bacteria | 3994 |
| 197 | Ga0207639_10358365 | 3300026041 | Bacteria | 1304 |
| 198 | Ga0207678_10049326 | 3300026067 | Bacteria | 3638 |
| 199 | Ga0207708_10000009 | 3300026075 | Bacteria | 235909 |
| 200 | Ga0207641_10002292 | 3300026088 | Bacteria | 17819 |
| 201 | Ga0207675_100016336 | 3300026118 | Bacteria | 6929 |
| 202 | Ga0207675_100039675 | 3300026118 | Bacteria | 4394 |
| 203 | Ga0207683_10531400 | 3300026121 | Bacteria | 1087 |
| 204 | Ga0207698_10201802 | 3300026142 | Bacteria | 1781 |
| 205 | Ga0207698_10550496 | 3300026142 | Bacteria | 1131 |
| 206 | Ga0207428_10001525 | 3300027907 | Bacteria | 24188 |
| 207 | Ga0207428_10001695 | 3300027907 | Bacteria | 22620 |
| 208 | Ga0268266_10005006 | 3300028379 | Bacteria | 12517 |
| 209 | Ga0268266_10796234 | 3300028379 | Bacteria | 913 |
| 210 | Ga0268264_10000027 | 3300028381 | Bacteria | 440852 |
| 211 | Ga0268264_10101147 | 3300028381 | Bacteria | 2505 |
| 212 | Ga0307515_10172501 | 3300028794 | Bacteria | 2149 |
| 213 | Ga0307408_100002326 | 3300031548 | Bacteria | 13452 |
| 214 | Ga0316575_10031747 | 3300031665 | Bacteria | 2067 |
| 215 | Ga0316576_10009042 | 3300031727 | Bacteria | 6407 |
| 216 | Ga0316576_10014000 | 3300031727 | Bacteria | 5349 |
| 217 | Ga0316578_10031062 | 3300031728 | Bacteria | 3041 |
| 218 | Ga0316578_10227566 | 3300031728 | Bacteria | 1120 |
| 219 | Ga0307405_10001218 | 3300031731 | Bacteria | 10690 |
| 220 | Ga0316577_10020974 | 3300031733 | Bacteria | 3621 |
| 221 | Ga0307413_10002389 | 3300031824 | Bacteria | 7626 |
| 222 | Ga0307410_10003463 | 3300031852 | Bacteria | 7918 |
| 223 | Ga0307410_10009695 | 3300031852 | Bacteria | 5416 |
| 224 | Ga0307410_10521282 | 3300031852 | Unclassified | 981 |
| 225 | Ga0307406_10002288 | 3300031901 | Bacteria | 10422 |
| 226 | Ga0307407_10019682 | 3300031903 | Bacteria | 3441 |
| 227 | Ga0307407_10171909 | 3300031903 | Unclassified | 1428 |
| 228 | Ga0307412_10115363 | 3300031911 | Unclassified | 1925 |
| 229 | Ga0307409_100000130 | 3300031995 | Bacteria | 28215 |
| 230 | Ga0307409_100029471 | 3300031995 | Bacteria | 3928 |
| 231 | Ga0307416_100000200 | 3300032002 | Bacteria | 31298 |
| 232 | Ga0307416_100027506 | 3300032002 | Bacteria | 4213 |
| 233 | Ga0307416_100258336 | 3300032002 | Bacteria | 1701 |
| 234 | Ga0307416_100455415 | 3300032002 | Bacteria | 1333 |
| 235 | Ga0307414_10004701 | 3300032004 | Bacteria | 7449 |
| 236 | Ga0307414_10022442 | 3300032004 | Bacteria | 3981 |
| 237 | Ga0307411_10002355 | 3300032005 | Bacteria | 8307 |
| 238 | Ga0307411_10130990 | 3300032005 | Bacteria | 1833 |
| 239 | Ga0307415_100000526 | 3300032126 | Bacteria | 16689 |
| 240 | Ga0307415_100250955 | 3300032126 | Bacteria | 1437 |
| 241 | Ga0316583_10007084 | 3300032133 | Bacteria | 4032 |
| 242 | Ga0316580_10014947 | 3300032139 | Bacteria | 2372 |
| 243 | Ga0316574_0017525 | 3300035398 | Bacteria | 4193 |
| 244 | Ga0316574_0098004 | 3300035398 | Bacteria | 1874 |
| 245 | Ga0373937_0283811 | 3300036401 | Bacteria | 1564 |
| 246 | Ga0316584_0012587 | 3300036712 | Bacteria | 5970 |
| 247 | Ga0316581_0009052 | 3300037588 | Bacteria | 2727 |
| 248 | Ga0436365_1802072 | 3300039437 | Bacteria | 1902 |
| 249 | Ga0436363_1460611 | 3300039450 | Bacteria | 1321 |
| 250 | Ga0436362_1286520 | 3300039453 | Bacteria | 2041 |
| 251 | Ga0451853_2162514 | 3300041512 | Bacteria | 1384 |
| 252 | Ga0439448_0005056 | 3300042005 | Bacteria | 3747 |
| 253 | Ga0439448_0031994 | 3300042005 | Bacteria | 1673 |
| 254 | Ga0439448_0111294 | 3300042005 | Unclassified | 936 |
| 255 | Ga0439450_027884 | 3300042008 | Unclassified | 1253 |
| 256 | Ga0439455_0086796 | 3300042012 | Bacteria | 855 |
| 257 | Ga0439463_045197 | 3300042016 | Bacteria | 1121 |
| 258 | Ga0439444_0016737 | 3300042437 | Bacteria | 1251 |
| 259 | Ga0439464_0006326 | 3300042439 | Bacteria | 3082 |
| 260 | Ga0439460_0115555 | 3300042461 | Unclassified | 874 |
| 261 | Ga0439440_0001677 | 3300042993 | Bacteria | 4070 |
| 262 | Ga0439440_0006381 | 3300042993 | Bacteria | 2371 |
| 263 | Ga0439440_0019589 | 3300042993 | Bacteria | 1511 |
