F405443

General Info

Members Datasets Scaffolds Average Seq Length
320 170 640 95

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100001640|Ga0070665_10000164011
Length 112
Sequence VPREDISEVTGFCLAEGMDLEFAGPLFEWRGPAPYHFVAVPDDEADQIRETAAFVTYGWGMIPVHGRIGDTDFTTALWPKDGGYVVPIKDAVRTPEGLDLGDEITVRLTIDV

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
101 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
102 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
103 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
104 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
105 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.75
Nodule 0
Rhizoplane 19.69
Rhizosphere 70.62
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100001640 3300005548 Bacteria 25777
2 JGI24740J21852_10089915 3300001979 Bacteria 793
3 JGI24735J21928_10001878 3300002067 Bacteria 7371
4 Ga0070658_10050238 3300005327 Bacteria 3380
5 Ga0070683_100244078 3300005329 Bacteria 1708
6 Ga0070683_100629983 3300005329 Bacteria 1027
7 Ga0070683_101194111 3300005329 Bacteria 731
8 Ga0070680_100045040 3300005336 Bacteria 3586
9 Ga0070682_100476281 3300005337 Bacteria 962
10 Ga0070682_100600813 3300005337 Bacteria 869
11 Ga0068868_100752605 3300005338 Bacteria 876
12 Ga0070660_100088795 3300005339 Bacteria 2434
13 Ga0070689_101221949 3300005340 Bacteria 675
14 Ga0070687_100127135 3300005343 Bacteria 1466
15 Ga0070668_100394131 3300005347 Bacteria 1181
16 Ga0070668_101213186 3300005347 Bacteria 684
17 Ga0070675_100699128 3300005354 Bacteria 923
18 Ga0070667_100226382 3300005367 Bacteria 1666
19 Ga0070701_10810700 3300005438 Bacteria 639
20 Ga0070678_100786591 3300005456 Bacteria 863
21 Ga0070681_10746981 3300005458 Bacteria 895
22 Ga0070681_11336609 3300005458 Bacteria 640
23 Ga0070685_10492741 3300005466 Bacteria 866
24 Ga0070679_100009609 3300005530 Bacteria 9149
25 Ga0070679_100947024 3300005530 Bacteria 805
26 Ga0070684_100015208 3300005535 Bacteria 6258
27 Ga0070684_100034681 3300005535 Bacteria 4316
28 Ga0070684_100181283 3300005535 Bacteria 1915
29 Ga0068853_100779256 3300005539 Bacteria 915
30 Ga0068853_100821074 3300005539 Bacteria 891
31 Ga0068853_101437906 3300005539 Bacteria 667
32 Ga0068853_101600633 3300005539 Bacteria 631
33 Ga0070686_100271446 3300005544 Bacteria 1247
34 Ga0070695_101878218 3300005545 Bacteria 503
35 Ga0070665_101728110 3300005548 Bacteria 633
36 Ga0070664_100235055 3300005564 Bacteria 1644
37 Ga0068857_101387590 3300005577 Bacteria 683
38 Ga0068856_100079127 3300005614 Bacteria 3260
39 Ga0070702_100256013 3300005615 Bacteria 1189
40 Ga0068864_100028888 3300005618 Bacteria 4692
41 Ga0068864_100802758 3300005618 Bacteria 925
42 Ga0068864_101262229 3300005618 Bacteria 738
43 Ga0068866_10211810 3300005718 Bacteria 1164
44 Ga0068861_100151910 3300005719 Bacteria 1901
45 Ga0068861_101664192 3300005719 Bacteria 630
46 Ga0068851_10281480 3300005834 Bacteria 951
47 Ga0068858_101634836 3300005842 Bacteria 636
48 Ga0068860_100220550 3300005843 Bacteria 1841
49 Ga0068860_101209810 3300005843 Bacteria 776
