F405755

General Info

Members Datasets Scaffolds Average Seq Length
320 238 284 200

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_023127|Ga0500645_023127_417_1130
Length 237
Sequence LKIIQVITGLSKGNPNPIIHSVNNPRSEFMSTPVNTAIPSIGIIGAGAIGSAIATVLARQGIPAILSNSRGPDSLEDTVRELGASITAGTREEAAAKDIVFVAVNWGRLPAALAGLPDFGGRIVVDTNNPIEAPLFKPAELNGRLSSEVFADLVPGARVVKAFNHLAAKLLASDPAAEGGKRVLFFSGDDAQAKAAVGALISRLGFSGIDLGALAVGARLAQFPGGPLPLLNLAHFA

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
3 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
4 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
5 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
6 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
7 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
8 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
9 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
10 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
11 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
12 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
13 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
14 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
15 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
16 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
17 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
18 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
19 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
20 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
21 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
22 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
23 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
24 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
25 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
26 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
27 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
28 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
29 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
30 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
31 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
32 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
33 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
34 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
35 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
36 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
37 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
38 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
39 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
40 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
41 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
44 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
45 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
46 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
95 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
134 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
144 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
153 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
154 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
157 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
158 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
159 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
160 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
161 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
162 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
163 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
164 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
165 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
166 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
167 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
168 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
169 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
170 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
171 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
199 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
200 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
219 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
220 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
221 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
222 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
223 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
224 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
225 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
226 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
229 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
235 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
238 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.75
Metatranscriptomes 0
Isolates 11.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.69
Nodule 3.75
