F405807

General Info

Members Datasets Scaffolds Average Seq Length
321 213 642 811

Family's Representative Sequence

Representative Sequence 3300003856|Ga0058692_1000279|Ga0058692_10002793
Length 970
Sequence MIHAKAPVKAARWQGDTRRRVAQQRHVRMKRLGVLGAAVARRLRAQQISELQQATRRALAAEPHHARTRPVPGVVQIKIEGGLLNARRQLLQFLRGIAFHLAEKSQRQVQISRHDGATGVIGKIIGAPAHQLLLQRVRQADAKKQALCLHGGLRQSSRMSATMRAILTQAEREFAVSDLPVSAVLPDLLQALNTAPQILLAAPTGAGKSTWLPLQLLQQATLPGRIIMLEPRRLAARYRMRGENCVGPATRLEVVTEGILTRMLQRDPELSGVSLVILDEFHERSLQADLALALLLDVQQGLRDDLKILLMSATLDNARLSALLPDAPLIVSEGRSFPVTRRFASLSSTLRFEEAVARETAQLLREESGSLLLFLPGVAEIERVKRELESRVAEDVDLTPLYGALPLAAQRRAILPAPPGRRKVVLATNIAETSLTIEGIRLVVDSALERTAQFDARSGVTRLLTQRISQASMTQRAGRAGRLMPGICLHLIAEEQASRAAAQSEAEILHSDLAALWIELLQWGCNQPDQLTWLDVPPAKHLRVAQQLLTRLGALDENGRLXALGRRMAQLGSDPRLSAILCAAGQDADAVASAALLAAVLEDPPRSGSPDLRDALHRPQPQWLRRAKQWQTRLGVSGGKVDEDRFAALLAAGFGDRLARRRDNGGRYQLANGLGAMLDREEGLNRYEWLIAPALLQGSATPDARMLLALPVEIDALRQALPTLVETRTEVEWDEEKGTLRALRREQIGALVLKAQPMARPESDVLHAAMLRWVAEKGLAVLGWSQEAEQLRVRLQCAAQWLPEENWPAVDDETLLATLETWLLPEMGAVRDLKSLQAVNLVTALLHLLTWSQRQRLDSVLPTHYTVPTGSRLAIRYHADKPPALAVRIQEMFGEASNPAVAEGRVPLVLELLSPAQRPLQITRDLAAFWRGAYQEVQKEMKGRYPKHPWPDDPASALPTRRTKKYSPQG

Samples

Sample ID Description Type Environment
1 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
7 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
8 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
9 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
10 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
11 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
12 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
13 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
17 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
21 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
32 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
45 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
49 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
50 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
54 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
55 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
56 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
57 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
58 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
59 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
60 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
63 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
64 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
65 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
66 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
67 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
68 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
69 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
70 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
73 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
74 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
75 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
76 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
77 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
78 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
79 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
80 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
81 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
82 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
83 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
84 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
89 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
90 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
91 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
92 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
93 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
94 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
95 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
99 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
102 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
103 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
104 2506520008 Serratia plymuthica AS12 Isolate Unclassified
105 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
106 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
107 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
108 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
109 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
110 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
111 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
112 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
113 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
114 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
115 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
116 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
117 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
118 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
119 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
120 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
121 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
122 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
123 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
124 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
125 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
126 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
127 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
128 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
129 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
130 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
131 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
132 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
133 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
134 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
135 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
136 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
137 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
138 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
139 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
140 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
141 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
142 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
143 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
144 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
145 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
146 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
147 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
148 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
149 2636415599 Klebsiella variicola DX120E Isolate Unclassified
150 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
151 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
152 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
153 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
154 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
155 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
156 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
157 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
158 2751185917 Enterobacter sp. HK169 Isolate Unclassified
159 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
160 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
161 2775507074 Klebsiella sp. D5A Isolate Unclassified
162 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
163 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
164 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
165 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
166 2821118458 Enterobacter asburiae 609 Isolate Unclassified
167 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
168 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
169 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
170 2847085930 Erwinia persicina B64 Isolate Bulb
171 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
172 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
173 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
174 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
175 2865014394 Pantoea sp. R-71966 Isolate Unclassified
176 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
177 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
178 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
179 2876601092 Pantoea endophytica 596 Isolate Unclassified
180 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
181 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
182 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
183 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
184 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
185 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
186 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
187 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
188 2932406140 Serratia sp. 2723 Isolate Rhizosphere
189 2937539931 Pantoea sp. LS15 Isolate Unclassified
190 2937967321 Serratia sp. YC16 Isolate Unclassified
191 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
192 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
193 2939577877 Serratia sp. 509 Isolate Rhizosphere
194 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
195 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
196 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
197 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
198 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
199 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
200 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
201 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
202 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
203 640753048 Serratia proteamaculans 568 Isolate Endosphere
204 8004592986 Serratia sp. S119 Isolate Unclassified
205 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
206 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
207 8018221730 Enterobacter sp. CM29 Isolate Unclassified
208 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
209 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
210 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
211 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
212 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
213 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 65.42
Metatranscriptomes 0
Isolates 34.58

