F405503

General Info

Members Datasets Scaffolds Average Seq Length
320 197 640 142

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10152698|Ga0114129_101526983
Length 159
Sequence VAGDPRRRPHPLSRMGFASPTLRLAEDQYRTIVGHCYDGLPDEACGLLIGPLSGSEPSGVVSEVRPCRNENASAITYRIDGRDQGAAMKAARERGHEIVGCWHSHTHTDAYPSPTDVEQAKYYPEWIYVLVSLRDGDPVLRAYRIRDDTIAECQVVLDG

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
93 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
94 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
95 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
97 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
106 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
107 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
108 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 0
Rhizoplane 8.75
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 11.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10152698 3300009147 Bacteria 3159
2 Ga0070658_11341325 3300005327 Bacteria 621
3 Ga0070670_101544714 3300005331 Unclassified 610
4 Ga0070682_100577468 3300005337 Bacteria 884
5 Ga0068868_100644156 3300005338 Bacteria 943
6 Ga0070668_101814886 3300005347 Bacteria 561
7 Ga0070671_100130055 3300005355 Bacteria 2120
8 Ga0070674_100871955 3300005356 Bacteria 782
9 Ga0070688_100554321 3300005365 Bacteria 874
10 Ga0070703_10160232 3300005406 Bacteria 853
11 Ga0070713_100067889 3300005436 Bacteria 3004
12 Ga0070713_100128405 3300005436 Bacteria 2233
13 Ga0070713_100722386 3300005436 Bacteria 952
14 Ga0070713_100983056 3300005436 Unclassified 814
15 Ga0070710_10042570 3300005437 Bacteria 2511
16 Ga0070711_100041824 3300005439 Bacteria 3096
17 Ga0070705_101012626 3300005440 Bacteria 675
18 Ga0070708_100069000 3300005445 Bacteria 3178
19 Ga0070678_100450660 3300005456 Bacteria 1127
20 Ga0070678_101188298 3300005456 Bacteria 707
21 Ga0070707_100176773 3300005468 Bacteria 2081
22 Ga0070698_100091804 3300005471 Bacteria 3018
23 Ga0070684_101020568 3300005535 Bacteria 776
24 Ga0070697_100189643 3300005536 Bacteria 1744
25 Ga0070697_101549595 3300005536 Bacteria 592
26 Ga0070695_100090107 3300005545 Bacteria 2046
27 Ga0070695_100391834 3300005545 Bacteria 1051
28 Ga0070693_100688287 3300005547 Unclassified 747
29 Ga0070704_100010433 3300005549 Bacteria 5653
30 Ga0068864_100565006 3300005618 Bacteria 1101
31 Ga0068864_101647551 3300005618 Bacteria 646
32 Ga0068858_100011006 3300005842 Bacteria 8550
33 Ga0068862_102205577 3300005844 Bacteria 562
34 Ga0081455_10036836 3300005937 Bacteria 4350
35 Ga0081455_10226719 3300005937 Bacteria 1382
36 Ga0081539_10008503 3300005985 Bacteria 8916
37 Ga0070717_10228135 3300006028 Bacteria 1639
38 Ga0075365_10108794 3300006038 Bacteria 1903
39 Ga0075365_10187644 3300006038 Bacteria 1446
40 Ga0075365_10622967 3300006038 Bacteria 763
41 Ga0075368_10075080 3300006042 Bacteria 1370
42 Ga0075363_100057662 3300006048 Bacteria 2085
43 Ga0075364_10066969 3300006051 Bacteria 2360
44 Ga0075364_10161809 3300006051 Bacteria 1511
45 Ga0075364_10172085 3300006051 Bacteria 1464
46 Ga0075364_11065542 3300006051 Bacteria 549
47 Ga0070716_100486513 3300006173 Bacteria 907