Rhizoplane 2.19
Rhizosphere 53.75
Stem 0
Stem Tuber 0
Unclassified 10.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000002 3300002704 Bacteria 292156
2 JGI25156J39149_1000003 3300002705 Bacteria 305434
3 JGI25154J39366_1000009 3300002738 Bacteria 305408
4 JGI25157J39369_1000002 3300002741 Bacteria 305434
5 JGI25150J39212_1011508 3300002774 Bacteria 1600
6 JGI25159J45721_1000148 3300002987 Bacteria 32592
7 JGI25151J46595_10010661 3300003187 Bacteria 4255
8 JGI25151J46595_10053897 3300003187 Bacteria 1339
9 JGI25153J46596_10003042 3300003215 Bacteria 9476
10 rootH2_10118171 3300003320 Bacteria 4074
11 rootH1_10108461 3300003323 Bacteria 5641
12 JGI25160J50197_1000123 3300003354 Bacteria 70031
13 JGI25160J50197_1003720 3300003354 Bacteria 6729
14 JGI25161J50226_1000032 3300003374 Bacteria 138440
15 Ga0055536_1000035 3300003781 Bacteria 145848
16 Ga0055536_1000538 3300003781 Bacteria 26028
17 Ga0055530_10013649 3300003791 Bacteria 2758
18 Ga0055530_10033197 3300003791 Unclassified 1333
19 Ga0055540_1011056 3300003792 Bacteria 2947
20 Ga0055531_10008266 3300003794 Bacteria 5530
21 Ga0055531_10043248 3300003794 Bacteria 1277
22 Ga0055543_1000294 3300004625 Bacteria 35881
23 Ga0065165_1009552 3300005262 Bacteria 4331
24 Ga0065165_1013088 3300005262 Bacteria 3322
25 Ga0065165_1019060 3300005262 Bacteria 2463
26 Ga0070670_100000603 3300005331 Bacteria 28216
27 Ga0070691_10031590 3300005341 Bacteria 2484
28 Ga0070691_10440778 3300005341 Bacteria 742
29 Ga0070709_10384319 3300005434 Bacteria 1044
30 Ga0070713_100781694 3300005436 Bacteria 914
31 Ga0070710_10223297 3300005437 Bacteria 1199
32 Ga0070711_100283074 3300005439 Bacteria 1312
33 Ga0070700_100023484 3300005441 Bacteria 3606
34 Ga0070694_100056462 3300005444 Bacteria 2667
35 Ga0070678_100113749 3300005456 Bacteria 2122
36 Ga0070706_100138842 3300005467 Bacteria 2268
37 Ga0070707_100096106 3300005468 Bacteria 2869
38 Ga0070697_100151024 3300005536 Bacteria 1958
39 Ga0070695_100231655 3300005545 Bacteria 1335
40 Ga0070696_100485231 3300005546 Bacteria 981
41 Ga0068860_101156872 3300005843 Bacteria 794
42 Ga0081455_10062328 3300005937 Bacteria 3135
43 Ga0075365_10005314 3300006038 Bacteria 6929
44 Ga0075432_10008162 3300006058 Bacteria 3569
45 Ga0075432_10023001 3300006058 Bacteria 2134
46 Ga0070715_10113553 3300006163 Bacteria 1281
47 Ga0070712_100471329 3300006175 Bacteria 1048
48 Ga0070712_100504462 3300006175 Bacteria 1014
49 Ga0075362_10066283 3300006177 Bacteria 1640
50 Ga0075362_10105435 3300006177 Bacteria 1322
51 Ga0075362_10112238 3300006177 Bacteria 1284
52 Ga0075369_10031587 3300006186 Bacteria 2237
53 Ga0075366_10018317 3300006195 Bacteria 4041
54 Ga0075370_10012133 3300006353 Bacteria 4547
55 Ga0075370_10275126 3300006353 Bacteria 1000
56 Ga0068871_100487904 3300006358 Bacteria 1109
57 Ga0075428_100070954 3300006844 Bacteria 3808
58 Ga0075428_101045333 3300006844 Bacteria 864
59 Ga0075430_100040737 3300006846 Bacteria 3931
60 Ga0075431_100072191 3300006847 Bacteria 3562
61 Ga0075431_100781850 3300006847 Bacteria 928
62 Ga0075433_10151159 3300006852 Bacteria 2065
63 Ga0075434_100024226 3300006871 Bacteria 5931
64 Ga0075434_100544489 3300006871 Bacteria 1180
65 Ga0075429_100533234 3300006880 Bacteria 1029
66 Ga0075436_100088512 3300006914 Bacteria 2151
67 Ga0075436_100562039 3300006914 Bacteria 838
68 Ga0079104_1013622 3300006946 Bacteria 2495
69 Ga0075435_100850342 3300007076 Unclassified 795
70 Ga0099794_10039314 3300007265 Bacteria 2245
71 Ga0099795_10055660 3300007788 Bacteria 1453
72 Ga0105244_10005131 3300009036 Bacteria 8780
73 Ga0111539_10087180 3300009094 Bacteria 3668
74 Ga0111539_10173150 3300009094 Bacteria 2521
75 Ga0114129_11718764 3300009147 Bacteria 765
76 Ga0105241_10574684 3300009174 Bacteria 1015
77 Ga0105242_10116476 3300009176 Bacteria 2286
78 Ga0105242_10894716 3300009176 Bacteria 887
79 Ga0123340_1041709 3300009763 Bacteria 2090
80 Ga0123341_1055598 3300009765 Bacteria 2090
81 Ga0157373_10028157 3300013100 Bacteria 4054
82 Ga0157371_10006687 3300013102 Bacteria 9430
83 Ga0157370_10033481 3300013104 Bacteria 5011
84 Ga0157369_10000203 3300013105 Bacteria 82075
85 Ga0157369_10019066 3300013105 Bacteria 7680
86 Ga0157369_10136938 3300013105 Bacteria 2592
87 Ga0182006_1000411 3300015261 Bacteria 34635
88 Ga0163161_10393921 3300017792 Bacteria 1109
89 Ga0163161_10540419 3300017792 Bacteria 954
90 Ga0209435_100001 3300025206 Bacteria 1424171
91 Ga0207425_1007238 3300025245 Bacteria 2951
92 Ga0207425_1014733 3300025245 Bacteria 1771
93 Ga0209646_1000001 3300025246 Bacteria 3092932
94 Ga0209026_1000003 3300025250 Bacteria 1060571
95 Ga0209759_1000001 3300025256 Bacteria 2799452
96 Ga0209565_1006828 3300025263 Bacteria 3153
97 Ga0209130_1000050 3300025284 Bacteria 222092
98 Ga0209130_1023946 3300025284 Bacteria 1339
99 Ga0209675_1010270 3300025291 Bacteria 3212
100 Ga0209675_1036250 3300025291 Bacteria 1118