Biome Distribution

Category Percentage (%)
Aerial Root 1.25
Bulb 0.31
Endosphere 0.93
Nodule 4.67
Rhizoplane 14.64
Rhizosphere 54.83
Stem 0
Stem Tuber 1.87
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058692_1000279 3300003856 Bacteria 27090
2 Ga0058692_1000183 3300003856 Bacteria 38266
3 Ga0058692_1000311 3300003856 Bacteria 24338
4 Ga0058692_1000469 3300003856 Bacteria 18156
5 Ga0065704_10000386 3300005289 Bacteria 24385
6 Ga0070680_100035658 3300005336 Bacteria 4017
7 Ga0070668_100003865 3300005347 Bacteria 11058
8 Ga0070668_100009313 3300005347 Bacteria 7285
9 Ga0070662_100008692 3300005457 Bacteria 6622
10 Ga0070686_100007892 3300005544 Bacteria 5950
11 Ga0068859_100010706 3300005617 Bacteria 9232
12 Ga0068861_100002870 3300005719 Bacteria 11355
13 Ga0068861_100005563 3300005719 Bacteria 8537
14 Ga0068861_100015586 3300005719 Bacteria 5360
15 Ga0075428_100006036 3300006844 Bacteria 13455
16 Ga0075430_100011276 3300006846 Bacteria 7580
17 Ga0075430_100037750 3300006846 Bacteria 4094
18 Ga0075429_100034558 3300006880 Bacteria 4393
19 Ga0068865_100014429 3300006881 Bacteria 5018
20 Ga0097620_100010706 3300006931 Bacteria 9232
21 Ga0079104_1000238 3300006946 Bacteria 73159
22 Ga0079104_1000406 3300006946 Bacteria 49721
23 Ga0079104_1000918 3300006946 Bacteria 23680
24 Ga0079104_1001021 3300006946 Bacteria 21577
25 Ga0079104_1001197 3300006946 Bacteria 18475
26 Ga0079104_1001894 3300006946 Bacteria 12637
27 Ga0079104_1006032 3300006946 Bacteria 4688
28 Ga0079104_1010431 3300006946 Bacteria 3063
29 Ga0105251_10000595 3300009011 Bacteria 33132
30 Ga0105251_10002049 3300009011 Bacteria 16301
31 Ga0105251_10003261 3300009011 Bacteria 11912
32 Ga0105251_10005303 3300009011 Bacteria 8478
33 Ga0105251_10015158 3300009011 Bacteria 4225
34 Ga0105251_10032925 3300009011 Bacteria 2577
35 Ga0105244_10000256 3300009036 Bacteria 54425
36 Ga0105244_10000451 3300009036 Bacteria 37498
37 Ga0105244_10001190 3300009036 Bacteria 21495
38 Ga0105244_10004568 3300009036 Bacteria 9479
39 Ga0105244_10013929 3300009036 Bacteria 4672
40 Ga0105250_10002850 3300009092 Bacteria 8467
41 Ga0105250_10008715 3300009092 Bacteria 4296
42 Ga0111539_10030983 3300009094 Bacteria 6498
43 Ga0105247_10000223 3300009101 Bacteria 54349
44 Ga0105241_10000006 3300009174 Bacteria 373608
45 Ga0157373_10002942 3300013100 Bacteria 12904
46 Ga0157371_10002195 3300013102 Bacteria 18957
47 Ga0157371_10003575 3300013102 Bacteria 14016
48 Ga0157370_10000142 3300013104 Bacteria 87393
49 Ga0157369_10062742 3300013105 Bacteria 4004
50 Ga0163162_10035450 3300013306 Bacteria 4970
51 Ga0157372_10010037 3300013307 Bacteria 10070
52 Ga0157372_10068031 3300013307 Bacteria 4004
53 Ga0157380_10078821 3300014326 Bacteria 2688
54 Ga0182008_10001121 3300014497 Bacteria 18442
55 Ga0182006_1000045 3300015261 Bacteria 197248
56 Ga0163161_10000050 3300017792 Bacteria 125396
57 Ga0209437_100063 3300025233 Bacteria 335477
58 Ga0207696_1000014 3300025711 Bacteria 517939
59 Ga0207696_1000215 3300025711 Bacteria 84729
60 Ga0207696_1000598 3300025711 Bacteria 27197
61 Ga0207696_1000678 3300025711 Bacteria 23793
62 Ga0207655_1000024 3300025728 Bacteria 459774
63 Ga0207655_1000436 3300025728 Bacteria 55864
64 Ga0207655_1000704 3300025728 Bacteria 38785
65 Ga0207655_1001024 3300025728 Bacteria 28234
66 Ga0207655_1004308 3300025728 Bacteria 10169
67 Ga0207655_1004492 3300025728 Bacteria 9878
68 Ga0207655_1007017 3300025728 Bacteria 7376
69 Ga0207655_1014648 3300025728 Bacteria 4415
70 Ga0207713_1000007 3300025735 Bacteria 564979
71 Ga0207713_1000164 3300025735 Bacteria 98195