50 Ga0075365_10151733 3300006038 Bacteria 1612
51 Ga0075365_10171609 3300006038 Bacteria 1514
52 Ga0075365_10681404 3300006038 Bacteria 726
53 Ga0075365_10766041 3300006038 Bacteria 681
54 Ga0075368_10008851 3300006042 Bacteria 3606
55 Ga0075363_100004595 3300006048 Bacteria 6058
56 Ga0075363_100305526 3300006048 Bacteria 924
57 Ga0075363_100762985 3300006048 Bacteria 587
58 Ga0075364_10024993 3300006051 Bacteria 3799
59 Ga0075364_10776054 3300006051 Bacteria 653
60 Ga0075367_10005287 3300006178 Bacteria 6389
61 Ga0075370_10041421 3300006353 Bacteria 2600
62 Ga0075370_10599915 3300006353 Bacteria 667
63 Ga0068865_100020525 3300006881 Bacteria 4285
64 Ga0105245_10370414 3300009098 Bacteria 1424
65 Ga0105245_10525324 3300009098 Bacteria 1203
66 Ga0105245_10901513 3300009098 Bacteria 926
67 Ga0105247_10582981 3300009101 Bacteria 827
68 Ga0105243_10481640 3300009148 Bacteria 1171
69 Ga0105241_12651132 3300009174 Bacteria 504
70 Ga0105242_10856737 3300009176 Bacteria 905
71 Ga0105242_11094072 3300009176 Bacteria 811
72 Ga0105248_10855546 3300009177 Bacteria 1027
73 Ga0105248_11623815 3300009177 Bacteria 732
74 Ga0105237_10098983 3300009545 Bacteria 2907
75 Ga0105237_11907954 3300009545 Bacteria 602
76 Ga0105238_10295839 3300009551 Bacteria 1602
77 Ga0105238_12384615 3300009551 Bacteria 565
78 Ga0105249_10015012 3300009553 Bacteria 6851
79 Ga0105249_12888806 3300009553 Bacteria 551
80 Ga0105239_10004561 3300010375 Bacteria 16514
81 Ga0105239_10931111 3300010375 Bacteria 998
82 Ga0105246_10002872 3300011119 Bacteria 10424
83 Ga0105246_10061151 3300011119 Bacteria 2619
84 Ga0157371_10237987 3300013102 Bacteria 1309
85 Ga0157370_11837876 3300013104 Bacteria 544
86 Ga0157369_10370509 3300013105 Bacteria 1487
87 Ga0157369_11207135 3300013105 Bacteria 772
88 Ga0157369_11694515 3300013105 Bacteria 642
89 Ga0157374_11774543 3300013296 Bacteria 642
90 Ga0157378_12204717 3300013297 Bacteria 602
91 Ga0163162_10066072 3300013306 Bacteria 3665
92 Ga0163162_10903849 3300013306 Bacteria 996
93 Ga0163162_11443042 3300013306 Bacteria 783
94 Ga0163162_12432214 3300013306 Bacteria 602
95 Ga0157372_10428582 3300013307 Bacteria 1542
96 Ga0157372_10515845 3300013307 Bacteria 1393
97 Ga0157372_10951301 3300013307 Bacteria 996
98 Ga0157372_12967002 3300013307 Bacteria 543
99 Ga0157375_10079345 3300013308 Bacteria 3318
100 Ga0157375_10313005 3300013308 Bacteria 1734
101 Ga0157375_10753424 3300013308 Bacteria 1125
102 Ga0157375_10808556 3300013308 Bacteria 1086
103 Ga0157375_10834380 3300013308 Bacteria 1069
104 Ga0157375_11065228 3300013308 Bacteria 945
105 Ga0157375_12066445 3300013308 Bacteria 678
106 Ga0163163_10087948 3300014325 Bacteria 3118
107 Ga0163163_12376993 3300014325 Bacteria 588
108 Ga0157377_10431052 3300014745 Bacteria 906
109 Ga0157379_10173908 3300014968 Bacteria 1944
110 Ga0157379_10946687 3300014968 Bacteria 819
111 Ga0157376_11142622 3300014969 Bacteria 806
112 Ga0206356_11581159 3300020070 Bacteria 509
113 Ga0207642_10184088 3300025899 Bacteria 1141
114 Ga0207688_10341939 3300025901 Bacteria 921
115 Ga0207647_10024904 3300025904 Bacteria 3940