101 Ga0209676_1000020 3300025292 Bacteria 617256
102 Ga0209676_1000060 3300025292 Bacteria 338238
103 Ga0209676_1022875 3300025292 Bacteria 2059
104 Ga0209025_1009294 3300025294 Bacteria 6881
105 Ga0209025_1009382 3300025294 Bacteria 6835
106 Ga0209564_1004790 3300025295 Bacteria 8066
107 Ga0209564_1011241 3300025295 Bacteria 4031
108 Ga0209758_1000030 3300025297 Bacteria 509217
109 Ga0209758_1000884 3300025297 Bacteria 41143
110 Ga0209758_1023560 3300025297 Bacteria 2780
111 Ga0209758_1029536 3300025297 Bacteria 2289
112 Ga0209050_1002995 3300025298 Bacteria 13132
113 Ga0209050_1004723 3300025298 Bacteria 9022
114 Ga0209050_1007545 3300025298 Bacteria 6063
115 Ga0209050_1016635 3300025298 Bacteria 2992
116 Ga0209256_1013559 3300025299 Bacteria 3014
117 Ga0209256_1033219 3300025299 Bacteria 1391
118 Ga0207426_1000071 3300025302 Bacteria 329539
119 Ga0209051_1002024 3300025303 Bacteria 15431
120 Ga0209051_1036512 3300025303 Bacteria 1814
121 Ga0209257_1002532 3300025304 Bacteria 17904
122 Ga0209257_1014815 3300025304 Bacteria 3309
123 Ga0207655_1009690 3300025728 Bacteria 5949
124 Ga0207699_10079729 3300025906 Bacteria 2026
125 Ga0207684_10105091 3300025910 Bacteria 2415
126 Ga0207693_10161131 3300025915 Bacteria 1765
127 Ga0207650_10010461 3300025925 Bacteria 6361
128 Ga0207706_10147425 3300025933 Bacteria 2070
129 Ga0207686_10413513 3300025934 Bacteria 1030
130 Ga0207712_10478603 3300025961 Bacteria 1061
131 Ga0207678_10106936 3300026067 Bacteria 2386
132 Ga0207708_10901484 3300026075 Bacteria 765
133 Ga0207683_10088541 3300026121 Bacteria 2755
134 Ga0209588_1009240 3300027671 Bacteria 2943
135 Ga0207428_10005922 3300027907 Bacteria 11320
136 Ga0207428_10069567 3300027907 Bacteria 2768
137 Ga0207428_10112823 3300027907 Bacteria 2090
138 Ga0268266_10547296 3300028379 Bacteria 1109
139 Ga0316179_1083726 3300030734 Bacteria 661
140 Ga0316178_1111490 3300030735 Bacteria 19573
141 Ga0307408_100080551 3300031548 Bacteria 2432
142 Ga0307413_10040142 3300031824 Bacteria 2729
143 Ga0307407_10210233 3300031903 Bacteria 1309
144 Ga0307412_10050801 3300031911 Bacteria 2738
145 Ga0307412_10106389 3300031911 Bacteria 1994
146 Ga0307412_10457838 3300031911 Bacteria 1052
147 Ga0307412_10994035 3300031911 Unclassified 741
148 Ga0307409_100034178 3300031995 Bacteria 3709
149 Ga0307416_100207953 3300032002 Bacteria 1864
150 Ga0307411_10007924 3300032005 Bacteria 5459
151 Ga0307415_100316057 3300032126 Unclassified 1300
152 Ga0373930_0044168 3300034816 Bacteria 957
153 Ga0373958_0052591 3300034819 Bacteria 863
154 Ga0373940_0019000 3300035088 Bacteria 1731
155 Ga0373932_0005484 3300035112 Bacteria 2985
156 Ga0373941_0037369 3300035115 Bacteria 1482
157 Ga0373961_0017332 3300035241 Bacteria 1867
158 Ga0373962_0024146 3300035242 Bacteria 1623
159 Ga0373931_0028481 3300035691 Bacteria 2860
160 Ga0395905_0068516 3300037471 Bacteria 3323
161 Ga0395905_0481824 3300037471 Bacteria 1140
162 Ga0439438_000322 3300041405 Bacteria 21550
163 Ga0439438_001251 3300041405 Bacteria 11255
164 Ga0439447_005074 3300041407 Bacteria 4427
165 Ga0439465_0048599 3300041413 Bacteria 1384
166 Ga0439431_0017604 3300041997 Bacteria 1683
167 Ga0439442_042125 3300042002 Bacteria 960
168 Ga0439445_0001058 3300042004 Bacteria 5888
169 Ga0439445_0003305 3300042004 Bacteria 3623
170 Ga0439445_0003924 3300042004 Bacteria 3353
171 Ga0439432_022441 3300042006 Bacteria 2084
172 Ga0439452_000081 3300042010 Bacteria 82231
173 Ga0439456_001672 3300042013 Bacteria 4476
174 Ga0439463_014346 3300042016 Bacteria 1953
175 Ga0439463_016301 3300042016 Bacteria 1837
176 Ga0450911_000010 3300042115 Bacteria 149605
177 Ga0450900_013552 3300042136 Bacteria 1078
178 Ga0450902_017108 3300042137 Bacteria 1183
179 Ga0450903_023695 3300042138 Bacteria 943
180 Ga0450905_017381 3300042142 Bacteria 1042
181 Ga0450906_000018 3300042145 Bacteria 31270
182 Ga0450908_038245 3300042184 Bacteria 832
183 Ga0450918_035278 3300042531 Bacteria 889
184 Ga0450893_0076458 3300042532 Bacteria 656
185 Ga0495617_082023 3300046452 Bacteria 1056
186 Ga0495638_0003737 3300046460 Bacteria 11843
187 Ga0495638_0012830 3300046460 Bacteria 5725
188 Ga0495638_0015726 3300046460 Bacteria 5073
189 Ga0495605_0022017 3300046474 Bacteria 3370
190 Ga0495585_0046136 3300046492 Bacteria 2431
191 Ga0495607_0000053 3300046501 Bacteria 118035
192 Ga0495607_0049574 3300046501 Bacteria 2448
193 Ga0495607_0188566 3300046501 Bacteria 1029
194 Ga0495583_0078740 3300046506 Bacteria 1435
195 Ga0495610_0066574 3300046512 Bacteria 1696
196 Ga0495610_0097066 3300046512 Bacteria 1326
197 Ga0495620_0000069 3300046515 Bacteria 86730
198 Ga0495620_0063822 3300046515 Bacteria 1525
199 Ga0495620_0120887 3300046515 Bacteria 1032
200 Ga0495631_0004529 3300046518 Bacteria 7385
201 Ga0495631_0039408 3300046518 Bacteria 2097
202 Ga0495632_0028803 3300046519 Bacteria 2897
203 Ga0495632_0091259 3300046519 Bacteria 1444
204 Ga0495643_0141591 3300046522 Bacteria 1199