72 Ga0207713_1000522 3300025735 Bacteria 38613
73 Ga0207713_1000620 3300025735 Bacteria 34825
74 Ga0207713_1003109 3300025735 Bacteria 11513
75 Ga0207713_1004549 3300025735 Bacteria 8978
76 Ga0207710_10000007 3300025900 Bacteria 488292
77 Ga0207645_10011517 3300025907 Bacteria 6034
78 Ga0207643_10008846 3300025908 Bacteria 5404
79 Ga0207654_10000008 3300025911 Bacteria 375871
80 Ga0207706_10013149 3300025933 Bacteria 7532
81 Ga0207669_10017560 3300025937 Bacteria 3674
82 Ga0207691_10012933 3300025940 Bacteria 7992
83 Ga0207691_10016749 3300025940 Bacteria 6957
84 Ga0207708_10014834 3300026075 Bacteria 5831
85 Ga0207675_100001648 3300026118 Bacteria 22353
86 Ga0209281_1000058 3300027111 Bacteria 300244
87 Ga0209281_1000060 3300027111 Bacteria 295683
88 Ga0209281_1000260 3300027111 Bacteria 101875
89 Ga0209281_1000298 3300027111 Bacteria 90323
90 Ga0209281_1000506 3300027111 Bacteria 51753
91 Ga0209281_1001156 3300027111 Bacteria 18489
92 Ga0209281_1005307 3300027111 Bacteria 3612
93 Ga0209371_1000053 3300027312 Bacteria 264616
94 Ga0209371_1000096 3300027312 Bacteria 160552
95 Ga0209371_1000276 3300027312 Bacteria 59687
96 Ga0209371_1000435 3300027312 Bacteria 42480
97 Ga0209371_1000640 3300027312 Bacteria 30870
98 Ga0209371_1002727 3300027312 Bacteria 9507
99 Ga0209371_1002829 3300027312 Bacteria 9220
100 Ga0209371_1002847 3300027312 Bacteria 9145
101 Ga0209371_1004726 3300027312 Bacteria 5775
102 Ga0209371_1006647 3300027312 Bacteria 4226
103 Ga0209983_1002591 3300027665 Bacteria 3936
104 Ga0268265_10008501 3300028380 Bacteria 6938
105 Ga0268256_1000053 3300030500 Bacteria 264616
106 Ga0268256_1000086 3300030500 Bacteria 160533
107 Ga0268256_1000230 3300030500 Bacteria 59687
108 Ga0268256_1000540 3300030500 Bacteria 31068
109 Ga0268256_1001724 3300030500 Bacteria 12418
110 Ga0268256_1004487 3300030500 Bacteria 5775
111 Ga0268256_1006723 3300030500 Bacteria 4226
112 Ga0265330_10000629 3300031235 Bacteria 22805
113 Ga0265329_10001009 3300031242 Bacteria 14060
114 Ga0265316_10000200 3300031344 Bacteria 69574
115 Ga0307509_10086422 3300031507 Bacteria 3225
116 Ga0265342_10000393 3300031712 Bacteria 48286
117 Ga0439438_004106 3300041405 Bacteria 5685
118 Ga0439447_005720 3300041407 Bacteria 4111
119 Ga0439466_0000107 3300041411 Bacteria 31816
120 Ga0439432_003198 3300042006 Bacteria 6095
121 Ga0439452_000004 3300042010 Bacteria 764268
122 Ga0439452_000007 3300042010 Bacteria 613625
123 Ga0450907_000034 3300042146 Bacteria 61803
124 Ga0466981_0000042 3300044669 Bacteria 40532
125 Ga0451576_0055315 3300045051 Bacteria 4152
126 Ga0495617_006816 3300046452 Bacteria 3991
127 Ga0495627_000266 3300046453 Bacteria 53407
128 Ga0495591_000024 3300046458 Bacteria 191134
129 Ga0495638_0002632 3300046460 Bacteria 14447
130 Ga0495650_0000377 3300046471 Bacteria 77543
131 Ga0495650_0004675 3300046471 Bacteria 9244
132 Ga0495584_0016262 3300046491 Bacteria 3794
133 Ga0495585_0004351 3300046492 Bacteria 9209
134 Ga0495596_0007830 3300046500 Bacteria 4787
135 Ga0495607_0003596 3300046501 Bacteria 11784
136 Ga0495606_0000954 3300046507 Bacteria 42555
137 Ga0495620_0009951 3300046515 Bacteria 5032
138 Ga0495644_0001325 3300046523 Bacteria 10141
139 Ga0495648_0010101 3300046524 Bacteria 7229
140 Ga0495654_0000061 3300046530 Bacteria 130939
141 Ga0495654_0000163 3300046530 Bacteria 65805
142 Ga0495654_0000546 3300046530 Bacteria 30342
143 Ga0495654_0004370 3300046530 Bacteria 8411
144 Ga0495597_0000400 3300046542 Bacteria 37496
145 Ga0495625_0001519 3300046660 Bacteria 27775
146 Ga0495649_0001409 3300046694 Bacteria 18159