48 Ga0070712_100038748 3300006175 Bacteria 3259
49 Ga0070712_101188739 3300006175 Bacteria 663
50 Ga0075362_10314068 3300006177 Bacteria 780
51 Ga0075367_10181136 3300006178 Bacteria 1314
52 Ga0075367_10292539 3300006178 Bacteria 1025
53 Ga0075428_100386414 3300006844 Bacteria 1500
54 Ga0075428_101233911 3300006844 Unclassified 787
55 Ga0075428_101455936 3300006844 Bacteria 718
56 Ga0075430_100122002 3300006846 Bacteria 2172
57 Ga0075430_100230860 3300006846 Bacteria 1534
58 Ga0075431_100034503 3300006847 Bacteria 5213
59 Ga0075431_100035994 3300006847 Bacteria 5098
60 Ga0075431_100269141 3300006847 Bacteria 1727
61 Ga0075434_100014605 3300006871 Bacteria 7512
62 Ga0075434_100250656 3300006871 Unclassified 1790
63 Ga0075434_100816051 3300006871 Bacteria 949
64 Ga0075429_100060181 3300006880 Bacteria 3308
65 Ga0075429_100772512 3300006880 Bacteria 842
66 Ga0068865_100858130 3300006881 Unclassified 787
67 Ga0075436_100023547 3300006914 Bacteria 4229
68 Ga0075435_100007941 3300007076 Bacteria 7593
69 Ga0075435_100147754 3300007076 Bacteria 1975
70 Ga0075435_100447935 3300007076 Bacteria 1113
71 Ga0111539_11857515 3300009094 Bacteria 698
72 Ga0105245_10018401 3300009098 Bacteria 6108
73 Ga0105245_10032937 3300009098 Bacteria 4589
74 Ga0105245_10500788 3300009098 Bacteria 1231
75 Ga0105245_10713613 3300009098 Bacteria 1037
76 Ga0105247_10621946 3300009101 Unclassified 803
77 Ga0114129_10915627 3300009147 Bacteria 1110
78 Ga0105243_10484949 3300009148 Unclassified 1168
79 Ga0105243_10720714 3300009148 Bacteria 975
80 Ga0105241_10898843 3300009174 Unclassified 822
81 Ga0105242_10056186 3300009176 Bacteria 3221
82 Ga0105242_10057225 3300009176 Bacteria 3192
83 Ga0105242_11708201 3300009176 Unclassified 666
84 Ga0105248_11304486 3300009177 Bacteria 821
85 Ga0105239_10287745 3300010375 Bacteria 1851
86 Ga0105246_11544635 3300011119 Unclassified 625
87 Ga0105246_11791177 3300011119 Bacteria 586
88 Ga0157378_10669311 3300013297 Bacteria 1055
89 Ga0157375_10806075 3300013308 Bacteria 1087
90 Ga0157375_12861981 3300013308 Unclassified 577
91 Ga0163163_10226623 3300014325 Bacteria 1918
92 Ga0163163_10627363 3300014325 Bacteria 1138
93 Ga0163163_11284964 3300014325 Bacteria 794
94 Ga0157379_10823188 3300014968 Bacteria 877
95 Ga0157376_10297254 3300014969 Bacteria 1527
96 Ga0163161_10433146 3300017792 Bacteria 1060
97 Ga0224572_1007490 3300024225 Bacteria 2001
98 Ga0207653_10140191 3300025885 Bacteria 884
99 Ga0207692_10057250 3300025898 Bacteria 2003
100 Ga0207710_10182585 3300025900 Unclassified 1030
101 Ga0207699_10107640 3300025906 Bacteria 1781
102 Ga0207684_10181270 3300025910 Bacteria 1816
103 Ga0207684_10295979 3300025910 Bacteria 1395
104 Ga0207693_10094706 3300025915 Bacteria 2340
105 Ga0207663_10179355 3300025916 Bacteria 1511
106 Ga0207657_10311047 3300025919 Bacteria 1247
107 Ga0207646_10290470 3300025922 Bacteria 1477
108 Ga0207646_10359672 3300025922 Bacteria 1315
109 Ga0207687_10378167 3300025927 Bacteria 1160
110 Ga0207687_10836586 3300025927 Unclassified 786
111 Ga0207687_11277467 3300025927 Bacteria 631
112 Ga0207700_10033514 3300025928 Bacteria 3676
113 Ga0207700_11628826 3300025928 Unclassified 571