205 Ga0495643_0150877 3300046522 Bacteria 1151
206 Ga0495668_0005289 3300046616 Bacteria 8826
207 Ga0495668_0009531 3300046616 Bacteria 5953
208 Ga0495668_0009854 3300046616 Bacteria 5830
209 Ga0495668_0326022 3300046616 Bacteria 842
210 Ga0495625_0114598 3300046660 Bacteria 1840
211 Ga0495649_0452337 3300046694 Bacteria 641
212 Ga0495672_0029857 3300047320 Bacteria 3427
213 Ga0495673_0002668 3300047469 Bacteria 12315
214 Ga0496100_0245895 3300048903 Bacteria 1322
215 Ga0496102_0560794 3300048905 Bacteria 1065
216 Ga0496111_0087015 3300048914 Bacteria 2287
217 Ga0496114_0908865 3300048917 Bacteria 762
218 Ga0496115_0326689 3300048918 Bacteria 1254
219 Ga0496117_0013684 3300048920 Bacteria 7056
220 Ga0496118_0107042 3300048921 Bacteria 1868
221 Ga0496121_0000705 3300048924 Bacteria 62174
222 Ga0496121_0135376 3300048924 Bacteria 1836
223 Ga0496123_0246594 3300048926 Bacteria 884
224 Ga0496124_0030919 3300048927 Bacteria 4743
225 Ga0496124_0151498 3300048927 Bacteria 1818
226 Ga0496126_0267339 3300048929 Bacteria 1420
227 Ga0495678_079936 3300049459 Bacteria 1176
228 Ga0495678_085244 3300049459 Bacteria 1125
229 Ga0495682_0000014 3300049460 Bacteria 249706
230 Ga0495682_0077332 3300049460 Bacteria 1197
231 Ga0495682_0169489 3300049460 Bacteria 777
232 Ga0501211_000524 3300049658 Bacteria 3749
233 Ga0501225_0031776 3300049705 Bacteria 1452
234 nmdc:mga03683_290070_c1 3300050489 Bacteria 766
235 nmdc:mga03683_89487_c1 3300050489 Bacteria 1340
236 nmdc:mga0k408_39201_c1 3300050493 Bacteria 2721
237 nmdc:mga07m45_223160_c1 3300050496 Bacteria 1096
238 nmdc:mga07m45_257456_c1 3300050496 Bacteria 1015
239 nmdc:mga07m45_480890_c1 3300050496 Bacteria 719
240 nmdc:mga05p37_1178729_c1 3300050507 Bacteria 794
241 nmdc:mga06r32_168551_c1 3300050510 Bacteria 2173
242 nmdc:mga08y16_112262_c1 3300050511 Bacteria 2837
243 nmdc:mga08y16_159134_c1 3300050511 Bacteria 2346
244 nmdc:mga08y16_25427_c2 3300050511 Bacteria 5731
245 nmdc:mga0n895_13691_c1 3300050512 Bacteria 7332
246 nmdc:mga0n895_5347_c1 3300050512 Bacteria 10706
247 nmdc:mga0rr50_158017_c1 3300050513 Bacteria 1838
248 nmdc:mga0rr50_190207_c1 3300050513 Bacteria 1681
249 nmdc:mga0a205_440605_c1 3300050515 Bacteria 1163
250 nmdc:mga0a205_923_c1 3300050515 Bacteria 24235
251 nmdc:mga0sz30_30905_c1 3300050516 Bacteria 1899
252 Ga0500610_0027185 3300053079 Bacteria 2871
253 Ga0500578_0023122 3300053086 Bacteria 3993
254 Ga0500578_0215574 3300053086 Bacteria 1169
255 Ga0500644_0001314 3300053088 Bacteria 6740
256 Ga0500651_0143089 3300053093 Bacteria 1440
257 Ga0500650_0122832 3300053098 Bacteria 1210
258 Ga0500556_0000220 3300053104 Bacteria 46311
259 Ga0500556_0094611 3300053104 Bacteria 1144
260 Ga0500557_009555 3300053105 Bacteria 2382
261 Ga0500569_002177 3300053109 Bacteria 3821
262 Ga0500569_109920 3300053109 Bacteria 910
263 Ga0500593_000361 3300053117 Bacteria 18443
264 Ga0500594_0081947 3300053118 Bacteria 966
265 Ga0500618_014194 3300053125 Bacteria 2040
266 Ga0500628_001106 3300053129 Bacteria 4702
267 Ga0500642_0012759 3300053130 Bacteria 3061
268 Ga0500652_064321 3300053131 Bacteria 1514
269 Ga0500655_010258 3300053133 Bacteria 1691
270 Ga0500568_0003279 3300053139 Bacteria 9131
271 Ga0500577_0027648 3300053142 Bacteria 1945
272 Ga0500588_0073944 3300053146 Bacteria 1125
273 Ga0500616_0000164 3300053153 Bacteria 110715
274 Ga0500616_0005028 3300053153 Bacteria 9158
275 Ga0500616_0109869 3300053153 Bacteria 1333
276 Ga0500622_0032796 3300053156 Bacteria 2723
277 Ga0500633_0011244 3300053160 Bacteria 2427
278 Ga0500645_000493 3300053730 Bacteria 26655
279 Ga0500645_013981 3300053730 Bacteria 2567
280 Ga0500645_015443 3300053730 Bacteria 2418
281 Ga0500645_023127 3300053730 Bacteria 1906
282 Ga0500609_013833 3300053731 Bacteria 1092
283 Ga0500599_019284 3300053736 Bacteria 958
284 Ga0501082_0940729 3300060353 Bacteria 756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049705 Ga0501225_0031776 Ga0501225_0031776_867_1385 172
2 3300053088 Ga0500644_0001314 Ga0500644_0001314_4608_5348 185
3 3300053117 Ga0500593_000361 Ga0500593_000361_4561_5196 185
4 3300053129 Ga0500628_001106 Ga0500628_001106_1258_1971 188
5 3300048905 Ga0496102_0560794 Ga0496102_0560794_280_858 192
6 iso_pu_bacteria 2600255283 2601623558 193
7 iso_pu_bacteria 2713897148 2715752620 193
8 iso_pu_bacteria 2842832357 2842835247 193
9 iso_pu_bacteria 2842843487 2842846982 193
10 iso_pu_bacteria 2919385768 2919391081 193
11 iso_pu_bacteria 2919487758 2919492777 193
12 iso_pu_bacteria 2974289157 2974291475 193
13 iso_pu_bacteria 2998139840 2998142279 193
14 iso_pu_bacteria 8029995093 8029998419 193
15 iso_pu_bacteria 8056166840 8056168786 193
16 iso_pu_bacteria 2510917026 2511169306 195
17 iso_pu_bacteria 2510917028 2511184353 195
18 iso_pu_bacteria 2513237138 2513867437 195
19 iso_pu_bacteria 2582581867 2585401678 195
20 iso_pu_bacteria 2585427590 2585821372 195