147 Ga0495649_0012721 3300046694 Bacteria 4881
148 Ga0495589_0000028 3300046794 Bacteria 179523
149 Ga0495660_0000158 3300046810 Bacteria 73369
150 Ga0495660_0023028 3300046810 Bacteria 3553
151 Ga0495672_0000029 3300047320 Bacteria 305231
152 Ga0495672_0000049 3300047320 Bacteria 240851
153 Ga0495672_0000054 3300047320 Bacteria 230777
154 Ga0495679_000131 3300047446 Bacteria 66495
155 Ga0495679_000606 3300047446 Bacteria 24321
156 Ga0495679_006220 3300047446 Bacteria 5172
157 Ga0495673_0000092 3300047469 Bacteria 187963
158 Ga0495681_0009495 3300047470 Bacteria 5984
159 Ga0496102_0016364 3300048905 Bacteria 6478
160 Ga0496103_0030215 3300048906 Bacteria 3296
161 Ga0496105_0002143 3300048908 Bacteria 14297
162 Ga0496116_0000009 3300048919 Bacteria 716119
163 Ga0496116_0000214 3300048919 Bacteria 109085
164 Ga0496116_0000368 3300048919 Bacteria 69066
165 Ga0496116_0001345 3300048919 Bacteria 27966
166 Ga0496117_0000350 3300048920 Bacteria 81439
167 Ga0496117_0000772 3300048920 Bacteria 50588
168 Ga0496117_0003932 3300048920 Bacteria 16821
169 Ga0496117_0005805 3300048920 Bacteria 12794
170 Ga0496118_0000821 3300048921 Bacteria 49444
171 Ga0496118_0001273 3300048921 Bacteria 38671
172 Ga0496118_0001525 3300048921 Bacteria 34487
173 Ga0496119_0000134 3300048922 Bacteria 104139
174 Ga0496119_0000226 3300048922 Bacteria 78974
175 Ga0496119_0000516 3300048922 Bacteria 52621
176 Ga0496119_0003967 3300048922 Bacteria 14982
177 Ga0496119_0006100 3300048922 Bacteria 11287
178 Ga0496119_0025085 3300048922 Bacteria 4172
179 Ga0496119_0040819 3300048922 Bacteria 2963
180 Ga0496119_0046663 3300048922 Bacteria 2702
181 Ga0496120_0000017 3300048923 Bacteria 269222
182 Ga0496120_0000032 3300048923 Bacteria 220255
183 Ga0496120_0000090 3300048923 Bacteria 150551
184 Ga0496120_0000330 3300048923 Bacteria 78975
185 Ga0496120_0000616 3300048923 Bacteria 53766
186 Ga0496120_0000853 3300048923 Bacteria 43233
187 Ga0496120_0020904 3300048923 Bacteria 4146
188 Ga0496120_0024220 3300048923 Bacteria 3788
189 Ga0496120_0029196 3300048923 Bacteria 3368
190 Ga0496121_0000336 3300048924 Bacteria 97792
191 Ga0496121_0006151 3300048924 Bacteria 15063
192 Ga0496121_0029600 3300048924 Bacteria 5057
193 Ga0496122_0046826 3300048925 Bacteria 3344
194 Ga0496123_0005392 3300048926 Bacteria 12887
195 Ga0496123_0005923 3300048926 Bacteria 12042
196 Ga0496123_0018278 3300048926 Bacteria 5582
197 Ga0496123_0048273 3300048926 Bacteria 2865
198 Ga0496124_0000096 3300048927 Bacteria 183847
199 Ga0496124_0000452 3300048927 Bacteria 72015
200 Ga0496124_0001954 3300048927 Bacteria 28148
201 Ga0496124_0002318 3300048927 Bacteria 25111
202 Ga0496124_0003612 3300048927 Bacteria 18787
203 Ga0496124_0021341 3300048927 Bacteria 5968
204 Ga0496124_0043248 3300048927 Bacteria 3873
205 Ga0496126_0048708 3300048929 Bacteria 3871
206 Ga0495678_000386 3300049459 Bacteria 44516
207 Ga0495682_0000003 3300049460 Bacteria 515787
208 nmdc:mga0qj67_4484_c1 3300050509 Bacteria 10114
209 nmdc:mga06r32_39156_c1 3300050510 Bacteria 4497
210 Ga0500621_000006 3300053126 Bacteria 245480
211 2506580286 2506520007 Bacteria 5442880
212 2506585425 2506520008 Bacteria 5443009
213 2508854064 2508501071 Bacteria 5454741
214 2511381791 2511231025 Bacteria 5324661
215 2511434699 2511231035 Bacteria 5341610
216 2538425005 2537561728 Bacteria 5149301
217 2548648893 2547132416 Bacteria 4633861
218 2566036385 2565956521 Bacteria 4468993
219 2599412256 2599185169 Bacteria 5441380
220 2599928264 2599185299 Bacteria 4854625
221 2601525446 2600255254 Bacteria 5281859