| 264 | Ga0439440_0051038 | 3300042993 | Bacteria | 1033 |
| 265 | Ga0466969_0139049 | 3300044656 | Bacteria | 1123 |
| 266 | Ga0466969_0232470 | 3300044656 | Bacteria | 837 |
| 267 | Ga0466966_0046257 | 3300044684 | Bacteria | 2779 |
| 268 | Ga0466966_0099781 | 3300044684 | Bacteria | 1796 |
| 269 | Ga0466966_0159689 | 3300044684 | Bacteria | 1373 |
| 270 | Ga0466961_0061658 | 3300044693 | Bacteria | 2383 |
| 271 | Ga0466961_0083882 | 3300044693 | Bacteria | 2015 |
| 272 | Ga0466961_0090543 | 3300044693 | Bacteria | 1932 |
| 273 | Ga0466961_0114532 | 3300044693 | Bacteria | 1695 |
| 274 | Ga0466963_0001518 | 3300044694 | Bacteria | 12562 |
| 275 | Ga0466963_0014932 | 3300044694 | Bacteria | 4800 |
| 276 | Ga0466971_0115647 | 3300044719 | Bacteria | 1240 |
| 277 | Ga0466970_0451796 | 3300044765 | Bacteria | 737 |
| 278 | Ga0466959_0178955 | 3300045049 | Bacteria | 1484 |
| 279 | Ga0466959_0205335 | 3300045049 | Bacteria | 1371 |
| 280 | Ga0466959_0295544 | 3300045049 | Bacteria | 1110 |
| 281 | Ga0466958_0044621 | 3300045836 | Bacteria | 2672 |
| 282 | Ga0466958_0147573 | 3300045836 | Unclassified | 1483 |
| 283 | Ga0466967_0083346 | 3300045976 | Bacteria | 2891 |
| 284 | Ga0466967_0148429 | 3300045976 | Bacteria | 2189 |
| 285 | Ga0466967_0736857 | 3300045976 | Bacteria | 977 |
| 286 | Ga0495631_0085967 | 3300046518 | Bacteria | 1355 |
| 287 | Ga0495656_0027519 | 3300046615 | Bacteria | 2272 |
| 288 | Ga0495657_0109805 | 3300046675 | Bacteria | 1749 |
| 289 | Ga0495613_0195591 | 3300046689 | Bacteria | 1428 |
| 290 | Ga0495670_0018245 | 3300046691 | Bacteria | 3455 |
| 291 | Ga0495677_0056174 | 3300047445 | Bacteria | 1454 |
| 292 | Ga0496101_0450802 | 3300048904 | Bacteria | 1015 |
| 293 | Ga0496104_0803236 | 3300048907 | Unclassified | 847 |
| 294 | Ga0496105_0138787 | 3300048908 | Bacteria | 2002 |
| 295 | Ga0496108_0002210 | 3300048911 | Bacteria | 15576 |
| 296 | Ga0496108_0131723 | 3300048911 | Bacteria | 2149 |
| 297 | Ga0496109_0002634 | 3300048912 | Bacteria | 15048 |
| 298 | Ga0496109_0108027 | 3300048912 | Bacteria | 2586 |
| 299 | Ga0496110_0008379 | 3300048913 | Bacteria | 8317 |
| 300 | Ga0496110_0025224 | 3300048913 | Bacteria | 5078 |
| 301 | Ga0496111_0068747 | 3300048914 | Bacteria | 2575 |
| 302 | Ga0496113_0003357 | 3300048916 | Bacteria | 9561 |
| 303 | Ga0496113_0246462 | 3300048916 | Bacteria | 1426 |
| 304 | Ga0496114_0043737 | 3300048917 | Bacteria | 3714 |
| 305 | Ga0496115_0179671 | 3300048918 | Bacteria | 1750 |
| 306 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 307 | Ga0501034_0629985 | 3300049571 | Bacteria | 976 |
| 308 | Ga0501070_1028000 | 3300049586 | Bacteria | 638 |
| 309 | nmdc:mga0qj67_17178_c1 | 3300050509 | Bacteria | 5498 |
| 310 | nmdc:mga06r32_27694_c1 | 3300050510 | Bacteria | 5297 |
| 311 | nmdc:mga08y16_13487_c1 | 3300050511 | Bacteria | 8600 |
| 312 | nmdc:mga08y16_42386_c1 | 3300050511 | Bacteria | 4768 |
| 313 | nmdc:mga0n895_14852_c1 | 3300050512 | Bacteria | 7087 |
| 314 | nmdc:mga0n895_15551_c1 | 3300050512 | Bacteria | 6944 |
| 315 | nmdc:mga0rr50_3919_c1 | 3300050513 | Bacteria | 8657 |
| 316 | nmdc:mga0a205_30542_c1 | 3300050515 | Bacteria | 5160 |
| 317 | nmdc:mga0a205_8935_c2 | 3300050515 | Bacteria | 4858 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042005 | Ga0439448_0111294 | Ga0439448_0111294_357_881 | 156 |
| 2 | 3300036401 | Ga0373937_0283811 | Ga0373937_0283811_1053_1550 | 163 |
| 3 | 3300005337 | Ga0070682_100031966 | Ga0070682_1000319663 | 164 |
| 4 | 3300005356 | Ga0070674_100451484 | Ga0070674_1004514841 | 164 |
| 5 | 3300005366 | Ga0070659_100046783 | Ga0070659_1000467832 | 164 |
| 6 | 3300005459 | Ga0068867_100112198 | Ga0068867_1001121983 | 164 |
| 7 | 3300005539 | Ga0068853_100066444 | Ga0068853_1000664442 | 164 |
| 8 | 3300005937 | Ga0081455_10002586 | Ga0081455_100025869 | 164 |
| 9 | 3300006058 | Ga0075432_10000136 | Ga0075432_100001366 | 164 |
| 10 | 3300006844 | Ga0075428_100020609 | Ga0075428_1000206093 | 164 |