21 iso_pu_bacteria 2599185236 2599719871 195
22 iso_pu_bacteria 2899792073 2899795883 195
23 iso_pu_bacteria 2919171160 2919173686 195
24 iso_pu_bacteria 2824617872 2824625260 196
25 iso_pu_bacteria 2824626560 2824631727 196
26 iso_pu_bacteria 2824635225 2824643657 196
27 iso_pu_bacteria 2824644064 2824652392 196
28 iso_pu_bacteria 2824714736 2824722915 196
29 iso_pu_bacteria 2824723954 2824732333 196
30 iso_pu_bacteria 2842038055 2842041385 196
31 iso_pu_bacteria 2842045827 2842049427 196
32 iso_pu_bacteria 2842698319 2842699107 196
33 iso_pu_bacteria 2849076700 2849083437 196
34 iso_pu_bacteria 2857509624 2857515642 196
35 iso_pu_bacteria 2888388044 2888390279 196
36 iso_pu_bacteria 2922393267 2922400774 196
37 iso_pu_bacteria 2935819856 2935826269 196
38 iso_pu_bacteria 2935847175 2935853765 196
39 iso_pu_bacteria 2935916978 2935924147 196
40 iso_pu_bacteria 3005506211 3005506299 196
41 3300002987 JGI25159J45721_1000148 JGI25159J45721_10001488 197
42 3300003354 JGI25160J50197_1000123 JGI25160J50197_100012361 197
43 3300003374 JGI25161J50226_1000032 JGI25161J50226_100003214 197
44 3300003781 Ga0055536_1000035 Ga0055536_100003578 197
45 3300003791 Ga0055530_10033197 Ga0055530_100331971 197
46 3300004625 Ga0055543_1000294 Ga0055543_10002948 197
47 3300005262 Ga0065165_1013088 Ga0065165_10130882 197
48 3300006058 Ga0075432_10023001 Ga0075432_100230012 197
49 3300006946 Ga0079104_1013622 Ga0079104_10136223 197
50 3300009036 Ga0105244_10005131 Ga0105244_100051315 197
51 3300013100 Ga0157373_10028157 Ga0157373_100281572 197
52 3300013102 Ga0157371_10006687 Ga0157371_100066873 197
53 3300013104 Ga0157370_10033481 Ga0157370_100334812 197
54 3300015261 Ga0182006_1000411 Ga0182006_10004119 197
55 3300025284 Ga0209130_1000050 Ga0209130_1000050194 197
56 3300025292 Ga0209676_1000020 Ga0209676_1000020351 197
57 3300025298 Ga0209050_1007545 Ga0209050_10075453 197
58 3300025302 Ga0207426_1000071 Ga0207426_100007162 197
59 3300025728 Ga0207655_1009690 Ga0207655_10096905 197
60 3300030734 Ga0316179_1083726 Ga0316179_10837261 197
61 3300030735 Ga0316178_1111490 Ga0316178_111149014 197
62 3300031548 Ga0307408_100080551 Ga0307408_1000805512 197
63 3300031824 Ga0307413_10040142 Ga0307413_100401422 197
64 3300031903 Ga0307407_10210233 Ga0307407_102102333 197
65 3300031995 Ga0307409_100034178 Ga0307409_1000341783 197
66 3300032005 Ga0307411_10007924 Ga0307411_100079244 197
67 3300041405 Ga0439438_000322 Ga0439438_000322_8177_8770 197
68 3300041405 Ga0439438_001251 Ga0439438_001251_5935_6528 197
69 3300042002 Ga0439442_042125 Ga0439442_042125_80_673 197
70 3300042004 Ga0439445_0003305 Ga0439445_0003305_2139_2732 197
71 3300042004 Ga0439445_0003924 Ga0439445_0003924_1542_2135 197
72 3300042006 Ga0439432_022441 Ga0439432_022441_162_755 197
73 3300042010 Ga0439452_000081 Ga0439452_000081_9195_9788 197
74 3300042013 Ga0439456_001672 Ga0439456_001672_3861_4454 197
75 3300042016 Ga0439463_016301 Ga0439463_016301_827_1420 197
76 3300042115 Ga0450911_000010 Ga0450911_000010_90796_91389 197
77 3300042136 Ga0450900_013552 Ga0450900_013552_190_783 197
78 3300042137 Ga0450902_017108 Ga0450902_017108_192_785 197
79 3300042138 Ga0450903_023695 Ga0450903_023695_184_777 197
80 3300042142 Ga0450905_017381 Ga0450905_017381_173_766 197
81 3300042145 Ga0450906_000018 Ga0450906_000018_21521_22114 197
82 3300042184 Ga0450908_038245 Ga0450908_038245_123_716 197
83 3300042531 Ga0450918_035278 Ga0450918_035278_110_703 197
84 3300042532 Ga0450893_0076458 Ga0450893_0076458_24_617 197
85 3300046501 Ga0495607_0000053 Ga0495607_0000053_37073_37666 197
86 3300046512 Ga0495610_0097066 Ga0495610_0097066_437_1030 197
87 3300046515 Ga0495620_0000069 Ga0495620_0000069_59970_60563 197
88 3300046515 Ga0495620_0063822 Ga0495620_0063822_458_1051 197
89 3300046616 Ga0495668_0005289 Ga0495668_0005289_3403_3996 197
90 3300047469 Ga0495673_0002668 Ga0495673_0002668_3524_4117 197
91 3300048903 Ga0496100_0245895 Ga0496100_0245895_627_1232 197
92 3300048918 Ga0496115_0326689 Ga0496115_0326689_220_825 197
93 3300048924 Ga0496121_0000705 Ga0496121_0000705_55061_55654 197
94 3300048927 Ga0496124_0151498 Ga0496124_0151498_594_1187 197
95 3300049459 Ga0495678_079936 Ga0495678_079936_52_645 197
96 3300049460 Ga0495682_0000014 Ga0495682_0000014_108428_109021 197
97 3300006871 Ga0075434_100024226 Ga0075434_1000242266 198
98 3300006914 Ga0075436_100088512 Ga0075436_1000885123 198
99 3300013105 Ga0157369_10000203 Ga0157369_1000020370 198
100 3300031911 Ga0307412_10050801 Ga0307412_100508011 198
101 3300031911 Ga0307412_10106389 Ga0307412_101063894 198
102 3300041407 Ga0439447_005074 Ga0439447_005074_3771_4367 198
103 3300042004 Ga0439445_0001058 Ga0439445_0001058_2708_3304 198
104 3300046616 Ga0495668_0009531 Ga0495668_0009531_3046_3642 198
105 3300049658 Ga0501211_000524 Ga0501211_000524_2947_3543 198
106 3300003320 rootH2_10118171 rootH2_101181711 199
107 3300003791 Ga0055530_10013649 Ga0055530_100136492 199