222 2601530581 2600255255 Bacteria 5282785
223 2601617567 2600255280 Bacteria 5292309
224 2601622601 2600255281 Bacteria 5288753
225 2601644491 2600255287 Bacteria 5210468
226 2601650875 2600255288 Bacteria 5282738
227 2601655925 2600255289 Bacteria 5281907
228 2601660795 2600255290 Bacteria 5282218
229 2601664656 2600255291 Bacteria 5217298
230 2601697476 2600255298 Bacteria 5215185
231 2601702864 2600255299 Bacteria 5218662
232 2601708691 2600255300 Bacteria 5287774
233 2601713549 2600255301 Bacteria 5280532
234 2601718774 2600255302 Bacteria 5288235
235 2601722477 2600255303 Bacteria 5219315
236 2601728745 2600255304 Bacteria 5283973
237 2601733668 2600255305 Bacteria 5282329
238 2601738643 2600255306 Bacteria 5281613
239 2601743025 2600255307 Bacteria 5439064
240 2601753819 2600255309 Bacteria 5431045
241 2602020651 2600255392 Bacteria 5437392
242 2603644476 2602042047 Bacteria 4697674
243 2603663027 2602042052 Bacteria 5215873
244 2603667925 2602042053 Bacteria 5214361
245 2603700331 2602042066 Bacteria 4423871
246 2603706055 2602042067 Bacteria 4863713
247 2603841244 2602042103 Bacteria 5284714
248 2603846316 2602042104 Bacteria 5281639
249 2603851391 2602042105 Bacteria 5282303
250 2603856458 2602042106 Bacteria 5282744
251 2603874038 2602042110 Bacteria 5283285
252 2603878733 2602042111 Bacteria 5212080
253 2606051218 2603880178 Bacteria 5283018
254 2606072145 2603880184 Bacteria 5217896
255 2606148851 2603880202 Bacteria 5284684
256 2606179109 2603880211 Bacteria 5284226
257 2637227024 2636415599 Bacteria 5718434
258 2650900079 2648501693 Bacteria 5069560
259 2671587850 2671180115 Bacteria 5353919
260 2676409488 2675903046 Bacteria 5451247
261 2681996964 2681812866 Bacteria 4552357
262 2686354318 2684622997 Bacteria 4624240
263 2689446816 2687453601 Bacteria 5546041
264 2707100002 2706794495 Bacteria 4536932
265 2712470797 2711768156 Bacteria 4471618
266 2753854682 2751185917 Bacteria 4551186
267 2772440721 2772190666 Bacteria 5117644
268 2775540937 2775506706 Bacteria 4873073
269 2777021422 2775507074 Bacteria 5532402
270 2791924359 2791354903 Bacteria 4937680
271 2793406784 2791355275 Bacteria 4429597
272 2807178706 2806310673 Bacteria 4801221
273 2809124393 2808606414 Bacteria 4917181
274 2821121545 2821118458 Bacteria 4714306
275 2823377332 2823373977 Bacteria 4779415
276 2844426243 2844425489 Bacteria 4854065
277 2844532472 2844528606 Bacteria 4733806
278 2847088976 2847085930 Bacteria 5070450
279 2847801168 2847797336 Bacteria 5176640
280 2854603750 2854601825 Bacteria 4797592
281 2855196432 2855195626 Bacteria 4927512
282 2858467337 2858466076 Bacteria 4722413
283 2865018481 2865014394 Bacteria 4764573
284 2869556195 2869551831 Bacteria 5474685
285 2871276645 2871272651 Bacteria 5042015
286 2871286174 2871282230 Bacteria 4917173
287 2876605617 2876601092 Bacteria 5114497
288 2881612195 2881609920 Bacteria 4405319
289 2884090354 2884086401 Bacteria 5005459
290 2891671926 2891670763 Bacteria 4967099
291 2900053352 2900051742 Bacteria 4985156
292 2904516255 2904513164 Bacteria 5476410
293 2908673274 2908669403 Bacteria 5740494
294 2923638090 2923634449 Bacteria 4753480
295 2927835485 2927833300 Bacteria 4923934
296 2932406833 2932406140 Bacteria 5134491
297 2937544550 2937539931 Bacteria 4639830
298 2937969346 2937967321 Bacteria 5094075
299 2939571466 2939568625 Bacteria 4542555
300 2939576169 2939573065 Bacteria 4926053
301 2939579759 2939577877 Bacteria 5132791
302 2939605271 2939602548 Bacteria 4950493
303 2939646125 2939642701 Bacteria 4475280