116 Ga0207705_10243770 3300025909 Bacteria 1369
117 Ga0207707_10320559 3300025912 Bacteria 1338
118 Ga0207671_10784430 3300025914 Bacteria 756
119 Ga0207660_10843938 3300025917 Bacteria 748
120 Ga0207662_10038235 3300025918 Bacteria 2811
121 Ga0207657_10022944 3300025919 Bacteria 5823
122 Ga0207657_10842698 3300025919 Bacteria 708
123 Ga0207652_10379711 3300025921 Bacteria 1275
124 Ga0207652_10453038 3300025921 Bacteria 1156
125 Ga0207652_10906123 3300025921 Bacteria 779
126 Ga0207659_10944250 3300025926 Bacteria 742
127 Ga0207687_10460495 3300025927 Bacteria 1056
128 Ga0207687_10744483 3300025927 Bacteria 834
129 Ga0207690_10310703 3300025932 Bacteria 1236
130 Ga0207686_11004978 3300025934 Bacteria 677
131 Ga0207709_11214096 3300025935 Bacteria 622
132 Ga0207691_10801697 3300025940 Bacteria 791
133 Ga0207711_10809111 3300025941 Bacteria 873
134 Ga0207661_10687526 3300025944 Bacteria 941
135 Ga0207661_10711567 3300025944 Bacteria 924
136 Ga0207661_10878833 3300025944 Bacteria 825
137 Ga0207661_11964879 3300025944 Bacteria 531
138 Ga0207679_10057608 3300025945 Bacteria 2875
139 Ga0207667_10486234 3300025949 Bacteria 1253
140 Ga0207712_10034701 3300025961 Bacteria 3420
141 Ga0207668_10580267 3300025972 Bacteria 975
142 Ga0207668_11590420 3300025972 Bacteria 590
143 Ga0207658_10161864 3300025986 Bacteria 1835
144 Ga0207703_10037633 3300026035 Bacteria 3855
145 Ga0207639_10245506 3300026041 Bacteria 1559
146 Ga0207639_10489044 3300026041 Bacteria 1123
147 Ga0207708_10670963 3300026075 Bacteria 884
148 Ga0207676_11088396 3300026095 Bacteria 790
149 Ga0207676_11117541 3300026095 Bacteria 779
150 Ga0207674_11058802 3300026116 Bacteria 780
151 Ga0207683_10102128 3300026121 Bacteria 2560
152 Ga0207698_10433972 3300026142 Bacteria 1264
153 Ga0209813_10002620 3300027866 Bacteria 4132
154 Ga0268266_10003007 3300028379 Bacteria 17329
155 Ga0268266_11596984 3300028379 Bacteria 628
156 Ga0268264_10133397 3300028381 Bacteria 2205
157 Ga0268264_11900269 3300028381 Bacteria 605
158 Ga0373925_1739517 3300037068 Bacteria 509
159 Ga0436365_1264187 3300039437 Bacteria 1339
160 Ga0451787_281729 3300041441 Bacteria 588
161 Ga0451797_0374431 3300041453 Bacteria 675
162 Ga0451795_0016451 3300041456 Bacteria 604
163 Ga0451800_0554632 3300041459 Bacteria 735
164 Ga0451833_0759813 3300041491 Bacteria 631
165 Ga0451837_1485877 3300041494 Bacteria 611
166 Ga0466963_0235163 3300044694 Bacteria 1284
167 Ga0466963_0330362 3300044694 Bacteria 1073
168 Ga0466963_0332736 3300044694 Bacteria 1069
169 Ga0466963_0864675 3300044694 Bacteria 637
170 Ga0466970_0141003 3300044765 Bacteria 1328
171 Ga0466960_0009961 3300044901 Bacteria 3935
172 Ga0466960_0098062 3300044901 Bacteria 1505
173 Ga0466967_0048129 3300045976 Bacteria 3722
174 Ga0466967_0053381 3300045976 Bacteria 3551
175 Ga0466967_0073975 3300045976 Bacteria 3058
176 Ga0466967_0110350 3300045976 Bacteria 2526
177 Ga0466967_0148397 3300045976 Bacteria 2189
178 Ga0466967_0287199 3300045976 Bacteria 1579
179 Ga0466967_0392883 3300045976 Bacteria 1348
180 Ga0466967_1457321 3300045976 Unclassified 682