114 Ga0207664_10103867 3300025929 Bacteria 2352
115 Ga0207644_10292440 3300025931 Bacteria 1310
116 Ga0207686_10252525 3300025934 Bacteria 1289
117 Ga0207704_10791250 3300025938 Bacteria 791
118 Ga0207665_10056788 3300025939 Bacteria 2643
119 Ga0207661_10440497 3300025944 Bacteria 1186
120 Ga0207677_10142586 3300026023 Bacteria 1837
121 Ga0207703_10007366 3300026035 Bacteria 8744
122 Ga0207641_11650776 3300026088 Bacteria 643
123 Ga0207648_10939392 3300026089 Bacteria 809
124 Ga0207676_10599564 3300026095 Bacteria 1058
125 Ga0207683_10060130 3300026121 Bacteria 3339
126 Ga0209813_10081567 3300027866 Bacteria 1070
127 Ga0265319_1194057 3300028563 Bacteria 624
128 Ga0265338_10060769 3300028800 Bacteria 3317
129 Ga0265327_10026927 3300031251 Bacteria 3320
130 Ga0265327_10078779 3300031251 Bacteria 1632
131 Ga0265327_10087704 3300031251 Bacteria 1523
132 Ga0265316_10622112 3300031344 Bacteria 765
133 Ga0307416_102450052 3300032002 Archaea 621
134 Ga0307415_101559863 3300032126 Bacteria 633
135 Ga0373930_0007110 3300034816 Bacteria 1915
136 Ga0373930_0097378 3300034816 Bacteria 696
137 Ga0373948_0006468 3300034817 Bacteria 1938
138 Ga0373928_0003829 3300035084 Bacteria 2867
139 Ga0373923_0190671 3300035111 Bacteria 945
140 Ga0373932_0005945 3300035112 Bacteria 2877
141 Ga0373957_0243959 3300035120 Bacteria 755
142 Ga0373931_0000010 3300035691 Bacteria 334069
143 Ga0373931_0000052 3300035691 Bacteria 60603
144 Ga0373935_0238443 3300035692 Bacteria 1269
145 Ga0373935_0901905 3300035692 Unclassified 655
146 Ga0373933_0120030 3300035724 Bacteria 1646
147 Ga0373937_0344406 3300036401 Bacteria 1411
148 Ga0373937_0853770 3300036401 Bacteria 859
149 Ga0436360_0097357 3300039438 Bacteria 1716
150 Ga0436360_0572826 3300039438 Unclassified 681
151 Ga0436363_0113831 3300039450 Bacteria 572
152 Ga0436363_0675689 3300039450 Bacteria 996
153 Ga0436362_0502360 3300039453 Unclassified 710
154 Ga0436362_1025074 3300039453 Bacteria 912
155 Ga0451797_0394768 3300041453 Bacteria 533
156 Ga0451798_0464880 3300041458 Unclassified 521
157 Ga0451807_0085275 3300041486 Bacteria 737
158 Ga0451849_1517555 3300041505 Unclassified 693
159 Ga0495603_0574254 3300046455 Bacteria 646
160 Ga0495590_0247265 3300046457 Bacteria 663
161 Ga0495641_0213651 3300046461 Bacteria 865
162 Ga0495651_0018870 3300046462 Bacteria 5342
163 Ga0495651_0308587 3300046462 Bacteria 1059
164 Ga0495651_0335297 3300046462 Bacteria 1004
165 Ga0495653_0423264 3300046463 Unclassified 842
166 Ga0495580_0721766 3300046472 Bacteria 651
167 Ga0495582_0137025 3300046473 Bacteria 1386
168 Ga0495582_0244247 3300046473 Bacteria 1029
169 Ga0495582_0488301 3300046473 Bacteria 712
170 Ga0495584_0226248 3300046491 Bacteria 951
171 Ga0495608_0068451 3300046511 Bacteria 2321
172 Ga0495630_0104859 3300046517 Bacteria 2140
173 Ga0495630_0618502 3300046517 Bacteria 830
174 Ga0495630_1413028 3300046517 Bacteria 523
175 Ga0495652_0344472 3300046529 Bacteria 1070
176 Ga0495640_0814848 3300046533 Bacteria 556
177 Ga0495587_0064215 3300046536 Bacteria 2145
178 Ga0495667_0005120 3300046559 Bacteria 8856
179 Ga0495667_0351662 3300046559 Bacteria 931
180 Ga0495656_0345915 3300046615 Bacteria 770