304 2945954200 2945951305 Bacteria 4918162
305 2969084035 2969079654 Bacteria 5439582
306 2978976684 2978975091 Bacteria 4704313
307 2984497995 2984494565 Bacteria 5000175
308 2984561112 2984559226 Bacteria 5683096
309 2984599185 2984595703 Bacteria 5682994
310 2990264489 2990261002 Bacteria 4919493
311 640939542 640753048 Bacteria 5495657
312 8004593621 8004592986 Bacteria 5122074
313 8015398076 8015394850 Bacteria 5064660
314 8016737149 8016733728 Bacteria 5274317
315 8018221934 8018221730 Bacteria 4616064
316 8019502352 8019499862 Bacteria 5169538
317 8054845561 8054844752 Bacteria 4450330
318 8054853789 8054849141 Bacteria 5232694
319 8055092487 8055087960 Bacteria 4784273
320 8055697453 8055693939 Bacteria 4772047
321 8057307226 8057304971 Bacteria 4649742
322 Ga0058692_1000279
323 Ga0058692_1000183
324 Ga0058692_1000311
325 Ga0058692_1000469
326 Ga0065704_10000386
327 Ga0070680_100035658
328 Ga0070668_100003865
329 Ga0070668_100009313
330 Ga0070662_100008692
331 Ga0070686_100007892
332 Ga0068859_100010706
333 Ga0068861_100002870
334 Ga0068861_100005563
335 Ga0068861_100015586
336 Ga0075428_100006036
337 Ga0075430_100011276
338 Ga0075430_100037750
339 Ga0075429_100034558
340 Ga0068865_100014429
341 Ga0097620_100010706
342 Ga0079104_1000238
343 Ga0079104_1000406
344 Ga0079104_1000918
345 Ga0079104_1001021
346 Ga0079104_1001197
347 Ga0079104_1001894
348 Ga0079104_1006032
349 Ga0079104_1010431
350 Ga0105251_10000595
351 Ga0105251_10002049
352 Ga0105251_10003261
353 Ga0105251_10005303
354 Ga0105251_10015158
355 Ga0105251_10032925
356 Ga0105244_10000256
357 Ga0105244_10000451
358 Ga0105244_10001190
359 Ga0105244_10004568
360 Ga0105244_10013929
361 Ga0105250_10002850
362 Ga0105250_10008715
363 Ga0111539_10030983
364 Ga0105247_10000223
365 Ga0105241_10000006
366 Ga0157373_10002942
367 Ga0157371_10002195
368 Ga0157371_10003575
369 Ga0157370_10000142
370 Ga0157369_10062742
371 Ga0163162_10035450
372 Ga0157372_10010037
373 Ga0157372_10068031
374 Ga0157380_10078821
375 Ga0182008_10001121
376 Ga0182006_1000045
377 Ga0163161_10000050
378 Ga0209437_100063
379 Ga0207696_1000014
380 Ga0207696_1000215
381 Ga0207696_1000598
382 Ga0207696_1000678
383 Ga0207655_1000024
384 Ga0207655_1000436
385 Ga0207655_1000704
386 Ga0207655_1001024
387 Ga0207655_1004308
388 Ga0207655_1004492
389 Ga0207655_1007017
390 Ga0207655_1014648
391 Ga0207713_1000007
392 Ga0207713_1000164
393 Ga0207713_1000522
394 Ga0207713_1000620
395 Ga0207713_1003109
396 Ga0207713_1004549
397 Ga0207710_10000007
398 Ga0207645_10011517
399 Ga0207643_10008846
400 Ga0207654_10000008
401 Ga0207706_10013149
402 Ga0207669_10017560
403 Ga0207691_10012933
404 Ga0207691_10016749
405 Ga0207708_10014834
406 Ga0207675_100001648
407 Ga0209281_1000058
408 Ga0209281_1000060
409 Ga0209281_1000260
410 Ga0209281_1000298
411 Ga0209281_1000506
412 Ga0209281_1001156
413 Ga0209281_1005307
414 Ga0209371_1000053
415 Ga0209371_1000096
416 Ga0209371_1000276
417 Ga0209371_1000435
418 Ga0209371_1000640
419 Ga0209371_1002727
420 Ga0209371_1002829
421 Ga0209371_1002847
422 Ga0209371_1004726
423 Ga0209371_1006647
424 Ga0209983_1002591
425 Ga0268265_10008501
426 Ga0268256_1000053
427 Ga0268256_1000086
428 Ga0268256_1000230
429 Ga0268256_1000540
430 Ga0268256_1001724
431 Ga0268256_1004487
432 Ga0268256_1006723
433 Ga0265330_10000629
434 Ga0265329_10001009
435 Ga0265316_10000200
436 Ga0307509_10086422
437 Ga0265342_10000393
438 Ga0439438_004106
439 Ga0439447_005720
440 Ga0439466_0000107
441 Ga0439432_003198
442 Ga0439452_000004
443 Ga0439452_000007
444 Ga0450907_000034
445 Ga0466981_0000042