181 Ga0466967_1874444 3300045976 Bacteria 596
182 Ga0495603_0044563 3300046455 Bacteria 2647
183 Ga0495639_0507095 3300046475 Bacteria 616
184 Ga0495584_0597279 3300046491 Bacteria 563
185 Ga0495608_0177682 3300046511 Bacteria 1348
186 Ga0495620_0334351 3300046515 Bacteria 575
187 Ga0495632_0318119 3300046519 Bacteria 688
188 Ga0495635_0281646 3300046663 Bacteria 1117
189 Ga0495588_0699609 3300046674 Bacteria 530
190 Ga0495657_0609972 3300046675 Bacteria 631
191 Ga0495658_0130894 3300046683 Bacteria 1527
192 Ga0495658_0708659 3300046683 Bacteria 645
193 Ga0495600_0346006 3300046809 Bacteria 932
194 Ga0495614_0453450 3300048089 Bacteria 607
195 Ga0496100_0161766 3300048903 Bacteria 1605
196 Ga0496100_0214528 3300048903 Bacteria 1410
197 Ga0496100_0246922 3300048903 Bacteria 1319
198 Ga0496100_0407729 3300048903 Bacteria 1036
199 Ga0496101_0085752 3300048904 Bacteria 2334
200 Ga0496101_0127264 3300048904 Bacteria 1931
201 Ga0496101_0172724 3300048904 Bacteria 1662
202 Ga0496101_0246518 3300048904 Bacteria 1391
203 Ga0496101_1277991 3300048904 Bacteria 574
204 Ga0496102_0104074 3300048905 Bacteria 2640
205 Ga0496102_0185522 3300048905 Bacteria 1960
206 Ga0496102_0606230 3300048905 Bacteria 1018
207 Ga0496102_1407141 3300048905 Bacteria 616
208 Ga0496102_1600596 3300048905 Bacteria 570
209 Ga0496103_0058117 3300048906 Bacteria 2403
210 Ga0496103_0338487 3300048906 Bacteria 967
211 Ga0496104_0013511 3300048907 Bacteria 7356
212 Ga0496105_0014415 3300048908 Bacteria 6292
213 Ga0496105_0221988 3300048908 Bacteria 1538
214 Ga0496105_0615899 3300048908 Bacteria 841
215 Ga0496106_0133213 3300048909 Bacteria 1950
216 Ga0496106_0248469 3300048909 Bacteria 1422
217 Ga0496106_1430921 3300048909 Bacteria 533
218 Ga0496107_0005986 3300048910 Bacteria 8337
219 Ga0496107_0022950 3300048910 Bacteria 4411
220 Ga0496107_0112837 3300048910 Bacteria 1999
221 Ga0496108_0192052 3300048911 Bacteria 1770
222 Ga0496108_0211806 3300048911 Bacteria 1682
223 Ga0496108_0221462 3300048911 Bacteria 1644
224 Ga0496108_0323941 3300048911 Bacteria 1343
225 Ga0496108_1377049 3300048911 Bacteria 591
226 Ga0496109_0103567 3300048912 Bacteria 2642
227 Ga0496109_0117454 3300048912 Bacteria 2476
228 Ga0496109_0330563 3300048912 Bacteria 1439
229 Ga0496109_0405849 3300048912 Bacteria 1287
230 Ga0496109_0419440 3300048912 Bacteria 1264
231 Ga0496109_1737934 3300048912 Bacteria 557
232 Ga0496110_0014089 3300048913 Bacteria 6629
233 Ga0496110_0280577 3300048913 Bacteria 1517
234 Ga0496110_0288370 3300048913 Bacteria 1495
235 Ga0496111_0146180 3300048914 Bacteria 1753
236 Ga0496111_0160096 3300048914 Bacteria 1671
237 Ga0496111_0234382 3300048914 Bacteria 1363
238 Ga0496111_0444977 3300048914 Bacteria 956
239 Ga0496111_1014501 3300048914 Bacteria 594
240 Ga0496112_1439814 3300048915 Bacteria 603
241 Ga0496113_0157915 3300048916 Bacteria 1792
242 Ga0496113_0220643 3300048916 Bacteria 1511
243 Ga0496113_0690151 3300048916 Bacteria 815
244 Ga0496114_0005388 3300048917 Bacteria 10004
245 Ga0496114_0011315 3300048917 Bacteria 7126
246 Ga0496114_0018419 3300048917 Bacteria 5645