| 11 | 3300006846 | Ga0075430_100319964 | Ga0075430_1003199642 | 164 |
| 12 | 3300006847 | Ga0075431_100007883 | Ga0075431_1000078838 | 164 |
| 13 | 3300006852 | Ga0075433_10005216 | Ga0075433_100052164 | 164 |
| 14 | 3300006871 | Ga0075434_100004539 | Ga0075434_1000045395 | 164 |
| 15 | 3300006881 | Ga0068865_100005191 | Ga0068865_1000051911 | 164 |
| 16 | 3300006881 | Ga0068865_100017156 | Ga0068865_1000171563 | 164 |
| 17 | 3300007076 | Ga0075435_100003206 | Ga0075435_1000032067 | 164 |
| 18 | 3300017792 | Ga0163161_10006400 | Ga0163161_100064006 | 164 |
| 19 | 3300025901 | Ga0207688_10018909 | Ga0207688_100189093 | 164 |
| 20 | 3300025932 | Ga0207690_10030553 | Ga0207690_100305533 | 164 |
| 21 | 3300025933 | Ga0207706_10006731 | Ga0207706_100067316 | 164 |
| 22 | 3300025937 | Ga0207669_10048370 | Ga0207669_100483702 | 164 |
| 23 | 3300025938 | Ga0207704_10110148 | Ga0207704_101101482 | 164 |
| 24 | 3300025949 | Ga0207667_10313377 | Ga0207667_103133771 | 164 |
| 25 | 3300026041 | Ga0207639_10358365 | Ga0207639_103583652 | 164 |
| 26 | 3300026067 | Ga0207678_10049326 | Ga0207678_100493262 | 164 |
| 27 | 3300026118 | Ga0207675_100039675 | Ga0207675_1000396754 | 164 |
| 28 | 3300027907 | Ga0207428_10001525 | Ga0207428_1000152519 | 164 |
| 29 | 3300031852 | Ga0307410_10521282 | Ga0307410_105212822 | 164 |
| 30 | 3300032002 | Ga0307416_100258336 | Ga0307416_1002583362 | 164 |
| 31 | 3300045049 | Ga0466959_0178955 | Ga0466959_0178955_608_1204 | 164 |
| 32 | 3300006058 | Ga0075432_10002507 | Ga0075432_100025073 | 167 |
| 33 | 3300006852 | Ga0075433_10060765 | Ga0075433_100607652 | 167 |
| 34 | 3300006871 | Ga0075434_100000691 | Ga0075434_10000069120 | 167 |
| 35 | 3300006914 | Ga0075436_100004002 | Ga0075436_1000040026 | 167 |
| 36 | 3300007076 | Ga0075435_100000613 | Ga0075435_1000006133 | 167 |
| 37 | 3300009094 | Ga0111539_10007208 | Ga0111539_100072087 | 167 |
| 38 | 3300027907 | Ga0207428_10001695 | Ga0207428_1000169523 | 167 |
| 39 | 3300050511 | nmdc:mga08y16_13487_c1 | nmdc:mga08y16_13487_c1_5200_5826 | 167 |
| 40 | 3300050512 | nmdc:mga0n895_15551_c1 | nmdc:mga0n895_15551_c1_3702_4328 | 167 |
| 41 | 3300050515 | nmdc:mga0a205_8935_c2 | nmdc:mga0a205_8935_c2_982_1608 | 167 |
| 42 | 3300039437 | Ga0436365_1802072 | Ga0436365_1802072_470_1117 | 168 |
| 43 | 3300039450 | Ga0436363_1460611 | Ga0436363_1460611_158_805 | 168 |
| 44 | 3300039453 | Ga0436362_1286520 | Ga0436362_1286520_280_927 | 168 |
| 45 | 3300003373 | JGI25407J50210_10036894 | JGI25407J50210_100368941 | 169 |
| 46 | 3300005981 | Ga0081538_10000345 | Ga0081538_1000034530 | 169 |
| 47 | 3300044693 | Ga0466961_0114532 | Ga0466961_0114532_744_1340 | 169 |
| 48 | 3300005327 | Ga0070658_10474343 | Ga0070658_104743432 | 171 |
| 49 | 3300005339 | Ga0070660_100053803 | Ga0070660_1000538032 | 171 |
| 50 | 3300005366 | Ga0070659_100441371 | Ga0070659_1004413711 | 171 |
| 51 | 3300005435 | Ga0070714_100877226 | Ga0070714_1008772262 | 171 |
| 52 | 3300005535 | Ga0070684_100025432 | Ga0070684_1000254325 | 171 |
| 53 | 3300013105 | Ga0157369_10628676 | Ga0157369_106286762 | 171 |
| 54 | 3300025909 | Ga0207705_10043295 | Ga0207705_100432953 | 171 |
| 55 | 3300025919 | Ga0207657_10169344 | Ga0207657_101693442 | 171 |
| 56 | 3300025932 | Ga0207690_10485537 | Ga0207690_104855371 | 171 |
| 57 | 3300042005 | Ga0439448_0031994 | Ga0439448_0031994_754_1380 | 171 |
| 58 | 3300009545 | Ga0105237_10042562 | Ga0105237_100425625 | 173 |
| 59 | 3300025914 | Ga0207671_10039215 | Ga0207671_100392153 | 173 |
| 60 | 3300044656 | Ga0466969_0232470 | Ga0466969_0232470_11_538 | 175 |
| 61 | 3300005336 | Ga0070680_100002194 | Ga0070680_1000021945 | 176 |
| 62 | 3300005458 | Ga0070681_10000253 | Ga0070681_1000025311 | 176 |
| 63 | 3300005530 | Ga0070679_100000006 | Ga0070679_10000000638 | 176 |
| 64 | 3300005535 | Ga0070684_100166660 | Ga0070684_1001666602 | 176 |
| 65 | 3300025912 | Ga0207707_10000646 | Ga0207707_1000064622 | 176 |
| 66 | 3300025917 | Ga0207660_10018566 | Ga0207660_100185665 | 176 |
| 67 | 3300025921 | Ga0207652_10000012 | Ga0207652_10000012151 | 176 |