181 Ga0495668_0634941 3300046616 Bacteria 590
182 Ga0495611_0349105 3300046648 Bacteria 679
183 Ga0495611_0410475 3300046648 Bacteria 619
184 Ga0495635_0784516 3300046663 Unclassified 615
185 Ga0495657_0009073 3300046675 Bacteria 7558
186 Ga0495657_0234704 3300046675 Bacteria 1108
187 Ga0495647_0041178 3300046681 Bacteria 1758
188 Ga0495658_0665845 3300046683 Bacteria 667
189 Ga0495613_0336817 3300046689 Bacteria 1039
190 Ga0495589_0138152 3300046794 Bacteria 1168
191 Ga0495589_0205626 3300046794 Bacteria 928
192 Ga0495600_0647113 3300046809 Bacteria 639
193 Ga0495581_0136498 3300047315 Bacteria 1430
194 Ga0495604_0070363 3300047317 Bacteria 2650
195 Ga0495604_0377139 3300047317 Bacteria 938
196 Ga0495674_0659695 3300047319 Unclassified 824
197 Ga0495674_0665672 3300047319 Unclassified 820
198 Ga0495674_0714730 3300047319 Bacteria 785
199 Ga0495680_0002483 3300047322 Bacteria 18862
200 Ga0495680_0407073 3300047322 Unclassified 938
201 Ga0495675_0107832 3300047444 Bacteria 1740
202 Ga0495684_0916460 3300047471 Bacteria 563
203 Ga0495593_0446661 3300047673 Bacteria 647
204 Ga0495602_0380165 3300048088 Bacteria 1012
205 Ga0495614_0046755 3300048089 Bacteria 1856
206 Ga0496100_0029123 3300048903 Bacteria 3413
207 Ga0496100_1364778 3300048903 Bacteria 559
208 Ga0496101_0819831 3300048904 Bacteria 734
209 Ga0496102_0012668 3300048905 Bacteria 7304
210 Ga0496103_0046655 3300048906 Bacteria 2676
211 Ga0496104_0106426 3300048907 Bacteria 2688
212 Ga0496104_1463163 3300048907 Unclassified 586
213 Ga0496105_0011643 3300048908 Bacteria 6960
214 Ga0496105_0034998 3300048908 Bacteria 4133
215 Ga0496105_0489020 3300048908 Bacteria 967
216 Ga0496106_0033184 3300048909 Bacteria 3851
217 Ga0496108_1022245 3300048911 Bacteria 705
218 Ga0496109_0454467 3300048912 Bacteria 1210
219 Ga0496109_0893610 3300048912 Bacteria 826
220 Ga0496109_0946677 3300048912 Bacteria 799
221 Ga0496109_1575696 3300048912 Bacteria 591
222 Ga0496110_0195712 3300048913 Bacteria 1836
223 Ga0496110_0313180 3300048913 Bacteria 1429
224 Ga0496112_0009733 3300048915 Bacteria 8677
225 Ga0496112_0206877 3300048915 Bacteria 1920
226 Ga0496113_0029994 3300048916 Bacteria 3933
227 Ga0496113_0939929 3300048916 Unclassified 683
228 Ga0496113_1011752 3300048916 Unclassified 654
229 Ga0496114_0070870 3300048917 Bacteria 2929
230 Ga0496115_0010861 3300048918 Bacteria 6815
231 Ga0496126_0335444 3300048929 Bacteria 1240
232 Ga0501032_0001606 3300049569 Bacteria 18027
233 Ga0501032_0349550 3300049569 Bacteria 953
234 Ga0501034_0000888 3300049571 Bacteria 43830
235 Ga0501034_0049852 3300049571 Bacteria 4224
236 Ga0501034_0115644 3300049571 Bacteria 2671
237 Ga0501034_0261949 3300049571 Bacteria 1672
238 Ga0501034_0810015 3300049571 Bacteria 829
239 Ga0501036_0243812 3300049572 Bacteria 1507
240 Ga0501036_0282153 3300049572 Bacteria 1390
241 Ga0501037_0001614 3300049573 Bacteria 16386
242 Ga0501037_0046043 3300049573 Bacteria 3200
243 Ga0501037_0575764 3300049573 Bacteria 758
244 Ga0501038_0061343 3300049574 Bacteria 3216
245 Ga0501039_0959629 3300049575 Bacteria 665
246 Ga0501043_0464215 3300049579 Bacteria 950
247 Ga0501047_0028678 3300049581 Bacteria 5368