247 Ga0496114_0056451 3300048917 Bacteria 3277
248 Ga0496114_0159096 3300048917 Bacteria 1963
249 Ga0496114_0173962 3300048917 Bacteria 1878
250 Ga0496114_1108411 3300048917 Bacteria 676
251 Ga0496115_0029106 3300048918 Bacteria 4336
252 Ga0496115_0100049 3300048918 Bacteria 2376
253 Ga0496115_0115750 3300048918 Bacteria 2205
254 Ga0501032_0171480 3300049569 Bacteria 1423
255 Ga0501032_0949642 3300049569 Bacteria 541
256 Ga0501033_0714309 3300049570 Bacteria 681
257 Ga0501034_0015726 3300049571 Bacteria 7770
258 Ga0501034_0400003 3300049571 Bacteria 1296
259 Ga0501036_0174428 3300049572 Bacteria 1811
260 Ga0501037_0422450 3300049573 Bacteria 912
261 Ga0501039_1494834 3300049575 Bacteria 519
262 Ga0501040_0527665 3300049576 Bacteria 852
263 Ga0501042_0328601 3300049578 Bacteria 1105
264 Ga0501043_0855609 3300049579 Bacteria 655
265 Ga0501047_0163516 3300049581 Bacteria 2097
266 Ga0501047_0802330 3300049581 Bacteria 756
267 Ga0501048_0629848 3300049582 Bacteria 770
268 Ga0501067_0021231 3300049583 Bacteria 3592
269 Ga0501067_0135025 3300049583 Bacteria 1373
270 Ga0501068_0352819 3300049584 Bacteria 945
271 Ga0501069_0071363 3300049585 Bacteria 1946
272 Ga0501069_0134470 3300049585 Bacteria 1417
273 Ga0501069_0219529 3300049585 Bacteria 1104
274 Ga0501070_0001075 3300049586 Bacteria 24476
275 Ga0501070_0009188 3300049586 Bacteria 8355
276 Ga0501070_0024140 3300049586 Bacteria 5098
277 Ga0501070_0078206 3300049586 Bacteria 2738
278 Ga0501071_0001601 3300049587 Bacteria 13271
279 Ga0501071_0354942 3300049587 Bacteria 1116
280 Ga0501071_0906929 3300049587 Bacteria 680
281 Ga0501072_0055331 3300049588 Bacteria 3127
282 Ga0501072_0196508 3300049588 Bacteria 1608
283 Ga0501073_0003948 3300049589 Bacteria 11124
284 Ga0501073_0114406 3300049589 Bacteria 1870
285 Ga0501074_0145569 3300049590 Bacteria 1694
286 Ga0501074_0159573 3300049590 Bacteria 1610
287 Ga0501074_0190728 3300049590 Bacteria 1461
288 Ga0501074_0380329 3300049590 Bacteria 1002
289 Ga0501077_0010923 3300049593 Bacteria 5659
290 Ga0501077_0201460 3300049593 Bacteria 1264
291 Ga0501079_0434649 3300049741 Bacteria 1030
292 Ga0501080_0268751 3300049742 Bacteria 1552
293 Ga0501080_0526409 3300049742 Bacteria 1054
294 Ga0501083_0077015 3300049744 Bacteria 2213
295 Ga0501083_0256665 3300049744 Bacteria 1137
296 Ga0501035_0436086 3300049822 Bacteria 1086
297 Ga0501044_0135932 3300049823 Bacteria 2450
298 Ga0501044_0805897 3300049823 Bacteria 818
299 Ga0501044_0862226 3300049823 Bacteria 782
300 nmdc:mga03n38_617295_c1 3300050490 Bacteria 619
301 nmdc:mga03n38_67035_c1 3300050490 Bacteria 1651
302 nmdc:mga00v17_209637_c1 3300050491 Unclassified 1261
303 nmdc:mga00v17_60054_c1 3300050491 Bacteria 2334
304 nmdc:mga0yw44_109437_c1 3300050492 Bacteria 1769
305 nmdc:mga0yw44_164273_c1 3300050492 Bacteria 1455
306 nmdc:mga0yw44_168679_c1 3300050492 Bacteria 1436
307 nmdc:mga0yw44_901415_c1 3300050492 Bacteria 600
308 nmdc:mga0yw44_901831_c1 3300050492 Bacteria 599
309 nmdc:mga0yw44_93150_c1 3300050492 Bacteria 1907
310 nmdc:mga04h51_10092_c1 3300050495 Bacteria 2584