108 3300003792 Ga0055540_1011056 Ga0055540_10110561 199
109 3300003794 Ga0055531_10008266 Ga0055531_100082664 199
110 3300005341 Ga0070691_10031590 Ga0070691_100315901 199
111 3300005341 Ga0070691_10440778 Ga0070691_104407781 199
112 3300005434 Ga0070709_10384319 Ga0070709_103843192 199
113 3300005436 Ga0070713_100781694 Ga0070713_1007816942 199
114 3300005437 Ga0070710_10223297 Ga0070710_102232972 199
115 3300005439 Ga0070711_100283074 Ga0070711_1002830742 199
116 3300005441 Ga0070700_100023484 Ga0070700_1000234842 199
117 3300005444 Ga0070694_100056462 Ga0070694_1000564624 199
118 3300005456 Ga0070678_100113749 Ga0070678_1001137492 199
119 3300005467 Ga0070706_100138842 Ga0070706_1001388422 199
120 3300005468 Ga0070707_100096106 Ga0070707_1000961062 199
121 3300005536 Ga0070697_100151024 Ga0070697_1001510243 199
122 3300005545 Ga0070695_100231655 Ga0070695_1002316552 199
123 3300005546 Ga0070696_100485231 Ga0070696_1004852312 199
124 3300005843 Ga0068860_101156872 Ga0068860_1011568721 199
125 3300005937 Ga0081455_10062328 Ga0081455_100623285 199
126 3300006038 Ga0075365_10005314 Ga0075365_100053149 199
127 3300006163 Ga0070715_10113553 Ga0070715_101135532 199
128 3300006175 Ga0070712_100471329 Ga0070712_1004713292 199
129 3300006175 Ga0070712_100504462 Ga0070712_1005044621 199
130 3300006177 Ga0075362_10112238 Ga0075362_101122381 199
131 3300006186 Ga0075369_10031587 Ga0075369_100315872 199
132 3300006844 Ga0075428_100070954 Ga0075428_1000709541 199
133 3300006844 Ga0075428_101045333 Ga0075428_1010453331 199
134 3300006846 Ga0075430_100040737 Ga0075430_1000407372 199
135 3300006847 Ga0075431_100072191 Ga0075431_1000721915 199
136 3300006847 Ga0075431_100781850 Ga0075431_1007818502 199
137 3300006852 Ga0075433_10151159 Ga0075433_101511592 199
138 3300006871 Ga0075434_100544489 Ga0075434_1005444891 199
139 3300006880 Ga0075429_100533234 Ga0075429_1005332342 199
140 3300006914 Ga0075436_100562039 Ga0075436_1005620391 199
141 3300007076 Ga0075435_100850342 Ga0075435_1008503421 199
142 3300007265 Ga0099794_10039314 Ga0099794_100393143 199
143 3300007788 Ga0099795_10055660 Ga0099795_100556602 199
144 3300009094 Ga0111539_10087180 Ga0111539_100871803 199
145 3300009094 Ga0111539_10173150 Ga0111539_101731501 199
146 3300009147 Ga0114129_11718764 Ga0114129_117187641 199
147 3300009174 Ga0105241_10574684 Ga0105241_105746841 199
148 3300009176 Ga0105242_10116476 Ga0105242_101164763 199
149 3300009176 Ga0105242_10894716 Ga0105242_108947162 199
150 3300009763 Ga0123340_1041709 Ga0123340_10417092 199
151 3300009765 Ga0123341_1055598 Ga0123341_10555982 199
152 3300017792 Ga0163161_10393921 Ga0163161_103939212 199
153 3300017792 Ga0163161_10540419 Ga0163161_105404191 199
154 3300025298 Ga0209050_1002995 Ga0209050_10029959 199
155 3300025303 Ga0209051_1002024 Ga0209051_10020242 199
156 3300025304 Ga0209257_1002532 Ga0209257_10025328 199
157 3300025906 Ga0207699_10079729 Ga0207699_100797293 199
158 3300025910 Ga0207684_10105091 Ga0207684_101050912 199
159 3300025915 Ga0207693_10161131 Ga0207693_101611313 199
160 3300025933 Ga0207706_10147425 Ga0207706_101474251 199
161 3300025934 Ga0207686_10413513 Ga0207686_104135132 199
162 3300025961 Ga0207712_10478603 Ga0207712_104786032 199
163 3300026075 Ga0207708_10901484 Ga0207708_109014841 199
164 3300026121 Ga0207683_10088541 Ga0207683_100885412 199
165 3300027671 Ga0209588_1009240 Ga0209588_10092403 199
166 3300027907 Ga0207428_10005922 Ga0207428_100059227 199
167 3300027907 Ga0207428_10112823 Ga0207428_101128233 199
168 3300034816 Ga0373930_0044168 Ga0373930_0044168_329_928 199
169 3300035112 Ga0373932_0005484 Ga0373932_0005484_2242_2841 199
170 3300035241 Ga0373961_0017332 Ga0373961_0017332_834_1433 199
171 3300035242 Ga0373962_0024146 Ga0373962_0024146_851_1450 199
172 3300046452 Ga0495617_082023 Ga0495617_082023_15_614 199
173 3300046460 Ga0495638_0003737 Ga0495638_0003737_9005_9604 199
174 3300046460 Ga0495638_0015726 Ga0495638_0015726_2427_3026 199
175 3300046474 Ga0495605_0022017 Ga0495605_0022017_517_1116 199
176 3300046492 Ga0495585_0046136 Ga0495585_0046136_1589_2188 199
177 3300046501 Ga0495607_0049574 Ga0495607_0049574_1205_1804 199
178 3300046501 Ga0495607_0188566 Ga0495607_0188566_322_921 199
179 3300046506 Ga0495583_0078740 Ga0495583_0078740_398_997 199
180 3300046515 Ga0495620_0120887 Ga0495620_0120887_410_1009 199
181 3300046518 Ga0495631_0004529 Ga0495631_0004529_479_1078 199
182 3300046519 Ga0495632_0028803 Ga0495632_0028803_611_1210 199
183 3300046522 Ga0495643_0141591 Ga0495643_0141591_375_974 199
184 3300046522 Ga0495643_0150877 Ga0495643_0150877_452_1051 199
185 3300046616 Ga0495668_0009854 Ga0495668_0009854_5213_5812 199
186 3300047320 Ga0495672_0029857 Ga0495672_0029857_1728_2327 199
187 3300048914 Ga0496111_0087015 Ga0496111_0087015_523_1122 199
188 3300048917 Ga0496114_0908865 Ga0496114_0908865_27_626 199
189 3300048927 Ga0496124_0030919 Ga0496124_0030919_360_974 199