248 Ga0501048_0274750 3300049582 Bacteria 1198
249 Ga0501067_0019421 3300049583 Bacteria 3762
250 Ga0501067_0166544 3300049583 Bacteria 1227
251 Ga0501068_0000026 3300049584 Bacteria 54959
252 Ga0501068_0099635 3300049584 Bacteria 1800
253 Ga0501070_0014098 3300049586 Bacteria 6729
254 Ga0501070_0101690 3300049586 Bacteria 2377
255 Ga0501070_0164870 3300049586 Bacteria 1826
256 Ga0501070_0594288 3300049586 Bacteria 883
257 Ga0501070_1037805 3300049586 Bacteria 634
258 Ga0501071_0423383 3300049587 Bacteria 1018
259 Ga0501071_1130537 3300049587 Unclassified 605
260 Ga0501072_0018012 3300049588 Bacteria 5430
261 Ga0501073_0012092 3300049589 Bacteria 6301
262 Ga0501073_0236085 3300049589 Bacteria 1263
263 Ga0501073_0751122 3300049589 Bacteria 673
264 Ga0501074_0001393 3300049590 Bacteria 16061
265 Ga0501074_0014686 3300049590 Bacteria 5697
266 Ga0501074_1326584 3300049590 Unclassified 504
267 Ga0501075_0479481 3300049591 Bacteria 949
268 Ga0501076_0073857 3300049592 Bacteria 2731
269 Ga0501080_0000773 3300049742 Bacteria 25991
270 Ga0501080_0094094 3300049742 Bacteria 2783
271 Ga0501083_0120519 3300049744 Bacteria 1720
272 Ga0501083_0150985 3300049744 Bacteria 1521
273 Ga0501035_0057425 3300049822 Bacteria 3470
274 Ga0501044_0003535 3300049823 Bacteria 17595
275 nmdc:mga03683_102081_c1 3300050489 Bacteria 1261
276 nmdc:mga03683_45745_c1 3300050489 Bacteria 1812
277 nmdc:mga03n38_168363_c1 3300050490 Bacteria 1114
278 nmdc:mga03n38_280518_c1 3300050490 Unclassified 889
279 nmdc:mga03n38_324160_c1 3300050490 Bacteria 832
280 nmdc:mga00v17_316093_c1 3300050491 Bacteria 1015
281 nmdc:mga00v17_480491_c1 3300050491 Bacteria 806
282 nmdc:mga00v17_567354_c1 3300050491 Bacteria 733
283 nmdc:mga00v17_62508_c1 3300050491 Bacteria 2291
284 nmdc:mga00v17_87667_c1 3300050491 Unclassified 1951
285 nmdc:mga00v17_935102_c1 3300050491 Bacteria 548
286 nmdc:mga0yw44_112209_c1 3300050492 Bacteria 1748
287 nmdc:mga0yw44_43385_c1 3300050492 Bacteria 2685
288 nmdc:mga0yw44_509746_c1 3300050492 Unclassified 816
289 nmdc:mga0yw44_5167_c1 3300050492 Bacteria 6114
290 nmdc:mga0yw44_91270_c1 3300050492 Bacteria 1925
291 nmdc:mga06z11_377203_c1 3300050494 Bacteria 852
292 nmdc:mga04h51_74377_c1 3300050495 Bacteria 1193
293 nmdc:mga09592_402484_c1 3300050508 Bacteria 1183
294 nmdc:mga09592_50597_c1 3300050508 Bacteria 3505
295 nmdc:mga0qj67_464712_c1 3300050509 Bacteria 1019
296 nmdc:mga0qj67_606059_c1 3300050509 Bacteria 876
297 nmdc:mga06r32_483603_c1 3300050510 Bacteria 1216
298 nmdc:mga06r32_858868_c1 3300050510 Unclassified 866
299 nmdc:mga06r32_86869_c1 3300050510 Bacteria 3051
300 nmdc:mga0n895_566636_c1 3300050512 Unclassified 1141
301 nmdc:mga0n895_747388_c1 3300050512 Bacteria 971
302 nmdc:mga0n895_78131_c1 3300050512 Bacteria 3294
303 nmdc:mga0rr50_14200_c1 3300050513 Bacteria 5216
304 nmdc:mga0rr50_279447_c1 3300050513 Bacteria 1393
305 nmdc:mga08x19_29282_c1 3300050514 Bacteria 3453
306 nmdc:mga0a205_72028_c1 3300050515 Bacteria 3338
307 Ga0495601_0038750 3300053077 Bacteria 2981
308 Ga0495601_0107654 3300053077 Bacteria 1804
309 Ga0495601_0214664 3300053077 Bacteria 1257
310 Ga0495601_0260111 3300053077 Bacteria 1133