311 nmdc:mga07m45_465837_c1 3300050496 Bacteria 733
312 nmdc:mga07m45_512482_c1 3300050496 Bacteria 694
313 nmdc:mga07m45_836660_c1 3300050496 Bacteria 527
314 Ga0495601_0161651 3300053077 Bacteria 1464
315 Ga0501084_0028529 3300054114 Bacteria 4666
316 Ga0501084_0626304 3300054114 Bacteria 908
317 Ga0501084_1771391 3300054114 Bacteria 516
318 Ga0501082_0055838 3300060353 Bacteria 3401
319 Ga0501082_0116828 3300060353 Bacteria 2310
320 Ga0501082_0723394 3300060353 Bacteria 871
321 Ga0070665_100001640
322 JGI24740J21852_10089915
323 JGI24735J21928_10001878
324 Ga0070658_10050238
325 Ga0070683_100244078
326 Ga0070683_100629983
327 Ga0070683_101194111
328 Ga0070680_100045040
329 Ga0070682_100476281
330 Ga0070682_100600813
331 Ga0068868_100752605
332 Ga0070660_100088795
333 Ga0070689_101221949
334 Ga0070687_100127135
335 Ga0070668_100394131
336 Ga0070668_101213186
337 Ga0070675_100699128
338 Ga0070667_100226382
339 Ga0070701_10810700
340 Ga0070678_100786591
341 Ga0070681_10746981
342 Ga0070681_11336609
343 Ga0070685_10492741
344 Ga0070679_100009609
345 Ga0070679_100947024
346 Ga0070684_100015208
347 Ga0070684_100034681
348 Ga0070684_100181283
349 Ga0068853_100779256
350 Ga0068853_100821074
351 Ga0068853_101437906
352 Ga0068853_101600633
353 Ga0070686_100271446
354 Ga0070695_101878218
355 Ga0070665_101728110
356 Ga0070664_100235055
357 Ga0068857_101387590
358 Ga0068856_100079127
359 Ga0070702_100256013
360 Ga0068864_100028888
361 Ga0068864_100802758
362 Ga0068864_101262229
363 Ga0068866_10211810
364 Ga0068861_100151910
365 Ga0068861_101664192
366 Ga0068851_10281480
367 Ga0068858_101634836
368 Ga0068860_100220550
369 Ga0068860_101209810
370 Ga0075365_10151733
371 Ga0075365_10171609
372 Ga0075365_10681404
373 Ga0075365_10766041
374 Ga0075368_10008851
375 Ga0075363_100004595
376 Ga0075363_100305526
377 Ga0075363_100762985
378 Ga0075364_10024993
379 Ga0075364_10776054
380 Ga0075367_10005287
381 Ga0075370_10041421
382 Ga0075370_10599915
383 Ga0068865_100020525
384 Ga0105245_10370414
385 Ga0105245_10525324
386 Ga0105245_10901513
387 Ga0105247_10582981
388 Ga0105243_10481640
389 Ga0105241_12651132
390 Ga0105242_10856737
391 Ga0105242_11094072
392 Ga0105248_10855546
393 Ga0105248_11623815
394 Ga0105237_10098983
395 Ga0105237_11907954
396 Ga0105238_10295839
397 Ga0105238_12384615
398 Ga0105249_10015012
399 Ga0105249_12888806
400 Ga0105239_10004561
401 Ga0105239_10931111
402 Ga0105246_10002872
403 Ga0105246_10061151
404 Ga0157371_10237987
405 Ga0157370_11837876
406 Ga0157369_10370509
407 Ga0157369_11207135
408 Ga0157369_11694515
409 Ga0157374_11774543
410 Ga0157378_12204717
411 Ga0163162_10066072
412 Ga0163162_10903849
413 Ga0163162_11443042
414 Ga0163162_12432214
415 Ga0157372_10428582
416 Ga0157372_10515845
417 Ga0157372_10951301
418 Ga0157372_12967002
419 Ga0157375_10079345
420 Ga0157375_10313005
421 Ga0157375_10753424
422 Ga0157375_10808556
423 Ga0157375_10834380
424 Ga0157375_11065228
425 Ga0157375_12066445
426 Ga0163163_10087948
427 Ga0163163_12376993
428 Ga0157377_10431052
429 Ga0157379_10173908
430 Ga0157379_10946687