446 Ga0451576_0055315
447 Ga0495617_006816
448 Ga0495627_000266
449 Ga0495591_000024
450 Ga0495638_0002632
451 Ga0495650_0000377
452 Ga0495650_0004675
453 Ga0495584_0016262
454 Ga0495585_0004351
455 Ga0495596_0007830
456 Ga0495607_0003596
457 Ga0495606_0000954
458 Ga0495620_0009951
459 Ga0495644_0001325
460 Ga0495648_0010101
461 Ga0495654_0000061
462 Ga0495654_0000163
463 Ga0495654_0000546
464 Ga0495654_0004370
465 Ga0495597_0000400
466 Ga0495625_0001519
467 Ga0495649_0001409
468 Ga0495649_0012721
469 Ga0495589_0000028
470 Ga0495660_0000158
471 Ga0495660_0023028
472 Ga0495672_0000029
473 Ga0495672_0000049
474 Ga0495672_0000054
475 Ga0495679_000131
476 Ga0495679_000606
477 Ga0495679_006220
478 Ga0495673_0000092
479 Ga0495681_0009495
480 Ga0496102_0016364
481 Ga0496103_0030215
482 Ga0496105_0002143
483 Ga0496116_0000009
484 Ga0496116_0000214
485 Ga0496116_0000368
486 Ga0496116_0001345
487 Ga0496117_0000350
488 Ga0496117_0000772
489 Ga0496117_0003932
490 Ga0496117_0005805
491 Ga0496118_0000821
492 Ga0496118_0001273
493 Ga0496118_0001525
494 Ga0496119_0000134
495 Ga0496119_0000226
496 Ga0496119_0000516
497 Ga0496119_0003967
498 Ga0496119_0006100
499 Ga0496119_0025085
500 Ga0496119_0040819
501 Ga0496119_0046663
502 Ga0496120_0000017
503 Ga0496120_0000032
504 Ga0496120_0000090
505 Ga0496120_0000330
506 Ga0496120_0000616
507 Ga0496120_0000853
508 Ga0496120_0020904
509 Ga0496120_0024220
510 Ga0496120_0029196
511 Ga0496121_0000336
512 Ga0496121_0006151
513 Ga0496121_0029600
514 Ga0496122_0046826
515 Ga0496123_0005392
516 Ga0496123_0005923
517 Ga0496123_0018278
518 Ga0496123_0048273
519 Ga0496124_0000096
520 Ga0496124_0000452
521 Ga0496124_0001954
522 Ga0496124_0002318
523 Ga0496124_0003612
524 Ga0496124_0021341
525 Ga0496124_0043248
526 Ga0496126_0048708
527 Ga0495678_000386
528 Ga0495682_0000003
529 nmdc:mga0qj67_4484_c1
530 nmdc:mga06r32_39156_c1
531 Ga0500621_000006
532 2506580286
533 2506585425
534 2508854064
535 2511381791
536 2511434699
537 2538425005
538 2548648893
539 2566036385
540 2599412256
541 2599928264
542 2601525446
543 2601530581
544 2601617567
545 2601622601
546 2601644491
547 2601650875
548 2601655925
549 2601660795
550 2601664656
551 2601697476
552 2601702864
553 2601708691
554 2601713549
555 2601718774
556 2601722477
557 2601728745
558 2601733668
559 2601738643
560 2601743025
561 2601753819
562 2602020651
563 2603644476
564 2603663027
565 2603667925
566 2603700331
567 2603706055
568 2603841244
569 2603846316
570 2603851391
571 2603856458
572 2603874038
573 2603878733
574 2606051218
575 2606072145
576 2606148851
577 2606179109
578 2637227024
579 2650900079
580 2671587850
581 2676409488
582 2681996964
583 2686354318
584 2689446816
585 2707100002
586 2712470797
587 2753854682
588 2772440721
589 2775540937
590 2777021422
591 2791924359
592 2793406784
593 2807178706
594 2809124393
595 2821121545
596 2823377332
597 2844426243
598 2844532472
599 2847088976
600 2847801168
601 2854603750
602 2855196432
603 2858467337
604 2865018481
605 2869556195
606 2871276645
607 2871286174
608 2876605617
609 2881612195
610 2884090354
611 2891671926
612 2900053352
613 2904516255
614 2908673274
615 2923638090
616 2927835485
617 2932406833
618 2937544550
619 2937969346
620 2939571466
621 2939576169
622 2939579759
623 2939605271
624 2939646125
625 2945954200
626 2969084035
627 2978976684
628 2984497995
629 2984561112
630 2984599185
631 2990264489
632 640939542
633 8004593621
634 8015398076
635 8016737149
636 8018221934
637 8019502352
638 8054845561
639 8054853789
640 8055092487
641 8055697453
642 8057307226