| 68 | iso_pu_bacteria | 2863067949 | 2863071895 | 177 |
| 69 | iso_pu_bacteria | 2866552031 | 2866553604 | 177 |
| 70 | iso_pu_bacteria | 8056207758 | 8056211459 | 177 |
| 71 | 3300005546 | Ga0070696_100215122 | Ga0070696_1002151222 | 178 |
| 72 | 3300028794 | Ga0307515_10172501 | Ga0307515_101725012 | 181 |
| 73 | iso_pu_bacteria | 2643221681 | 2644456840 | 181 |
| 74 | 3300005327 | Ga0070658_10000211 | Ga0070658_1000021120 | 182 |
| 75 | 3300005327 | Ga0070658_10001256 | Ga0070658_1000125612 | 182 |
| 76 | 3300005327 | Ga0070658_10063771 | Ga0070658_100637713 | 182 |
| 77 | 3300005336 | Ga0070680_100013555 | Ga0070680_1000135558 | 182 |
| 78 | 3300005336 | Ga0070680_100101614 | Ga0070680_1001016143 | 182 |
| 79 | 3300005336 | Ga0070680_100177930 | Ga0070680_1001779303 | 182 |
| 80 | 3300005336 | Ga0070680_100222268 | Ga0070680_1002222682 | 182 |
| 81 | 3300005339 | Ga0070660_100010562 | Ga0070660_1000105628 | 182 |
| 82 | 3300005366 | Ga0070659_100283585 | Ga0070659_1002835852 | 182 |
| 83 | 3300005456 | Ga0070678_100339124 | Ga0070678_1003391241 | 182 |
| 84 | 3300005458 | Ga0070681_10017309 | Ga0070681_100173094 | 182 |
| 85 | 3300005458 | Ga0070681_10126912 | Ga0070681_101269122 | 182 |
| 86 | 3300005458 | Ga0070681_10492381 | Ga0070681_104923811 | 182 |
| 87 | 3300005530 | Ga0070679_100000620 | Ga0070679_10000062024 | 182 |
| 88 | 3300005530 | Ga0070679_100004859 | Ga0070679_1000048598 | 182 |
| 89 | 3300005530 | Ga0070679_100066501 | Ga0070679_1000665013 | 182 |
| 90 | 3300005535 | Ga0070684_100253127 | Ga0070684_1002531272 | 182 |
| 91 | 3300005563 | Ga0068855_101484189 | Ga0068855_1014841891 | 182 |
| 92 | 3300009093 | Ga0105240_10787195 | Ga0105240_107871952 | 182 |
| 93 | 3300009098 | Ga0105245_10172172 | Ga0105245_101721722 | 182 |
| 94 | 3300009176 | Ga0105242_10019224 | Ga0105242_100192244 | 182 |
| 95 | 3300013105 | Ga0157369_10001215 | Ga0157369_1000121517 | 182 |
| 96 | 3300013105 | Ga0157369_10506388 | Ga0157369_105063882 | 182 |
| 97 | 3300013296 | Ga0157374_10538825 | Ga0157374_105388252 | 182 |
| 98 | 3300013297 | Ga0157378_10695523 | Ga0157378_106955231 | 182 |
| 99 | 3300013307 | Ga0157372_10605241 | Ga0157372_106052412 | 182 |
| 100 | 3300014325 | Ga0163163_10277096 | Ga0163163_102770962 | 182 |
| 101 | 3300020069 | Ga0197907_10222316 | Ga0197907_102223165 | 182 |
| 102 | 3300020069 | Ga0197907_11297030 | Ga0197907_112970303 | 182 |
| 103 | 3300020081 | Ga0206354_11339550 | Ga0206354_113395503 | 182 |
| 104 | 3300020082 | Ga0206353_10407573 | Ga0206353_104075736 | 182 |
| 105 | 3300020082 | Ga0206353_11104919 | Ga0206353_111049192 | 182 |
| 106 | 3300022467 | Ga0224712_10376039 | Ga0224712_103760391 | 182 |
| 107 | 3300025909 | Ga0207705_10001002 | Ga0207705_1000100213 | 182 |
| 108 | 3300025909 | Ga0207705_10009110 | Ga0207705_100091106 | 182 |
| 109 | 3300025909 | Ga0207705_10381262 | Ga0207705_103812622 | 182 |
| 110 | 3300025912 | Ga0207707_10000733 | Ga0207707_100007334 | 182 |
| 111 | 3300025912 | Ga0207707_10064426 | Ga0207707_100644262 | 182 |
| 112 | 3300025912 | Ga0207707_10392284 | Ga0207707_103922842 | 182 |
| 113 | 3300025913 | Ga0207695_10557871 | Ga0207695_105578712 | 182 |
| 114 | 3300025917 | Ga0207660_10094445 | Ga0207660_100944452 | 182 |
| 115 | 3300025917 | Ga0207660_10105996 | Ga0207660_101059962 | 182 |
| 116 | 3300025919 | Ga0207657_10027862 | Ga0207657_100278626 | 182 |
| 117 | 3300025919 | Ga0207657_10178866 | Ga0207657_101788662 | 182 |
| 118 | 3300025921 | Ga0207652_10012386 | Ga0207652_100123865 | 182 |
| 119 | 3300025921 | Ga0207652_10048591 | Ga0207652_100485912 | 182 |
| 120 | 3300025921 | Ga0207652_10094508 | Ga0207652_100945083 | 182 |
| 121 | 3300025927 | Ga0207687_10144341 | Ga0207687_101443412 | 182 |
| 122 | 3300044684 | Ga0466966_0159689 | Ga0466966_0159689_449_1048 | 182 |
| 123 | 3300044765 | Ga0466970_0451796 | Ga0466970_0451796_76_672 | 182 |
| 124 | 3300045049 | Ga0466959_0295544 | Ga0466959_0295544_146_742 | 182 |
| 125 | 3300046689 | Ga0495613_0195591 | Ga0495613_0195591_548_1147 | 182 |