431 Ga0157376_11142622
432 Ga0206356_11581159
433 Ga0207642_10184088
434 Ga0207688_10341939
435 Ga0207647_10024904
436 Ga0207705_10243770
437 Ga0207707_10320559
438 Ga0207671_10784430
439 Ga0207660_10843938
440 Ga0207662_10038235
441 Ga0207657_10022944
442 Ga0207657_10842698
443 Ga0207652_10379711
444 Ga0207652_10453038
445 Ga0207652_10906123
446 Ga0207659_10944250
447 Ga0207687_10460495
448 Ga0207687_10744483
449 Ga0207690_10310703
450 Ga0207686_11004978
451 Ga0207709_11214096
452 Ga0207691_10801697
453 Ga0207711_10809111
454 Ga0207661_10687526
455 Ga0207661_10711567
456 Ga0207661_10878833
457 Ga0207661_11964879
458 Ga0207679_10057608
459 Ga0207667_10486234
460 Ga0207712_10034701
461 Ga0207668_10580267
462 Ga0207668_11590420
463 Ga0207658_10161864
464 Ga0207703_10037633
465 Ga0207639_10245506
466 Ga0207639_10489044
467 Ga0207708_10670963
468 Ga0207676_11088396
469 Ga0207676_11117541
470 Ga0207674_11058802
471 Ga0207683_10102128
472 Ga0207698_10433972
473 Ga0209813_10002620
474 Ga0268266_10003007
475 Ga0268266_11596984
476 Ga0268264_10133397
477 Ga0268264_11900269
478 Ga0373925_1739517
479 Ga0436365_1264187
480 Ga0451787_281729
481 Ga0451797_0374431
482 Ga0451795_0016451
483 Ga0451800_0554632
484 Ga0451833_0759813
485 Ga0451837_1485877
486 Ga0466963_0235163
487 Ga0466963_0330362
488 Ga0466963_0332736
489 Ga0466963_0864675
490 Ga0466970_0141003
491 Ga0466960_0009961
492 Ga0466960_0098062
493 Ga0466967_0048129
494 Ga0466967_0053381
495 Ga0466967_0073975
496 Ga0466967_0110350
497 Ga0466967_0148397
498 Ga0466967_0287199
499 Ga0466967_0392883
500 Ga0466967_1457321
501 Ga0466967_1874444
502 Ga0495603_0044563
503 Ga0495639_0507095
504 Ga0495584_0597279
505 Ga0495608_0177682
506 Ga0495620_0334351
507 Ga0495632_0318119
508 Ga0495635_0281646
509 Ga0495588_0699609
510 Ga0495657_0609972
511 Ga0495658_0130894
512 Ga0495658_0708659
513 Ga0495600_0346006
514 Ga0495614_0453450
515 Ga0496100_0161766
516 Ga0496100_0214528
517 Ga0496100_0246922
518 Ga0496100_0407729
519 Ga0496101_0085752
520 Ga0496101_0127264
521 Ga0496101_0172724
522 Ga0496101_0246518
523 Ga0496101_1277991
524 Ga0496102_0104074
525 Ga0496102_0185522
526 Ga0496102_0606230
527 Ga0496102_1407141
528 Ga0496102_1600596
529 Ga0496103_0058117
530 Ga0496103_0338487
531 Ga0496104_0013511
532 Ga0496105_0014415
533 Ga0496105_0221988
534 Ga0496105_0615899
535 Ga0496106_0133213
536 Ga0496106_0248469
537 Ga0496106_1430921
538 Ga0496107_0005986
539 Ga0496107_0022950
540 Ga0496107_0112837
541 Ga0496108_0192052
542 Ga0496108_0211806
543 Ga0496108_0221462
544 Ga0496108_0323941
545 Ga0496108_1377049
546 Ga0496109_0103567
547 Ga0496109_0117454
548 Ga0496109_0330563
549 Ga0496109_0405849
550 Ga0496109_0419440
551 Ga0496109_1737934
552 Ga0496110_0014089
553 Ga0496110_0280577
554 Ga0496110_0288370
555 Ga0496111_0146180
556 Ga0496111_0160096
557 Ga0496111_0234382
558 Ga0496111_0444977
559 Ga0496111_1014501
560 Ga0496112_1439814
561 Ga0496113_0157915
562 Ga0496113_0220643
563 Ga0496113_0690151
564 Ga0496114_0005388
565 Ga0496114_0011315
566 Ga0496114_0018419
567 Ga0496114_0056451
568 Ga0496114_0159096