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08482

HrpB_C

ATP-dependent helicase C-terminal

822

954

1

PF24473

724

758

0.97

PF04408

HA2_N

Helicase associated domain (HA2), winged-helix

545

572

0.94

PF00271

Helicase_C

Helicase conserved C-terminal domain

354

484

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eud-assembly1.cif.gz_A crystal structure of e. coli dexh-box ntpase hrpb 0.8652 146 931
6zm2-assembly1.cif.gz_A crystal structure of the deah-box atpase prp2 in complex with adp-bef3 and ssrna 0.8644 142 685
6heg-assembly1.cif.gz_A crystal structure of escherichia coli deah/rha helicase hrpb 0.8634 150 918
5mq0-assembly1.cif.gz_V structure of a spliceosome remodeled for exon ligation 0.8628 151 691
6ff7-assembly1.cif.gz_q human bact spliceosome core structure 0.8611 155 691
ID Description Score Start End Superfamily
af_P37024_180_347_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9973 308 475 3.40.50.300
af_P37024_180_347_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9914 308 475 3.40.50.300
af_P37024_371_482_1.20.120.1080 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9532 499 608 1.20.120.1080
af_P37024_1_179_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9408 148 307 3.40.50.300
af_Q7L2E3_634_805_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9364 322 473 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3S1CCK0-F1-model_v4 ATP-dependent helicase HrpB 0.9804 338 484 GO:0004386
GO:0005524
GO:0016787
AF-A0A376P0E5-F1-model_v4 ATP-dependent helicase HrpB (EC 3.6.1.-) 0.9731 311 525 GO:0004386
GO:0005524
GO:0016787
AF-W1Y4D0-F1-model_v4 ATP-dependent RNA helicase hrpB 0.9727 411 534 GO:0004386
GO:0005524
GO:0016787
AF-A0A8B4Q5J5-F1-model_v4 deleted 0.9675 158 546
AF-A0A3S1CCK0-F1-model_v4 ATP-dependent helicase HrpB 0.9674 338 484 GO:0004386
GO:0005524
GO:0016787

Map