311 Ga0495601_0787382 3300053077 Bacteria 604
312 Ga0495595_0004342 3300053084 Bacteria 5707
313 Ga0495619_0055012 3300053085 Bacteria 2635
314 Ga0495619_0430583 3300053085 Bacteria 910
315 Ga0495619_0651607 3300053085 Unclassified 718
316 Ga0500650_0514230 3300053098 Unclassified 508
317 Ga0501084_0421086 3300054114 Bacteria 1129
318 Ga0501084_1183054 3300054114 Bacteria 641
319 Ga0501082_0385697 3300060353 Bacteria 1223
320 Ga0501082_1839277 3300060353 Bacteria 528
321 Ga0114129_10152698
322 Ga0070658_11341325
323 Ga0070670_101544714
324 Ga0070682_100577468
325 Ga0068868_100644156
326 Ga0070668_101814886
327 Ga0070671_100130055
328 Ga0070674_100871955
329 Ga0070688_100554321
330 Ga0070703_10160232
331 Ga0070713_100067889
332 Ga0070713_100128405
333 Ga0070713_100722386
334 Ga0070713_100983056
335 Ga0070710_10042570
336 Ga0070711_100041824
337 Ga0070705_101012626
338 Ga0070708_100069000
339 Ga0070678_100450660
340 Ga0070678_101188298
341 Ga0070707_100176773
342 Ga0070698_100091804
343 Ga0070684_101020568
344 Ga0070697_100189643
345 Ga0070697_101549595
346 Ga0070695_100090107
347 Ga0070695_100391834
348 Ga0070693_100688287
349 Ga0070704_100010433
350 Ga0068864_100565006
351 Ga0068864_101647551
352 Ga0068858_100011006
353 Ga0068862_102205577
354 Ga0081455_10036836
355 Ga0081455_10226719
356 Ga0081539_10008503
357 Ga0070717_10228135
358 Ga0075365_10108794
359 Ga0075365_10187644
360 Ga0075365_10622967
361 Ga0075368_10075080
362 Ga0075363_100057662
363 Ga0075364_10066969
364 Ga0075364_10161809
365 Ga0075364_10172085
366 Ga0075364_11065542
367 Ga0070716_100486513
368 Ga0070712_100038748
369 Ga0070712_101188739
370 Ga0075362_10314068
371 Ga0075367_10181136
372 Ga0075367_10292539
373 Ga0075428_100386414
374 Ga0075428_101233911
375 Ga0075428_101455936
376 Ga0075430_100122002
377 Ga0075430_100230860
378 Ga0075431_100034503
379 Ga0075431_100035994
380 Ga0075431_100269141
381 Ga0075434_100014605
382 Ga0075434_100250656
383 Ga0075434_100816051
384 Ga0075429_100060181
385 Ga0075429_100772512
386 Ga0068865_100858130
387 Ga0075436_100023547
388 Ga0075435_100007941
389 Ga0075435_100147754
390 Ga0075435_100447935
391 Ga0111539_11857515
392 Ga0105245_10018401
393 Ga0105245_10032937
394 Ga0105245_10500788
395 Ga0105245_10713613
396 Ga0105247_10621946
397 Ga0114129_10915627
398 Ga0105243_10484949
399 Ga0105243_10720714
400 Ga0105241_10898843
401 Ga0105242_10056186
402 Ga0105242_10057225
403 Ga0105242_11708201
404 Ga0105248_11304486
405 Ga0105239_10287745
406 Ga0105246_11544635
407 Ga0105246_11791177
408 Ga0157378_10669311
409 Ga0157375_10806075
410 Ga0157375_12861981
411 Ga0163163_10226623
412 Ga0163163_10627363
413 Ga0163163_11284964
414 Ga0157379_10823188
415 Ga0157376_10297254
416 Ga0163161_10433146
417 Ga0224572_1007490
418 Ga0207653_10140191
419 Ga0207692_10057250
420 Ga0207710_10182585
421 Ga0207699_10107640
422 Ga0207684_10181270
423 Ga0207684_10295979
424 Ga0207693_10094706
425 Ga0207663_10179355
426 Ga0207657_10311047
427 Ga0207646_10290470
428 Ga0207646_10359672
429 Ga0207687_10378167
430 Ga0207687_10836586
431 Ga0207687_11277467
432 Ga0207700_10033514
433 Ga0207700_11628826
434 Ga0207664_10103867