| 126 | 3300048904 | Ga0496101_0450802 | Ga0496101_0450802_266_856 | 182 |
| 127 | 3300048907 | Ga0496104_0803236 | Ga0496104_0803236_128_727 | 182 |
| 128 | 3300048908 | Ga0496105_0138787 | Ga0496105_0138787_1061_1660 | 182 |
| 129 | 3300048911 | Ga0496108_0131723 | Ga0496108_0131723_885_1484 | 182 |
| 130 | 3300048912 | Ga0496109_0108027 | Ga0496109_0108027_402_1001 | 182 |
| 131 | 3300048913 | Ga0496110_0008379 | Ga0496110_0008379_848_1447 | 182 |
| 132 | 3300048914 | Ga0496111_0068747 | Ga0496111_0068747_645_1244 | 182 |
| 133 | 3300048918 | Ga0496115_0179671 | Ga0496115_0179671_124_714 | 182 |
| 134 | 3300049571 | Ga0501034_0629985 | Ga0501034_0629985_364_963 | 182 |
| 135 | 3300049586 | Ga0501070_1028000 | Ga0501070_1028000_20_619 | 182 |
| 136 | 3300005327 | Ga0070658_10540535 | Ga0070658_105405351 | 183 |
| 137 | 3300005336 | Ga0070680_100548249 | Ga0070680_1005482491 | 183 |
| 138 | 3300005336 | Ga0070680_100566579 | Ga0070680_1005665792 | 183 |
| 139 | 3300005339 | Ga0070660_100050481 | Ga0070660_1000504813 | 183 |
| 140 | 3300005345 | Ga0070692_10023879 | Ga0070692_100238792 | 183 |
| 141 | 3300005458 | Ga0070681_10055441 | Ga0070681_100554414 | 183 |
| 142 | 3300005458 | Ga0070681_10498375 | Ga0070681_104983752 | 183 |
| 143 | 3300005530 | Ga0070679_100016522 | Ga0070679_1000165223 | 183 |
| 144 | 3300005937 | Ga0081455_10001195 | Ga0081455_1000119524 | 183 |
| 145 | 3300005937 | Ga0081455_10025081 | Ga0081455_100250812 | 183 |
| 146 | 3300006844 | Ga0075428_100007594 | Ga0075428_1000075944 | 183 |
| 147 | 3300006846 | Ga0075430_100336967 | Ga0075430_1003369672 | 183 |
| 148 | 3300009098 | Ga0105245_10791930 | Ga0105245_107919301 | 183 |
| 149 | 3300013104 | Ga0157370_10320643 | Ga0157370_103206432 | 183 |
| 150 | 3300013105 | Ga0157369_10061063 | Ga0157369_100610633 | 183 |
| 151 | 3300013105 | Ga0157369_10477779 | Ga0157369_104777792 | 183 |
| 152 | 3300017792 | Ga0163161_10213352 | Ga0163161_102133522 | 183 |
| 153 | 3300020081 | Ga0206354_10019345 | Ga0206354_100193451 | 183 |
| 154 | 3300020082 | Ga0206353_10380358 | Ga0206353_103803581 | 183 |
| 155 | 3300020082 | Ga0206353_10774631 | Ga0206353_107746312 | 183 |
| 156 | 3300022467 | Ga0224712_10099574 | Ga0224712_100995742 | 183 |
| 157 | 3300025912 | Ga0207707_10257793 | Ga0207707_102577931 | 183 |
| 158 | 3300025917 | Ga0207660_10389084 | Ga0207660_103890842 | 183 |
| 159 | 3300025921 | Ga0207652_10033692 | Ga0207652_100336923 | 183 |
| 160 | 3300025921 | Ga0207652_10614692 | Ga0207652_106146922 | 183 |
| 161 | 3300025928 | Ga0207700_10835561 | Ga0207700_108355611 | 183 |
| 162 | 3300025932 | Ga0207690_10000396 | Ga0207690_100003968 | 183 |
| 163 | 3300026121 | Ga0207683_10531400 | Ga0207683_105314002 | 183 |
| 164 | 3300031665 | Ga0316575_10031747 | Ga0316575_100317473 | 183 |
| 165 | 3300031727 | Ga0316576_10009042 | Ga0316576_100090422 | 183 |
| 166 | 3300031727 | Ga0316576_10014000 | Ga0316576_100140002 | 183 |
| 167 | 3300031728 | Ga0316578_10031062 | Ga0316578_100310621 | 183 |
| 168 | 3300031728 | Ga0316578_10227566 | Ga0316578_102275662 | 183 |
| 169 | 3300031733 | Ga0316577_10020974 | Ga0316577_100209743 | 183 |
| 170 | 3300032002 | Ga0307416_100455415 | Ga0307416_1004554152 | 183 |
| 171 | 3300032133 | Ga0316583_10007084 | Ga0316583_100070843 | 183 |
| 172 | 3300032139 | Ga0316580_10014947 | Ga0316580_100149473 | 183 |
| 173 | 3300035398 | Ga0316574_0017525 | Ga0316574_0017525_3399_3998 | 183 |
| 174 | 3300035398 | Ga0316574_0098004 | Ga0316574_0098004_1080_1679 | 183 |
| 175 | 3300036712 | Ga0316584_0012587 | Ga0316584_0012587_3939_4538 | 183 |
| 176 | 3300037588 | Ga0316581_0009052 | Ga0316581_0009052_109_708 | 183 |
| 177 | 3300041512 | Ga0451853_2162514 | Ga0451853_2162514_331_918 | 183 |
| 178 | 3300042008 | Ga0439450_027884 | Ga0439450_027884_248_859 | 183 |
| 179 | 3300042439 | Ga0439464_0006326 | Ga0439464_0006326_1120_1731 | 183 |
| 180 | 3300042993 | Ga0439440_0001677 | Ga0439440_0001677_301_912 | 183 |
| 181 | 3300042993 | Ga0439440_0006381 | Ga0439440_0006381_403_1014 | 183 |