190 3300049459 Ga0495678_085244 Ga0495678_085244_256_855 199
191 3300049460 Ga0495682_0077332 Ga0495682_0077332_23_622 199
192 3300050489 nmdc:mga03683_89487_c1 nmdc:mga03683_89487_c1_289_888 199
193 3300050507 nmdc:mga05p37_1178729_c1 nmdc:mga05p37_1178729_c1_107_706 199
194 3300050510 nmdc:mga06r32_168551_c1 nmdc:mga06r32_168551_c1_913_1512 199
195 3300050511 nmdc:mga08y16_112262_c1 nmdc:mga08y16_112262_c1_1648_2247 199
196 3300050511 nmdc:mga08y16_159134_c1 nmdc:mga08y16_159134_c1_1415_2014 199
197 3300050511 nmdc:mga08y16_25427_c2 nmdc:mga08y16_25427_c2_4395_4994 199
198 3300050512 nmdc:mga0n895_13691_c1 nmdc:mga0n895_13691_c1_6681_7280 199
199 3300050512 nmdc:mga0n895_5347_c1 nmdc:mga0n895_5347_c1_1277_1876 199
200 3300050513 nmdc:mga0rr50_158017_c1 nmdc:mga0rr50_158017_c1_125_724 199
201 3300050513 nmdc:mga0rr50_190207_c1 nmdc:mga0rr50_190207_c1_1032_1631 199
202 3300050515 nmdc:mga0a205_440605_c1 nmdc:mga0a205_440605_c1_546_1145 199
203 3300050515 nmdc:mga0a205_923_c1 nmdc:mga0a205_923_c1_11058_11657 199
204 3300050516 nmdc:mga0sz30_30905_c1 nmdc:mga0sz30_30905_c1_810_1409 199
205 3300053079 Ga0500610_0027185 Ga0500610_0027185_593_1192 199
206 3300053086 Ga0500578_0023122 Ga0500578_0023122_1869_2468 199
207 3300053086 Ga0500578_0215574 Ga0500578_0215574_333_932 199
208 3300053098 Ga0500650_0122832 Ga0500650_0122832_94_693 199
209 3300053104 Ga0500556_0000220 Ga0500556_0000220_1945_2544 199
210 3300053105 Ga0500557_009555 Ga0500557_009555_365_964 199
211 3300053109 Ga0500569_109920 Ga0500569_109920_224_823 199
212 3300053118 Ga0500594_0081947 Ga0500594_0081947_332_931 199
213 3300053125 Ga0500618_014194 Ga0500618_014194_889_1488 199
214 3300053131 Ga0500652_064321 Ga0500652_064321_339_938 199
215 3300053139 Ga0500568_0003279 Ga0500568_0003279_2268_2867 199
216 3300053153 Ga0500616_0000164 Ga0500616_0000164_40164_40763 199
217 3300053153 Ga0500616_0005028 Ga0500616_0005028_6291_6890 199
218 3300053730 Ga0500645_015443 Ga0500645_015443_1124_1723 199
219 3300060353 Ga0501082_0940729 Ga0501082_0940729_94_693 199
220 3300003215 JGI25153J46596_10003042 JGI25153J46596_1000304210 200
221 3300003354 JGI25160J50197_1003720 JGI25160J50197_10037205 200
222 3300003781 Ga0055536_1000538 Ga0055536_100053815 200
223 3300003794 Ga0055531_10043248 Ga0055531_100432482 200
224 3300005262 Ga0065165_1009552 Ga0065165_10095523 200
225 3300005262 Ga0065165_1019060 Ga0065165_10190602 200
226 3300005331 Ga0070670_100000603 Ga0070670_1000006035 200
227 3300006058 Ga0075432_10008162 Ga0075432_100081623 200
228 3300006177 Ga0075362_10105435 Ga0075362_101054352 200
229 3300006195 Ga0075366_10018317 Ga0075366_100183174 200
230 3300006353 Ga0075370_10012133 Ga0075370_100121334 200
231 3300013105 Ga0157369_10136938 Ga0157369_101369382 200
232 3300025245 Ga0207425_1014733 Ga0207425_10147332 200
233 3300025284 Ga0209130_1023946 Ga0209130_10239462 200
234 3300025292 Ga0209676_1000060 Ga0209676_1000060197 200
235 3300025295 Ga0209564_1011241 Ga0209564_10112413 200
236 3300025297 Ga0209758_1000030 Ga0209758_1000030184 200
237 3300025297 Ga0209758_1000884 Ga0209758_100088441 200
238 3300025297 Ga0209758_1029536 Ga0209758_10295362 200
239 3300025298 Ga0209050_1004723 Ga0209050_10047238 200
240 3300025299 Ga0209256_1013559 Ga0209256_10135592 200
241 3300025299 Ga0209256_1033219 Ga0209256_10332193 200
242 3300025925 Ga0207650_10010461 Ga0207650_100104613 200
243 3300027907 Ga0207428_10069567 Ga0207428_100695673 200
244 3300028379 Ga0268266_10547296 Ga0268266_105472962 200
245 3300031911 Ga0307412_10457838 Ga0307412_104578382 200
246 3300031911 Ga0307412_10994035 Ga0307412_109940351 200
247 3300032002 Ga0307416_100207953 Ga0307416_1002079532 200
248 3300032126 Ga0307415_100316057 Ga0307415_1003160572 200
249 3300037471 Ga0395905_0481824 Ga0395905_0481824_261_863 200
250 3300041413 Ga0439465_0048599 Ga0439465_0048599_619_1221 200
251 3300046460 Ga0495638_0012830 Ga0495638_0012830_4484_5086 200
252 3300046512 Ga0495610_0066574 Ga0495610_0066574_465_1067 200
253 3300046518 Ga0495631_0039408 Ga0495631_0039408_1338_1940 200
254 3300046519 Ga0495632_0091259 Ga0495632_0091259_556_1158 200
255 3300046616 Ga0495668_0326022 Ga0495668_0326022_108_710 200
256 3300046660 Ga0495625_0114598 Ga0495625_0114598_90_692 200
257 3300046694 Ga0495649_0452337 Ga0495649_0452337_26_628 200
258 3300048920 Ga0496117_0013684 Ga0496117_0013684_3501_4103 200
259 3300048921 Ga0496118_0107042 Ga0496118_0107042_1012_1614 200
260 3300048924 Ga0496121_0135376 Ga0496121_0135376_23_625 200
261 3300048926 Ga0496123_0246594 Ga0496123_0246594_257_859 200
262 3300048929 Ga0496126_0267339 Ga0496126_0267339_283_885 200
263 3300049460 Ga0495682_0169489 Ga0495682_0169489_122_724 200
264 3300050493 nmdc:mga0k408_39201_c1 nmdc:mga0k408_39201_c1_294_896 200
265 3300050496 nmdc:mga07m45_223160_c1 nmdc:mga07m45_223160_c1_429_1031 200