435 Ga0207644_10292440
436 Ga0207686_10252525
437 Ga0207704_10791250
438 Ga0207665_10056788
439 Ga0207661_10440497
440 Ga0207677_10142586
441 Ga0207703_10007366
442 Ga0207641_11650776
443 Ga0207648_10939392
444 Ga0207676_10599564
445 Ga0207683_10060130
446 Ga0209813_10081567
447 Ga0265319_1194057
448 Ga0265338_10060769
449 Ga0265327_10026927
450 Ga0265327_10078779
451 Ga0265327_10087704
452 Ga0265316_10622112
453 Ga0307416_102450052
454 Ga0307415_101559863
455 Ga0373930_0007110
456 Ga0373930_0097378
457 Ga0373948_0006468
458 Ga0373928_0003829
459 Ga0373923_0190671
460 Ga0373932_0005945
461 Ga0373957_0243959
462 Ga0373931_0000010
463 Ga0373931_0000052
464 Ga0373935_0238443
465 Ga0373935_0901905
466 Ga0373933_0120030
467 Ga0373937_0344406
468 Ga0373937_0853770
469 Ga0436360_0097357
470 Ga0436360_0572826
471 Ga0436363_0113831
472 Ga0436363_0675689
473 Ga0436362_0502360
474 Ga0436362_1025074
475 Ga0451797_0394768
476 Ga0451798_0464880
477 Ga0451807_0085275
478 Ga0451849_1517555
479 Ga0495603_0574254
480 Ga0495590_0247265
481 Ga0495641_0213651
482 Ga0495651_0018870
483 Ga0495651_0308587
484 Ga0495651_0335297
485 Ga0495653_0423264
486 Ga0495580_0721766
487 Ga0495582_0137025
488 Ga0495582_0244247
489 Ga0495582_0488301
490 Ga0495584_0226248
491 Ga0495608_0068451
492 Ga0495630_0104859
493 Ga0495630_0618502
494 Ga0495630_1413028
495 Ga0495652_0344472
496 Ga0495640_0814848
497 Ga0495587_0064215
498 Ga0495667_0005120
499 Ga0495667_0351662
500 Ga0495656_0345915
501 Ga0495668_0634941
502 Ga0495611_0349105
503 Ga0495611_0410475
504 Ga0495635_0784516
505 Ga0495657_0009073
506 Ga0495657_0234704
507 Ga0495647_0041178
508 Ga0495658_0665845
509 Ga0495613_0336817
510 Ga0495589_0138152
511 Ga0495589_0205626
512 Ga0495600_0647113
513 Ga0495581_0136498
514 Ga0495604_0070363
515 Ga0495604_0377139
516 Ga0495674_0659695
517 Ga0495674_0665672
518 Ga0495674_0714730
519 Ga0495680_0002483
520 Ga0495680_0407073
521 Ga0495675_0107832
522 Ga0495684_0916460
523 Ga0495593_0446661
524 Ga0495602_0380165
525 Ga0495614_0046755
526 Ga0496100_0029123
527 Ga0496100_1364778
528 Ga0496101_0819831
529 Ga0496102_0012668
530 Ga0496103_0046655
531 Ga0496104_0106426
532 Ga0496104_1463163
533 Ga0496105_0011643
534 Ga0496105_0034998
535 Ga0496105_0489020
536 Ga0496106_0033184
537 Ga0496108_1022245
538 Ga0496109_0454467
539 Ga0496109_0893610
540 Ga0496109_0946677
541 Ga0496109_1575696
542 Ga0496110_0195712
543 Ga0496110_0313180
544 Ga0496112_0009733
545 Ga0496112_0206877
546 Ga0496113_0029994
547 Ga0496113_0939929
548 Ga0496113_1011752
549 Ga0496114_0070870
550 Ga0496115_0010861
551 Ga0496126_0335444
552 Ga0501032_0001606
553 Ga0501032_0349550
554 Ga0501034_0000888
555 Ga0501034_0049852
556 Ga0501034_0115644
557 Ga0501034_0261949
558 Ga0501034_0810015
559 Ga0501036_0243812
560 Ga0501036_0282153
561 Ga0501037_0001614
562 Ga0501037_0046043
563 Ga0501037_0575764
564 Ga0501038_0061343
565 Ga0501039_0959629
566 Ga0501043_0464215
567 Ga0501047_0028678
568 Ga0501048_0274750
569 Ga0501067_0019421
570 Ga0501067_0166544
571 Ga0501068_0000026
572 Ga0501068_0099635
573 Ga0501070_0014098
574 Ga0501070_0101690
575 Ga0501070_0164870
576 Ga0501070_0594288