| 182 | 3300042993 | Ga0439440_0051038 | Ga0439440_0051038_254_865 | 183 |
| 183 | 3300044693 | Ga0466961_0083882 | Ga0466961_0083882_592_1200 | 183 |
| 184 | 3300044693 | Ga0466961_0090543 | Ga0466961_0090543_960_1577 | 183 |
| 185 | 3300045049 | Ga0466959_0205335 | Ga0466959_0205335_294_893 | 183 |
| 186 | 3300045836 | Ga0466958_0147573 | Ga0466958_0147573_582_1184 | 183 |
| 187 | 3300045976 | Ga0466967_0736857 | Ga0466967_0736857_152_760 | 183 |
| 188 | 3300046675 | Ga0495657_0109805 | Ga0495657_0109805_124_711 | 183 |
| 189 | 3300048911 | Ga0496108_0002210 | Ga0496108_0002210_10081_10668 | 183 |
| 190 | 3300048912 | Ga0496109_0002634 | Ga0496109_0002634_8722_9309 | 183 |
| 191 | 3300048913 | Ga0496110_0025224 | Ga0496110_0025224_3914_4501 | 183 |
| 192 | 3300048916 | Ga0496113_0246462 | Ga0496113_0246462_268_855 | 183 |
| 193 | 3300048917 | Ga0496114_0043737 | Ga0496114_0043737_1960_2547 | 183 |
| 194 | 3300005334 | Ga0068869_100231888 | Ga0068869_1002318882 | 184 |
| 195 | 3300005338 | Ga0068868_100189681 | Ga0068868_1001896812 | 184 |
| 196 | 3300005347 | Ga0070668_100070207 | Ga0070668_1000702072 | 184 |
| 197 | 3300005718 | Ga0068866_10099765 | Ga0068866_100997652 | 184 |
| 198 | 3300005843 | Ga0068860_100190274 | Ga0068860_1001902742 | 184 |
| 199 | 3300009094 | Ga0111539_10036707 | Ga0111539_100367074 | 184 |
| 200 | 3300009098 | Ga0105245_10046969 | Ga0105245_100469693 | 184 |
| 201 | 3300009147 | Ga0114129_10037650 | Ga0114129_100376502 | 184 |
| 202 | 3300009148 | Ga0105243_10005653 | Ga0105243_100056536 | 184 |
| 203 | 3300009148 | Ga0105243_10137612 | Ga0105243_101376122 | 184 |
| 204 | 3300009176 | Ga0105242_10015174 | Ga0105242_100151742 | 184 |
| 205 | 3300009551 | Ga0105238_10406559 | Ga0105238_104065592 | 184 |
| 206 | 3300009553 | Ga0105249_10045301 | Ga0105249_100453013 | 184 |
| 207 | 3300010375 | Ga0105239_10119717 | Ga0105239_101197172 | 184 |
| 208 | 3300012500 | Ga0157314_1005249 | Ga0157314_10052492 | 184 |
| 209 | 3300012507 | Ga0157342_1007078 | Ga0157342_10070781 | 184 |
| 210 | 3300013306 | Ga0163162_10029717 | Ga0163162_100297175 | 184 |
| 211 | 3300013306 | Ga0163162_10090825 | Ga0163162_100908252 | 184 |
| 212 | 3300013307 | Ga0157372_10000022 | Ga0157372_1000002280 | 184 |
| 213 | 3300013307 | Ga0157372_10251826 | Ga0157372_102518262 | 184 |
| 214 | 3300014326 | Ga0157380_10180539 | Ga0157380_101805392 | 184 |
| 215 | 3300017792 | Ga0163161_10075222 | Ga0163161_100752222 | 184 |
| 216 | 3300025899 | Ga0207642_10008272 | Ga0207642_100082722 | 184 |
| 217 | 3300025927 | Ga0207687_10079674 | Ga0207687_100796742 | 184 |
| 218 | 3300025942 | Ga0207689_10354001 | Ga0207689_103540012 | 184 |
| 219 | 3300025981 | Ga0207640_10135772 | Ga0207640_101357722 | 184 |
| 220 | 3300026023 | Ga0207677_10145768 | Ga0207677_101457682 | 184 |
| 221 | 3300026118 | Ga0207675_100016336 | Ga0207675_1000163366 | 184 |
| 222 | 3300026142 | Ga0207698_10201802 | Ga0207698_102018022 | 184 |
| 223 | 3300028381 | Ga0268264_10101147 | Ga0268264_101011472 | 184 |
| 224 | 3300031548 | Ga0307408_100002326 | Ga0307408_10000232613 | 184 |
| 225 | 3300031731 | Ga0307405_10001218 | Ga0307405_100012185 | 184 |
| 226 | 3300031824 | Ga0307413_10002389 | Ga0307413_100023894 | 184 |
| 227 | 3300031852 | Ga0307410_10003463 | Ga0307410_100034632 | 184 |
| 228 | 3300031852 | Ga0307410_10009695 | Ga0307410_100096953 | 184 |
| 229 | 3300031901 | Ga0307406_10002288 | Ga0307406_1000228810 | 184 |
| 230 | 3300031903 | Ga0307407_10019682 | Ga0307407_100196823 | 184 |
| 231 | 3300031903 | Ga0307407_10171909 | Ga0307407_101719092 | 184 |
| 232 | 3300031911 | Ga0307412_10115363 | Ga0307412_101153631 | 184 |
| 233 | 3300031995 | Ga0307409_100000130 | Ga0307409_10000013028 | 184 |
| 234 | 3300031995 | Ga0307409_100029471 | Ga0307409_1000294713 | 184 |
| 235 | 3300032002 | Ga0307416_100000200 | Ga0307416_1000002004 | 184 |
| 236 | 3300032002 | Ga0307416_100027506 | Ga0307416_1000275063 | 184 |
| 237 | 3300032004 | Ga0307414_10004701 | Ga0307414_100047015 | 184 |