569 Ga0496114_0173962
570 Ga0496114_1108411
571 Ga0496115_0029106
572 Ga0496115_0100049
573 Ga0496115_0115750
574 Ga0501032_0171480
575 Ga0501032_0949642
576 Ga0501033_0714309
577 Ga0501034_0015726
578 Ga0501034_0400003
579 Ga0501036_0174428
580 Ga0501037_0422450
581 Ga0501039_1494834
582 Ga0501040_0527665
583 Ga0501042_0328601
584 Ga0501043_0855609
585 Ga0501047_0163516
586 Ga0501047_0802330
587 Ga0501048_0629848
588 Ga0501067_0021231
589 Ga0501067_0135025
590 Ga0501068_0352819
591 Ga0501069_0071363
592 Ga0501069_0134470
593 Ga0501069_0219529
594 Ga0501070_0001075
595 Ga0501070_0009188
596 Ga0501070_0024140
597 Ga0501070_0078206
598 Ga0501071_0001601
599 Ga0501071_0354942
600 Ga0501071_0906929
601 Ga0501072_0055331
602 Ga0501072_0196508
603 Ga0501073_0003948
604 Ga0501073_0114406
605 Ga0501074_0145569
606 Ga0501074_0159573
607 Ga0501074_0190728
608 Ga0501074_0380329
609 Ga0501077_0010923
610 Ga0501077_0201460
611 Ga0501079_0434649
612 Ga0501080_0268751
613 Ga0501080_0526409
614 Ga0501083_0077015
615 Ga0501083_0256665
616 Ga0501035_0436086
617 Ga0501044_0135932
618 Ga0501044_0805897
619 Ga0501044_0862226
620 nmdc:mga03n38_617295_c1
621 nmdc:mga03n38_67035_c1
622 nmdc:mga00v17_209637_c1
623 nmdc:mga00v17_60054_c1
624 nmdc:mga0yw44_109437_c1
625 nmdc:mga0yw44_164273_c1
626 nmdc:mga0yw44_168679_c1
627 nmdc:mga0yw44_901415_c1
628 nmdc:mga0yw44_901831_c1
629 nmdc:mga0yw44_93150_c1
630 nmdc:mga04h51_10092_c1
631 nmdc:mga07m45_465837_c1
632 nmdc:mga07m45_512482_c1
633 nmdc:mga07m45_836660_c1
634 Ga0495601_0161651
635 Ga0501084_0028529
636 Ga0501084_0626304
637 Ga0501084_1771391
638 Ga0501082_0055838
639 Ga0501082_0116828
640 Ga0501082_0723394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08922

DUF1905

Domain of unknown function (DUF1905)

22

108

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8214 1 94
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8126 1 94
5trd-assembly1.cif.gz_B structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator 0.6202 1 94
5trd-assembly1.cif.gz_B structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator 0.6097 1 94
6lb0-assembly1.cif.gz_A the cryo-em structure of hev vlp in complex with fab 8c11 0.5412 2 94
ID Description Score Start End Superfamily
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.8222 1 94 2.40.30.100
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.8132 1 94 2.40.30.100
af_Q8GWU1_1_101_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6365 20 88 2.40.330.10
5trdB02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Riboflavin kinase-like 0.6202 1 94 2.40.30.30
af_Q1G3Z6_2_111_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6194 20 88 2.40.330.10
ID Description Score Start End GO Terms
AF-A0A2D7FQE9-F1-model_v4 DUF1905 domain-containing protein 0.9768 1 93
AF-A0A2K8L1E1-F1-model_v4 DUF1905 domain-containing protein 0.9724 1 95
AF-A0A4R8XUY6-F1-model_v4 DUF1905 domain-containing protein 0.972 1 95
AF-A0A1V5J8K0-F1-model_v4 deleted 0.9717 1 93
AF-A0A1H2D226-F1-model_v4 DUF1905 domain-containing protein 0.9706 1 94

Map