577 Ga0501070_1037805
578 Ga0501071_0423383
579 Ga0501071_1130537
580 Ga0501072_0018012
581 Ga0501073_0012092
582 Ga0501073_0236085
583 Ga0501073_0751122
584 Ga0501074_0001393
585 Ga0501074_0014686
586 Ga0501074_1326584
587 Ga0501075_0479481
588 Ga0501076_0073857
589 Ga0501080_0000773
590 Ga0501080_0094094
591 Ga0501083_0120519
592 Ga0501083_0150985
593 Ga0501035_0057425
594 Ga0501044_0003535
595 nmdc:mga03683_102081_c1
596 nmdc:mga03683_45745_c1
597 nmdc:mga03n38_168363_c1
598 nmdc:mga03n38_280518_c1
599 nmdc:mga03n38_324160_c1
600 nmdc:mga00v17_316093_c1
601 nmdc:mga00v17_480491_c1
602 nmdc:mga00v17_567354_c1
603 nmdc:mga00v17_62508_c1
604 nmdc:mga00v17_87667_c1
605 nmdc:mga00v17_935102_c1
606 nmdc:mga0yw44_112209_c1
607 nmdc:mga0yw44_43385_c1
608 nmdc:mga0yw44_509746_c1
609 nmdc:mga0yw44_5167_c1
610 nmdc:mga0yw44_91270_c1
611 nmdc:mga06z11_377203_c1
612 nmdc:mga04h51_74377_c1
613 nmdc:mga09592_402484_c1
614 nmdc:mga09592_50597_c1
615 nmdc:mga0qj67_464712_c1
616 nmdc:mga0qj67_606059_c1
617 nmdc:mga06r32_483603_c1
618 nmdc:mga06r32_858868_c1
619 nmdc:mga06r32_86869_c1
620 nmdc:mga0n895_566636_c1
621 nmdc:mga0n895_747388_c1
622 nmdc:mga0n895_78131_c1
623 nmdc:mga0rr50_14200_c1
624 nmdc:mga0rr50_279447_c1
625 nmdc:mga08x19_29282_c1
626 nmdc:mga0a205_72028_c1
627 Ga0495601_0038750
628 Ga0495601_0107654
629 Ga0495601_0214664
630 Ga0495601_0260111
631 Ga0495601_0787382
632 Ga0495595_0004342
633 Ga0495619_0055012
634 Ga0495619_0430583
635 Ga0495619_0651607
636 Ga0500650_0514230
637 Ga0501084_0421086
638 Ga0501084_1183054
639 Ga0501082_0385697
640 Ga0501082_1839277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14464

Prok-JAB

Prokaryotic homologs of the JAB domain

25

146

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ld9-assembly1.cif.gz_B structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.9091 1 133
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.9041 1 135
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.8979 1 135
5ld9-assembly1.cif.gz_B structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8955 1 133
5ld9-assembly1.cif.gz_A structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8795 2 133
ID Description Score Start End Superfamily
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9421 1 135 3.40.140.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9355 1 135 3.40.140.10
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9041 1 135 3.40.140.10
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8979 1 135 3.40.140.10
af_K7UWW6_1_160_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8583 2 133 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A349BBM1-F1-model_v4 Peptidase 0.9976 1 132 GO:0006508
GO:0008235
GO:0008270
AF-A0A522TB21-F1-model_v4 M67 family peptidase 0.9966 1 132 GO:0006508
GO:0008235
GO:0008270
GO:0016020
AF-A0A6J7U8B0-F1-model_v4 Unannotated protein 0.9946 41 132 GO:0006508
GO:0008235
GO:0008270
AF-A0A7V9GHT0-F1-model_v4 M67 family metallopeptidase 0.9918 1 133 GO:0006508
GO:0008235
GO:0008270
AF-A0A7K1DJZ2-F1-model_v4 JAB1/MPN/MOV34 metalloenzyme domain-containing protein 0.9905 2 132 GO:0006508
GO:0008235
GO:0008270

Map