| 238 | 3300032004 | Ga0307414_10022442 | Ga0307414_100224424 | 184 |
| 239 | 3300032005 | Ga0307411_10002355 | Ga0307411_1000235510 | 184 |
| 240 | 3300032005 | Ga0307411_10130990 | Ga0307411_101309902 | 184 |
| 241 | 3300032126 | Ga0307415_100000526 | Ga0307415_1000005264 | 184 |
| 242 | 3300032126 | Ga0307415_100250955 | Ga0307415_1002509551 | 184 |
| 243 | 3300042005 | Ga0439448_0005056 | Ga0439448_0005056_946_1572 | 184 |
| 244 | 3300042012 | Ga0439455_0086796 | Ga0439455_0086796_68_694 | 184 |
| 245 | 3300042016 | Ga0439463_045197 | Ga0439463_045197_185_811 | 184 |
| 246 | 3300042437 | Ga0439444_0016737 | Ga0439444_0016737_383_1009 | 184 |
| 247 | 3300042461 | Ga0439460_0115555 | Ga0439460_0115555_120_746 | 184 |
| 248 | 3300042993 | Ga0439440_0019589 | Ga0439440_0019589_760_1386 | 184 |
| 249 | 3300046518 | Ga0495631_0085967 | Ga0495631_0085967_63_692 | 184 |
| 250 | 3300046615 | Ga0495656_0027519 | Ga0495656_0027519_644_1273 | 184 |
| 251 | 3300047445 | Ga0495677_0056174 | Ga0495677_0056174_543_1172 | 184 |
| 252 | 3300050509 | nmdc:mga0qj67_17178_c1 | nmdc:mga0qj67_17178_c1_4407_5033 | 184 |
| 253 | 3300050510 | nmdc:mga06r32_27694_c1 | nmdc:mga06r32_27694_c1_725_1351 | 184 |
| 254 | 3300050511 | nmdc:mga08y16_42386_c1 | nmdc:mga08y16_42386_c1_1495_2121 | 184 |
| 255 | 3300050512 | nmdc:mga0n895_14852_c1 | nmdc:mga0n895_14852_c1_5046_5672 | 184 |
| 256 | 3300050513 | nmdc:mga0rr50_3919_c1 | nmdc:mga0rr50_3919_c1_5753_6379 | 184 |
| 257 | 3300050515 | nmdc:mga0a205_30542_c1 | nmdc:mga0a205_30542_c1_904_1530 | 184 |
| 258 | 3300020069 | Ga0197907_11371458 | Ga0197907_113714583 | 185 |
| 259 | 3300020082 | Ga0206353_10269213 | Ga0206353_102692132 | 185 |
| 260 | 3300002067 | JGI24735J21928_10070218 | JGI24735J21928_100702182 | 186 |
| 261 | 3300005535 | Ga0070684_100450246 | Ga0070684_1004502462 | 186 |
| 262 | 3300009093 | Ga0105240_10673637 | Ga0105240_106736372 | 186 |
| 263 | 3300013105 | Ga0157369_10368676 | Ga0157369_103686762 | 186 |
| 264 | 3300020069 | Ga0197907_11276795 | Ga0197907_112767952 | 186 |
| 265 | 3300025904 | Ga0207647_10063153 | Ga0207647_100631532 | 186 |
| 266 | 3300025944 | Ga0207661_10116413 | Ga0207661_101164133 | 186 |
| 267 | 3300044694 | Ga0466963_0001518 | Ga0466963_0001518_8423_9037 | 186 |
| 268 | 3300045836 | Ga0466958_0044621 | Ga0466958_0044621_334_948 | 186 |
| 269 | 3300045976 | Ga0466967_0148429 | Ga0466967_0148429_1401_2015 | 186 |
| 270 | 3300046691 | Ga0495670_0018245 | Ga0495670_0018245_173_805 | 187 |
| 271 | 3300048929 | Ga0496126_0000006 | Ga0496126_0000006_322300_322899 | 187 |
| 272 | 3300005334 | Ga0068869_100071281 | Ga0068869_1000712814 | 188 |
| 273 | 3300005338 | Ga0068868_100003436 | Ga0068868_1000034364 | 188 |
| 274 | 3300005366 | Ga0070659_100000345 | Ga0070659_1000003454 | 188 |
| 275 | 3300009093 | Ga0105240_10851473 | Ga0105240_108514732 | 188 |
| 276 | 3300009551 | Ga0105238_10225942 | Ga0105238_102259422 | 188 |
| 277 | 3300025942 | Ga0207689_10684830 | Ga0207689_106848301 | 188 |
| 278 | 3300048916 | Ga0496113_0003357 | Ga0496113_0003357_2380_3000 | 188 |
| 279 | 3300005354 | Ga0070675_100516007 | Ga0070675_1005160072 | 189 |
| 280 | 3300005356 | Ga0070674_100016225 | Ga0070674_1000162253 | 189 |
| 281 | 3300005457 | Ga0070662_100014721 | Ga0070662_1000147215 | 189 |
| 282 | 3300005578 | Ga0068854_100530605 | Ga0068854_1005306051 | 189 |
| 283 | 3300005616 | Ga0068852_101028992 | Ga0068852_1010289922 | 189 |
| 284 | 3300025934 | Ga0207686_10009999 | Ga0207686_100099995 | 189 |
| 285 | 3300025961 | Ga0207712_10024988 | Ga0207712_100249884 | 189 |
| 286 | 3300025972 | Ga0207668_10173319 | Ga0207668_101733191 | 189 |
| 287 | 3300044656 | Ga0466969_0139049 | Ga0466969_0139049_393_1007 | 189 |
| 288 | 3300025904 | Ga0207647_10169095 | Ga0207647_101690952 | 191 |
| 289 | 3300044694 | Ga0466963_0014932 | Ga0466963_0014932_2081_2695 | 192 |
| 290 | 3300044719 | Ga0466971_0115647 | Ga0466971_0115647_333_947 | 192 |
| 291 | 3300005435 | Ga0070714_100310912 | Ga0070714_1003109121 | 196 |