266 3300053093 Ga0500651_0143089 Ga0500651_0143089_483_1085 200
267 3300053104 Ga0500556_0094611 Ga0500556_0094611_42_644 200
268 3300053109 Ga0500569_002177 Ga0500569_002177_950_1552 200
269 3300053130 Ga0500642_0012759 Ga0500642_0012759_1804_2406 200
270 3300053133 Ga0500655_010258 Ga0500655_010258_315_917 200
271 3300053142 Ga0500577_0027648 Ga0500577_0027648_1164_1766 200
272 3300053146 Ga0500588_0073944 Ga0500588_0073944_15_617 200
273 3300053153 Ga0500616_0109869 Ga0500616_0109869_654_1256 200
274 3300053156 Ga0500622_0032796 Ga0500622_0032796_1840_2442 200
275 3300053160 Ga0500633_0011244 Ga0500633_0011244_1236_1838 200
276 3300053730 Ga0500645_013981 Ga0500645_013981_855_1457 200
277 3300053731 Ga0500609_013833 Ga0500609_013833_75_677 200
278 3300053736 Ga0500599_019284 Ga0500599_019284_205_807 200
279 3300037471 Ga0395905_0068516 Ga0395905_0068516_2252_2857 201
280 3300041997 Ga0439431_0017604 Ga0439431_0017604_140_751 202
281 iso_pu_bacteria 2511231002 2511246203 202
282 3300003323 rootH1_10108461 rootH1_101084614 203
283 3300013105 Ga0157369_10019066 Ga0157369_100190664 207
284 3300042016 Ga0439463_014346 Ga0439463_014346_1229_1906 207
285 3300006177 Ga0075362_10066283 Ga0075362_100662832 208
286 3300050496 nmdc:mga07m45_480890_c1 nmdc:mga07m45_480890_c1_53_679 208
287 3300053730 Ga0500645_000493 Ga0500645_000493_10750_11499 208
288 3300053730 Ga0500645_023127 Ga0500645_023127_417_1130 208
289 3300002704 JGI25155J39150_1000002 JGI25155J39150_1000002116 209
290 3300002705 JGI25156J39149_1000003 JGI25156J39149_1000003190 209
291 3300002738 JGI25154J39366_1000009 JGI25154J39366_1000009116 209
292 3300002741 JGI25157J39369_1000002 JGI25157J39369_1000002116 209
293 3300002774 JGI25150J39212_1011508 JGI25150J39212_10115082 209
294 3300003187 JGI25151J46595_10010661 JGI25151J46595_100106611 209
295 3300003187 JGI25151J46595_10053897 JGI25151J46595_100538972 209
296 3300006353 Ga0075370_10275126 Ga0075370_102751261 209
297 3300006358 Ga0068871_100487904 Ga0068871_1004879042 209
298 3300025206 Ga0209435_100001 Ga0209435_100001601 209
299 3300025245 Ga0207425_1007238 Ga0207425_10072383 209
300 3300025246 Ga0209646_1000001 Ga0209646_1000001970 209
301 3300025250 Ga0209026_1000003 Ga0209026_1000003601 209
302 3300025256 Ga0209759_1000001 Ga0209759_1000001601 209
303 3300025263 Ga0209565_1006828 Ga0209565_10068282 209
304 3300025291 Ga0209675_1010270 Ga0209675_10102704 209
305 3300025291 Ga0209675_1036250 Ga0209675_10362501 209
306 3300025292 Ga0209676_1022875 Ga0209676_10228752 209
307 3300025294 Ga0209025_1009294 Ga0209025_10092946 209
308 3300025294 Ga0209025_1009382 Ga0209025_10093826 209
309 3300025295 Ga0209564_1004790 Ga0209564_10047904 209
310 3300025297 Ga0209758_1023560 Ga0209758_10235603 209
311 3300025298 Ga0209050_1016635 Ga0209050_10166353 209
312 3300025303 Ga0209051_1036512 Ga0209051_10365122 209
313 3300025304 Ga0209257_1014815 Ga0209257_10148153 209
314 3300026067 Ga0207678_10106936 Ga0207678_101069365 209
315 3300034819 Ga0373958_0052591 Ga0373958_0052591_193_822 209
316 3300035088 Ga0373940_0019000 Ga0373940_0019000_193_822 209
317 3300035115 Ga0373941_0037369 Ga0373941_0037369_825_1454 209
318 3300035691 Ga0373931_0028481 Ga0373931_0028481_1946_2575 209
319 3300050489 nmdc:mga03683_290070_c1 nmdc:mga03683_290070_c1_71_706 209
320 3300050496 nmdc:mga07m45_257456_c1 nmdc:mga07m45_257456_c1_319_990 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

40

130

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eei-assembly1.cif.gz_B unbound c. ammoniagenes monoamine oxidase (mao) 0.9652 13 41
8eem-assembly2.cif.gz_B c. ammoniagenes monoamine oxidase (mao) bound to norepinephrine 0.965 13 41
8eej-assembly2.cif.gz_A c. ammoniagenes monoamine oxidase (mao) c424s variant bound to dopamine 0.9623 13 41
8eeo-assembly1.cif.gz_A c. ammoniagenes monoamine oxidase bound to cadaverine 0.962 13 41
8een-assembly2.cif.gz_A c. ammoniagenes monoamine oxidase (mao) c424s variant 0.9609 13 41
ID Description Score Start End Superfamily
af_Q54F68_8_396_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9805 12 40 3.50.50.60
af_E0AHD3_2_449_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9637 12 40 3.50.50.60
af_B4FME7_8_374_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9629 13 40 3.50.50.60
af_I1LF51_8_392_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9606 13 41 3.50.50.60
af_K7LFM7_8_371_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9593 13 40 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A329J692-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 1.001 11 76
AF-A0A4R1IVY3-F1-model_v4 deleted 0.9914 12 81
AF-A0A519HC89-F1-model_v4 NADP oxidoreductase 0.9865 12 80
AF-A0A537NVC4-F1-model_v4 NADP oxidoreductase 0.978 12 76
AF-A0A7Y9N486-F1-model_v4 Putative dinucleotide-binding enzyme 0.9772 12 76

Feature Viewer

pLDDT pTM Quality
87.95 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map