| 292 | 3300005578 | Ga0068854_100799579 | Ga0068854_1007995791 | 196 |
| 293 | 3300044684 | Ga0466966_0046257 | Ga0466966_0046257_1550_2182 | 196 |
| 294 | 3300044684 | Ga0466966_0099781 | Ga0466966_0099781_267_890 | 196 |
| 295 | 3300044693 | Ga0466961_0061658 | Ga0466961_0061658_823_1446 | 196 |
| 296 | 3300025928 | Ga0207700_10116954 | Ga0207700_101169542 | 197 |
| 297 | 3300005335 | Ga0070666_10024369 | Ga0070666_100243692 | 202 |
| 298 | 3300005347 | Ga0070668_100431054 | Ga0070668_1004310542 | 202 |
| 299 | 3300005441 | Ga0070700_100000011 | Ga0070700_10000001176 | 202 |
| 300 | 3300005548 | Ga0070665_100000583 | Ga0070665_10000058347 | 202 |
| 301 | 3300005841 | Ga0068863_100000675 | Ga0068863_10000067517 | 202 |
| 302 | 3300005843 | Ga0068860_100000214 | Ga0068860_10000021471 | 202 |
| 303 | 3300009101 | Ga0105247_10495409 | Ga0105247_104954091 | 202 |
| 304 | 3300009553 | Ga0105249_10931474 | Ga0105249_109314742 | 202 |
| 305 | 3300025903 | Ga0207680_10011618 | Ga0207680_100116185 | 202 |
| 306 | 3300025972 | Ga0207668_10024801 | Ga0207668_100248012 | 202 |
| 307 | 3300026035 | Ga0207703_10034916 | Ga0207703_100349162 | 202 |
| 308 | 3300026075 | Ga0207708_10000009 | Ga0207708_10000009197 | 202 |
| 309 | 3300026088 | Ga0207641_10002292 | Ga0207641_1000229217 | 202 |
| 310 | 3300028379 | Ga0268266_10005006 | Ga0268266_1000500612 | 202 |
| 311 | 3300028381 | Ga0268264_10000027 | Ga0268264_10000027195 | 202 |
| 312 | 3300002067 | JGI24735J21928_10026809 | JGI24735J21928_100268092 | 203 |
| 313 | 3300005337 | Ga0070682_100262240 | Ga0070682_1002622402 | 203 |
| 314 | 3300005435 | Ga0070714_100000006 | Ga0070714_100000006160 | 203 |
| 315 | 3300005616 | Ga0068852_100588862 | Ga0068852_1005888622 | 203 |
| 316 | 3300009098 | Ga0105245_10192602 | Ga0105245_101926021 | 203 |
| 317 | 3300025927 | Ga0207687_10436762 | Ga0207687_104367621 | 203 |
| 318 | 3300025929 | Ga0207664_10000032 | Ga0207664_1000003255 | 203 |
| 319 | 3300026142 | Ga0207698_10550496 | Ga0207698_105504961 | 203 |
| 320 | 3300028379 | Ga0268266_10796234 | Ga0268266_107962341 | 203 |
| 321 | 3300045976 | Ga0466967_0083346 | Ga0466967_0083346_553_1203 | 203 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2bky-assembly1.cif.gz_A | crystal structure of the alba1:alba2 heterodimer from sulfolobus solfataricus | 0.6639 | 138 | 169 |
| 5mus-assembly1.cif.gz_B | structure of the c-terminal domain of a reptarenavirus l protein | 0.595 | 45 | 100 |
| 8i2f-assembly2.cif.gz_C | crystal structure of bacillus subtilis lyte catalytic domain in complex with isea | 0.5904 | 44 | 88 |
| 2ihw-assembly1.cif.gz_A | crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), apo form | 0.5586 | 138 | 190 |
| 1nfh-assembly1.cif.gz_B-2 | structure of a sir2 substrate, alba, reveals a mechanism for deactylation-induced enhancement of dna-binding | 0.5435 | 124 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O86317_22_202_3.30.1460.10 | Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; | 0.9096 | 25 | 198 | 3.30.1460.10 |
| af_O86317_22_202_3.30.1460.10 | Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; | 0.8711 | 25 | 198 | 3.30.1460.10 |
| 4f6aA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.6927 | 62 | 98 | 3.40.630.30 |
| af_F6PBY5_48_260_3.40.570.10 | Alpha Beta;3-Layer(aba) Sandwich;Extracellular Endonuclease; Chain A;Extracellular Endonuclease, subunit A | 0.6843 | 60 | 104 | 3.40.570.10 |
| 6mjnB02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.6418 | 117 | 158 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G1NUW6-F1-model_v4 | DUF3000 domain-containing protein | 0.9521 | 24 | 196 |
|
| AF-A0A7W9UTU0-F1-model_v4 | DUF3000 domain-containing protein | 0.949 | 24 | 197 |
|
| AF-A0A2W6B1S7-F1-model_v4 | DUF3000 domain-containing protein | 0.948 | 21 | 203 |
|
| AF-A0A7K0VWQ8-F1-model_v4 | DUF3000 family protein | 0.9479 | 23 | 143 |
|
| AF-A0A7V9ITQ3-F1-model_v4 | DUF3000 domain-containing protein | 0.9471 | 24 | 201 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar