F405176

General Info

Members Datasets Scaffolds Average Seq Length
319 215 638 120

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0701301|Ga0436363_0701301_243_581
Length 112
Sequence MSYAIVKTGGKQYRVEKGQTLLVERLRADAGESVDLQPLLYVDGDELVSEGVTVSARVVGHERGPKLRVVKFKPKRGYKRRTGHRQELTRLEVTGISRRRGRAKKEDKGDGA

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 1.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.34
Rhizosphere 82.13
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0701301 3300039450 Bacteria 750
2 JGI24738J21930_10053933 3300002075 Bacteria 821
3 JGI24744J21845_10039605 3300002077 Bacteria 884
4 JGI25404J52841_10066694 3300003659 Bacteria 753
5 Ga0070683_100203072 3300005329 Bacteria 1882
6 Ga0070683_100604408 3300005329 Bacteria 1050
7 Ga0070683_101623897 3300005329 Bacteria 622
8 Ga0070690_100116460 3300005330 Bacteria 1789
9 Ga0070682_100165810 3300005337 Bacteria 1530
10 Ga0070682_100817470 3300005337 Bacteria 758
11 Ga0068868_100181002 3300005338 Bacteria 1749
12 Ga0068868_100365021 3300005338 Bacteria 1240
13 Ga0068868_101996624 3300005338 Bacteria 550
14 Ga0070689_100018944 3300005340 Bacteria 5082
15 Ga0070691_10225693 3300005341 Bacteria 995
16 Ga0070661_100146375 3300005344 Bacteria 1784
17 Ga0070668_100630246 3300005347 Bacteria 940
18 Ga0070671_100583225 3300005355 Bacteria 966
19 Ga0070674_100043491 3300005356 Bacteria 3056
20 Ga0070673_101033863 3300005364 Bacteria 766
21 Ga0070688_100009791 3300005365 Bacteria 5265
22 Ga0070667_100219381 3300005367 Bacteria 1693
23 Ga0070709_10175743 3300005434 Bacteria 1500
24 Ga0070713_100038904 3300005436 Bacteria 3857
25 Ga0070710_10113854 3300005437 Bacteria 1628
26 Ga0070711_100016829 3300005439 Bacteria 4647
27 Ga0070711_100491208 3300005439 Bacteria 1011
28 Ga0070711_100691675 3300005439 Bacteria 858
29 Ga0070694_100111116 3300005444 Bacteria 1953
30 Ga0070708_100940484 3300005445 Bacteria 811
31 Ga0070678_100430576 3300005456 Bacteria 1152
32 Ga0070662_100117353 3300005457 Bacteria 2035
33 Ga0070681_10943460 3300005458 Bacteria 782
34 Ga0070685_10049815 3300005466 Bacteria 2417
35 Ga0070685_11049062 3300005466 Bacteria 614
36 Ga0070706_101304478 3300005467 Bacteria 666
37 Ga0070707_100210389 3300005468 Bacteria 1896
38 Ga0070684_100548686 3300005535 Bacteria 1072
39 Ga0070672_100399732 3300005543 Bacteria 1177
40 Ga0070686_100113140 3300005544 Bacteria 1852
41 Ga0070696_100173200 3300005546 Bacteria 1596
42 Ga0070696_100376808 3300005546 Bacteria 1105
43 Ga0070696_101012648 3300005546 Bacteria 694
44 Ga0070665_100489065 3300005548 Bacteria 1241
45 Ga0070664_100240705 3300005564 Bacteria 1624
46 Ga0068857_100460692 3300005577 Bacteria 1190
47 Ga0068857_100702985 3300005577 Bacteria 961
48 Ga0068856_100288821 3300005614 Bacteria 1657
49 Ga0070702_100181553 3300005615 Bacteria 1377
50 Ga0068852_100330325 3300005616 Bacteria 1483
51 Ga0068852_101318807 3300005616 Bacteria 743
52 Ga0068859_100053532 3300005617 Bacteria 4059
53 Ga0068864_100305902 3300005618 Bacteria 1489
54 Ga0068864_100414929 3300005618 Bacteria 1282
55 Ga0068866_10286682 3300005718 Bacteria 1022
56 Ga0068866_10317531 3300005718 Bacteria 979
57 Ga0068870_10506323 3300005840 Bacteria 806
58 Ga0068863_100487591 3300005841 Bacteria 1213
59 Ga0068858_101873889 3300005842 Bacteria 592
60 Ga0068860_101624704 3300005843 Bacteria 668
61 Ga0068862_100388584 3300005844 Bacteria 1303
62 Ga0081455_10318839 3300005937 Bacteria 1108
63 Ga0081540_1000943 3300005983 Bacteria 26189
64 Ga0070717_10177461 3300006028 Bacteria 1855
65 Ga0070712_100002362 3300006175 Bacteria 11621
66 Ga0070712_100004573 3300006175 Bacteria 8544
67 Ga0097621_100852040 3300006237 Bacteria 847
68 Ga0075428_101115650 3300006844 Bacteria 833
69 Ga0075433_10184965 3300006852 Bacteria 1853
70 Ga0075434_100352988 3300006871 Bacteria 1492
71 Ga0075434_101710798 3300006871 Bacteria 637
72 Ga0068865_100152108 3300006881 Bacteria 1756
73 Ga0075436_100472572 3300006914 Bacteria 915
74 Ga0097620_100053530 3300006931 Bacteria 4059
75 Ga0097620_102490040 3300006931 Bacteria 570
76 Ga0075435_100498210 3300007076 Bacteria 1053
77 Ga0075435_101088350 3300007076 Bacteria 699
78 Ga0111539_10575234 3300009094 Bacteria 1312
79 Ga0111539_11565412 3300009094 Bacteria 764
80 Ga0105247_10347284 3300009101 Bacteria 1042
81 Ga0105243_10680440 3300009148 Bacteria 1000
82 Ga0105241_10370426 3300009174 Bacteria 1249
83 Ga0105241_11695683 3300009174 Bacteria 614
84 Ga0105241_11784055 3300009174 Bacteria 600
85 Ga0105242_11045830 3300009176 Bacteria 827
86 Ga0105248_10187795 3300009177 Bacteria 2329
87 Ga0105248_10313641 3300009177 Bacteria 1766
88 Ga0105237_10211055 3300009545 Bacteria 1941
89 Ga0105249_10567164 3300009553 Bacteria 1187
90 Ga0105249_12456053 3300009553 Bacteria 594
91 Ga0105246_10360871 3300011119 Bacteria 1194
92 Ga0157373_10369610 3300013100 Bacteria 1025
93 Ga0157371_10380593 3300013102 Bacteria 1030
94 Ga0157370_10003852 3300013104 Bacteria 17496
95 Ga0157375_10247586 3300013308 Bacteria 1943
96 Ga0157375_10913542 3300013308 Unclassified 1021
97 Ga0157375_12141628 3300013308 Bacteria 666
98 Ga0163163_10339445 3300014325 Bacteria 1557
99 Ga0163163_11208730 3300014325 Bacteria 818
100 Ga0157376_10802266 3300014969 Bacteria 954
101 Ga0157376_11099341 3300014969 Bacteria 821
102 Ga0163161_10175529 3300017792 Unclassified 1640
103 Ga0206356_10403615 3300020070 Bacteria 657
104 Ga0206349_1947021 3300020075 Bacteria 1945
105 Ga0206354_11647382 3300020081 Bacteria 683
106 Ga0206353_10563983 3300020082 Bacteria 663
107 Ga0206353_10963792 3300020082 Bacteria 618
108 Ga0213874_10000207 3300021377 Bacteria 10890
109 Ga0213874_10323635 3300021377 Bacteria 585
110 Ga0213876_10113758 3300021384 Bacteria 1436
111 Ga0213875_10011058 3300021388 Bacteria 4504
112 Ga0213875_10285405 3300021388 Bacteria 780
113 Ga0207653_10331919 3300025885 Bacteria 592
114 Ga0207692_10083421 3300025898 Bacteria 1715
115 Ga0207642_11113580 3300025899 Bacteria 511
116 Ga0207710_10157238 3300025900 Bacteria 1105
117 Ga0207680_10139780 3300025903 Bacteria 1605
118 Ga0207647_10163967 3300025904 Bacteria 1295
119 Ga0207699_10365359 3300025906 Bacteria 1021
120 Ga0207643_10042211 3300025908 Bacteria 2571
121 Ga0207654_11050637 3300025911 Bacteria 593
122 Ga0207695_10226436 3300025913 Bacteria 1776
123 Ga0207671_10003196 3300025914 Bacteria 16516
124 Ga0207693_10004097 3300025915 Bacteria 12388
125 Ga0207693_10110423 3300025915 Bacteria 2156
126 Ga0207693_10259626 3300025915 Bacteria 1362
127 Ga0207693_10279736 3300025915 Bacteria 1307
128 Ga0207693_10321025 3300025915 Bacteria 1212
129 Ga0207663_10012089 3300025916 Bacteria 4656
130 Ga0207663_10051629 3300025916 Bacteria 2562
131 Ga0207649_10816391 3300025920 Bacteria 728
132 Ga0207646_10233581 3300025922 Bacteria 1661
133 Ga0207650_10532011 3300025925 Bacteria 984
134 Ga0207700_10261092 3300025928 Bacteria 1483
135 Ga0207664_10309780 3300025929 Bacteria 1391
136 Ga0207644_10422443 3300025931 Bacteria 1092
137 Ga0207706_11071341 3300025933 Bacteria 675
138 Ga0207686_10702033 3300025934 Bacteria 804
139 Ga0207709_10006471 3300025935 Bacteria 6578
140 Ga0207670_10147961 3300025936 Bacteria 1739
141 Ga0207670_10219492 3300025936 Bacteria 1454
142 Ga0207704_10082280 3300025938 Bacteria 2085
143 Ga0207665_10964131 3300025939 Unclassified 678
144 Ga0207691_10339563 3300025940 Bacteria 1286
145 Ga0207711_10089431 3300025941 Bacteria 2705
146 Ga0207661_10400052 3300025944 Bacteria 1245
147 Ga0207661_10785686 3300025944 Bacteria 876
148 Ga0207679_10529240 3300025945 Bacteria 1055
149 Ga0207712_10622366 3300025961 Bacteria 936
150 Ga0207668_10939489 3300025972 Bacteria 771
151 Ga0207668_10947883 3300025972 Bacteria 767
152 Ga0207640_10253969 3300025981 Bacteria 1366
153 Ga0207658_10650770 3300025986 Bacteria 950
154 Ga0207677_10491233 3300026023 Bacteria 1059
155 Ga0207703_10600298 3300026035 Bacteria 1041
156 Ga0207708_10015954 3300026075 Bacteria 5640
157 Ga0207702_10567372 3300026078 Bacteria 1111
158 Ga0207641_10959472 3300026088 Bacteria 851
159 Ga0207648_10763534 3300026089 Bacteria 898
160 Ga0207676_10170100 3300026095 Bacteria 1897
161 Ga0207676_10341335 3300026095 Bacteria 1382
162 Ga0207676_11618645 3300026095 Bacteria 645
163 Ga0207674_10236561 3300026116 Bacteria 1774
164 Ga0207675_102034667 3300026118 Bacteria 591
165 Ga0207683_10093612 3300026121 Bacteria 2678
166 Ga0207698_10213792 3300026142 Bacteria 1737
167 Ga0207428_10251869 3300027907 Bacteria 1317
168 Ga0268265_10458876 3300028380 Bacteria 1192
169 Ga0268265_10942959 3300028380 Bacteria 850
170 Ga0268264_10472540 3300028381 Bacteria 1218
171 Ga0265326_10171455 3300028558 Bacteria 621
172 Ga0265318_10048588 3300028577 Bacteria 1598
173 Ga0265322_10114191 3300028654 Bacteria 769
174 Ga0265327_10009279 3300031251 Bacteria 7128
175 Ga0265327_10049876 3300031251 Bacteria 2193
176 Ga0265316_10261850 3300031344 Bacteria 1268
177 Ga0307408_100402114 3300031548 Bacteria 1176
178 Ga0307407_10651325 3300031903 Bacteria 789
179 Ga0307409_100455961 3300031995 Bacteria 1235
180 Ga0307409_100871829 3300031995 Bacteria 912
181 Ga0307409_102783191 3300031995 Bacteria 517
182 Ga0307416_100346899 3300032002 Bacteria 1500
183 Ga0307416_103675455 3300032002 Bacteria 513
184 Ga0307415_100188306 3300032126 Bacteria 1626
185 Ga0373938_0152112 3300034957 Bacteria 617
186 Ga0373953_0042629 3300035117 Bacteria 1809
187 Ga0373957_0461593 3300035120 Bacteria 550
188 Ga0373960_0363279 3300035121 Bacteria 551
189 Ga0373943_0168307 3300035170 Bacteria 1198
190 Ga0373942_0148396 3300035207 Bacteria 752
191 Ga0373933_0601365 3300035724 Bacteria 722
192 Ga0373937_0016150 3300036401 Bacteria 6623
193 Ga0436364_0134593 3300037853 Bacteria 2903
194 Ga0436364_0171707 3300037853 Bacteria 1105
195 Ga0436364_0187891 3300037853 Bacteria 633
196 Ga0436364_0464218 3300037853 Bacteria 1299
197 Ga0436364_0598634 3300037853 Bacteria 10370
198 Ga0436364_0853878 3300037853 Bacteria 707
199 Ga0436364_1012194 3300037853 Bacteria 947
200 Ga0436365_0319249 3300039437 Bacteria 5322
201 Ga0436365_0406821 3300039437 Bacteria 11514
202 Ga0436365_0534374 3300039437 Bacteria 1770
203 Ga0436365_1090601 3300039437 Bacteria 5993
204 Ga0436365_1772586 3300039437 Bacteria 3712
205 Ga0436363_0082727 3300039450 Bacteria 710
206 Ga0436363_0177025 3300039450 Bacteria 864
207 Ga0436363_0833398 3300039450 Bacteria 29402
208 Ga0436363_1001078 3300039450 Bacteria 834
209 Ga0436363_1059293 3300039450 Bacteria 2391
210 Ga0436363_1443097 3300039450 Bacteria 3850
211 Ga0436362_0916227 3300039453 Bacteria 3117
212 Ga0436362_1176415 3300039453 Bacteria 869
213 Ga0466969_0265777 3300044656 Bacteria 777
214 Ga0466966_0084061 3300044684 Bacteria 1980
215 Ga0466961_0003279 3300044693 Bacteria 10082
216 Ga0466961_0715071 3300044693 Bacteria 600
217 Ga0466963_0000301 3300044694 Bacteria 22253
218 Ga0466963_0929292 3300044694 Bacteria 613
219 Ga0466968_0394717 3300044735 Bacteria 677
220 Ga0466957_0184376 3300044842 Bacteria 1364
221 Ga0466960_0038551 3300044901 Bacteria 2248
222 Ga0466960_0048399 3300044901 Bacteria 2043
223 Ga0466960_0770906 3300044901 Bacteria 581
224 Ga0466959_0014487 3300045049 Bacteria 5732
225 Ga0466958_0014130 3300045836 Bacteria 4555
226 Ga0466958_0069641 3300045836 Bacteria 2151
227 Ga0466958_0479707 3300045836 Bacteria 806
228 Ga0466967_0155373 3300045976 Bacteria 2142
229 Ga0466967_0531575 3300045976 Bacteria 1156
230 Ga0466967_1160686 3300045976 Bacteria 769
231 Ga0495592_0149279 3300046454 Bacteria 1618
232 Ga0495629_0195926 3300046459 Bacteria 1397
233 Ga0495641_0313956 3300046461 Bacteria 707
234 Ga0495651_0006535 3300046462 Bacteria 8906
235 Ga0495653_0056638 3300046463 Bacteria 2987
236 Ga0495653_0135379 3300046463 Bacteria 1739
237 Ga0495662_0005830 3300046476 Bacteria 6164
238 Ga0495608_0025281 3300046511 Bacteria 4053
239 Ga0495608_0140658 3300046511 Bacteria 1541
240 Ga0495618_0202401 3300046514 Bacteria 1256
241 Ga0495628_0054532 3300046516 Bacteria 3151
242 Ga0495630_0011760 3300046517 Bacteria 6343
243 Ga0495630_0047733 3300046517 Bacteria 3203
244 Ga0495652_0106829 3300046529 Bacteria 2259
245 Ga0495640_0114160 3300046533 Bacteria 1761
246 Ga0495587_0341898 3300046536 Bacteria 835
247 Ga0495667_0163042 3300046559 Bacteria 1433
248 Ga0495667_0192104 3300046559 Bacteria 1308
249 Ga0495667_0301496 3300046559 Bacteria 1015
250 Ga0495634_0190580 3300046642 Bacteria 1279
251 Ga0495635_0004028 3300046663 Bacteria 10199
252 Ga0495635_0140929 3300046663 Bacteria 1642
253 Ga0495657_0033508 3300046675 Bacteria 3575
254 Ga0495657_0053382 3300046675 Bacteria 2705
255 Ga0495599_0124618 3300046678 Bacteria 1601
256 Ga0495647_0000009 3300046681 Bacteria 94874
257 Ga0495613_0001352 3300046689 Bacteria 18688
258 Ga0495613_0069245 3300046689 Bacteria 2573
259 Ga0495670_0010128 3300046691 Bacteria 4639
260 Ga0495600_0006303 3300046809 Bacteria 7210
261 Ga0495600_0486677 3300046809 Bacteria 759
262 Ga0495604_0062048 3300047317 Bacteria 2857
263 Ga0495674_0124681 3300047319 Bacteria 2174
264 Ga0495674_0634707 3300047319 Bacteria 843
265 Ga0495676_0020961 3300047321 Bacteria 5721
266 Ga0495680_0381947 3300047322 Bacteria 975
267 Ga0495680_0987895 3300047322 Bacteria 538
268 Ga0495675_0060947 3300047444 Bacteria 2391
269 Ga0495684_0202239 3300047471 Bacteria 1464
270 Ga0495593_0131191 3300047673 Bacteria 1272
271 Ga0496100_0502111 3300048903 Bacteria 934
272 Ga0496100_0522454 3300048903 Bacteria 916
273 Ga0496101_0018894 3300048904 Bacteria 4694
274 Ga0496101_0101401 3300048904 Bacteria 2155
275 Ga0496102_0000002 3300048905 Bacteria 814588
276 Ga0496102_0261612 3300048905 Bacteria 1631
277 Ga0496103_0000066 3300048906 Bacteria 126247
278 Ga0496103_0680364 3300048906 Bacteria 653
279 Ga0496104_0023743 3300048907 Bacteria 5639
280 Ga0496104_0268573 3300048907 Bacteria 1618
281 Ga0496105_0255634 3300048908 Bacteria 1418
282 Ga0496105_0309103 3300048908 Bacteria 1269
283 Ga0496105_0605364 3300048908 Bacteria 850
284 Ga0496105_1029343 3300048908 Bacteria 614
285 Ga0496106_0001346 3300048909 Bacteria 18420
286 Ga0496106_0062788 3300048909 Bacteria 2821
287 Ga0496107_0008599 3300048910 Bacteria 7068
288 Ga0496107_0059080 3300048910 Bacteria 2774
289 Ga0496109_0051354 3300048912 Bacteria 3755
290 Ga0496109_0054449 3300048912 Bacteria 3650
291 Ga0496109_0758172 3300048912 Bacteria 908
292 Ga0496110_0422327 3300048913 Bacteria 1215
293 Ga0496111_0340324 3300048914 Bacteria 1110
294 Ga0496112_0073438 3300048915 Bacteria 3381
295 Ga0496112_0279847 3300048915 Bacteria 1616
296 Ga0496112_1169900 3300048915 Bacteria 686
297 Ga0496113_0019444 3300048916 Bacteria 4751
298 Ga0496113_0230855 3300048916 Bacteria 1475
299 Ga0496113_0357856 3300048916 Bacteria 1171
300 Ga0496114_0121668 3300048917 Bacteria 2245
301 Ga0496115_0098385 3300048918 Bacteria 2396
302 Ga0496115_0314886 3300048918 Bacteria 1281
303 Ga0496115_0342224 3300048918 Bacteria 1220
304 Ga0501067_0413318 3300049583 Unclassified 753
305 nmdc:mga08y16_301131_c1 3300050511 Bacteria 1653
306 nmdc:mga08y16_922874_c1 3300050511 Bacteria 858
307 nmdc:mga0n895_1214094_c1 3300050512 Bacteria 728
308 nmdc:mga0rr50_550978_c1 3300050513 Bacteria 982
309 nmdc:mga08x19_579266_c1 3300050514 Bacteria 795
310 nmdc:mga08x19_911853_c1 3300050514 Bacteria 624
311 Ga0495601_0000656 3300053077 Bacteria 18444
312 Ga0495612_0094669 3300053078 Bacteria 1268
313 Ga0495595_0005374 3300053084 Bacteria 5188
314 Ga0495619_0000412 3300053085 Bacteria 29043
315 Ga0495619_0008321 3300053085 Bacteria 6558
316 Ga0495619_0016018 3300053085 Bacteria 4745
317 Ga0495619_0858050 3300053085 Bacteria 612
318 Ga0587091_129971 3300059511 Bacteria 621
319 Ga0501082_0603059 3300060353 Bacteria 961
320 Ga0436363_0701301
321 JGI24738J21930_10053933
322 JGI24744J21845_10039605
323 JGI25404J52841_10066694
324 Ga0070683_100203072
325 Ga0070683_100604408
326 Ga0070683_101623897
327 Ga0070690_100116460
328 Ga0070682_100165810
329 Ga0070682_100817470
330 Ga0068868_100181002
331 Ga0068868_100365021
332 Ga0068868_101996624
333 Ga0070689_100018944
334 Ga0070691_10225693
335 Ga0070661_100146375
336 Ga0070668_100630246
337 Ga0070671_100583225
338 Ga0070674_100043491
339 Ga0070673_101033863
340 Ga0070688_100009791
341 Ga0070667_100219381
342 Ga0070709_10175743
343 Ga0070713_100038904
344 Ga0070710_10113854
345 Ga0070711_100016829
346 Ga0070711_100491208
347 Ga0070711_100691675
348 Ga0070694_100111116
349 Ga0070708_100940484
350 Ga0070678_100430576
351 Ga0070662_100117353
352 Ga0070681_10943460
353 Ga0070685_10049815
354 Ga0070685_11049062
355 Ga0070706_101304478
356 Ga0070707_100210389
357 Ga0070684_100548686
358 Ga0070672_100399732
359 Ga0070686_100113140
360 Ga0070696_100173200
361 Ga0070696_100376808
362 Ga0070696_101012648
363 Ga0070665_100489065
364 Ga0070664_100240705
365 Ga0068857_100460692
366 Ga0068857_100702985
367 Ga0068856_100288821
368 Ga0070702_100181553
369 Ga0068852_100330325
370 Ga0068852_101318807
371 Ga0068859_100053532
372 Ga0068864_100305902
373 Ga0068864_100414929
374 Ga0068866_10286682
375 Ga0068866_10317531
376 Ga0068870_10506323
377 Ga0068863_100487591
378 Ga0068858_101873889
379 Ga0068860_101624704
380 Ga0068862_100388584
381 Ga0081455_10318839
382 Ga0081540_1000943
383 Ga0070717_10177461
384 Ga0070712_100002362
385 Ga0070712_100004573
386 Ga0097621_100852040
387 Ga0075428_101115650
388 Ga0075433_10184965
389 Ga0075434_100352988
390 Ga0075434_101710798
391 Ga0068865_100152108
392 Ga0075436_100472572
393 Ga0097620_100053530
394 Ga0097620_102490040
395 Ga0075435_100498210
396 Ga0075435_101088350
397 Ga0111539_10575234
398 Ga0111539_11565412
399 Ga0105247_10347284
400 Ga0105243_10680440
401 Ga0105241_10370426
402 Ga0105241_11695683
403 Ga0105241_11784055
404 Ga0105242_11045830
405 Ga0105248_10187795
406 Ga0105248_10313641
407 Ga0105237_10211055
408 Ga0105249_10567164
409 Ga0105249_12456053
410 Ga0105246_10360871
411 Ga0157373_10369610
412 Ga0157371_10380593
413 Ga0157370_10003852
414 Ga0157375_10247586
415 Ga0157375_10913542
416 Ga0157375_12141628
417 Ga0163163_10339445
418 Ga0163163_11208730
419 Ga0157376_10802266
420 Ga0157376_11099341
421 Ga0163161_10175529
422 Ga0206356_10403615
423 Ga0206349_1947021
424 Ga0206354_11647382
425 Ga0206353_10563983
426 Ga0206353_10963792
427 Ga0213874_10000207
428 Ga0213874_10323635
429 Ga0213876_10113758
430 Ga0213875_10011058
431 Ga0213875_10285405
432 Ga0207653_10331919
433 Ga0207692_10083421
434 Ga0207642_11113580
435 Ga0207710_10157238
436 Ga0207680_10139780
437 Ga0207647_10163967
438 Ga0207699_10365359
439 Ga0207643_10042211
440 Ga0207654_11050637
441 Ga0207695_10226436
442 Ga0207671_10003196
443 Ga0207693_10004097
444 Ga0207693_10110423
445 Ga0207693_10259626
446 Ga0207693_10279736
447 Ga0207693_10321025
448 Ga0207663_10012089
449 Ga0207663_10051629
450 Ga0207649_10816391
451 Ga0207646_10233581
452 Ga0207650_10532011
453 Ga0207700_10261092
454 Ga0207664_10309780
455 Ga0207644_10422443
456 Ga0207706_11071341
457 Ga0207686_10702033
458 Ga0207709_10006471
459 Ga0207670_10147961
460 Ga0207670_10219492
461 Ga0207704_10082280
462 Ga0207665_10964131
463 Ga0207691_10339563
464 Ga0207711_10089431
465 Ga0207661_10400052
466 Ga0207661_10785686
467 Ga0207679_10529240
468 Ga0207712_10622366
469 Ga0207668_10939489
470 Ga0207668_10947883
471 Ga0207640_10253969
472 Ga0207658_10650770
473 Ga0207677_10491233
474 Ga0207703_10600298
475 Ga0207708_10015954
476 Ga0207702_10567372
477 Ga0207641_10959472
478 Ga0207648_10763534
479 Ga0207676_10170100
480 Ga0207676_10341335
481 Ga0207676_11618645
482 Ga0207674_10236561
483 Ga0207675_102034667
484 Ga0207683_10093612
485 Ga0207698_10213792
486 Ga0207428_10251869
487 Ga0268265_10458876
488 Ga0268265_10942959
489 Ga0268264_10472540
490 Ga0265326_10171455
491 Ga0265318_10048588
492 Ga0265322_10114191
493 Ga0265327_10009279
494 Ga0265327_10049876
495 Ga0265316_10261850
496 Ga0307408_100402114
497 Ga0307407_10651325
498 Ga0307409_100455961
499 Ga0307409_100871829
500 Ga0307409_102783191
501 Ga0307416_100346899
502 Ga0307416_103675455
503 Ga0307415_100188306
504 Ga0373938_0152112
505 Ga0373953_0042629
506 Ga0373957_0461593
507 Ga0373960_0363279
508 Ga0373943_0168307
509 Ga0373942_0148396
510 Ga0373933_0601365
511 Ga0373937_0016150
512 Ga0436364_0134593
513 Ga0436364_0171707
514 Ga0436364_0187891
515 Ga0436364_0464218
516 Ga0436364_0598634
517 Ga0436364_0853878
518 Ga0436364_1012194
519 Ga0436365_0319249
520 Ga0436365_0406821
521 Ga0436365_0534374
522 Ga0436365_1090601
523 Ga0436365_1772586
524 Ga0436363_0082727
525 Ga0436363_0177025
526 Ga0436363_0833398
527 Ga0436363_1001078
528 Ga0436363_1059293
529 Ga0436363_1443097
530 Ga0436362_0916227
531 Ga0436362_1176415
532 Ga0466969_0265777
533 Ga0466966_0084061
534 Ga0466961_0003279
535 Ga0466961_0715071
536 Ga0466963_0000301
537 Ga0466963_0929292
538 Ga0466968_0394717
539 Ga0466957_0184376
540 Ga0466960_0038551
541 Ga0466960_0048399
542 Ga0466960_0770906
543 Ga0466959_0014487
544 Ga0466958_0014130
545 Ga0466958_0069641
546 Ga0466958_0479707
547 Ga0466967_0155373
548 Ga0466967_0531575
549 Ga0466967_1160686
550 Ga0495592_0149279
551 Ga0495629_0195926
552 Ga0495641_0313956
553 Ga0495651_0006535
554 Ga0495653_0056638
555 Ga0495653_0135379
556 Ga0495662_0005830
557 Ga0495608_0025281
558 Ga0495608_0140658
559 Ga0495618_0202401
560 Ga0495628_0054532
561 Ga0495630_0011760
562 Ga0495630_0047733
563 Ga0495652_0106829
564 Ga0495640_0114160
565 Ga0495587_0341898
566 Ga0495667_0163042
567 Ga0495667_0192104
568 Ga0495667_0301496
569 Ga0495634_0190580
570 Ga0495635_0004028
571 Ga0495635_0140929
572 Ga0495657_0033508
573 Ga0495657_0053382
574 Ga0495599_0124618
575 Ga0495647_0000009
576 Ga0495613_0001352
577 Ga0495613_0069245
578 Ga0495670_0010128
579 Ga0495600_0006303
580 Ga0495600_0486677
581 Ga0495604_0062048
582 Ga0495674_0124681
583 Ga0495674_0634707
584 Ga0495676_0020961
585 Ga0495680_0381947
586 Ga0495680_0987895
587 Ga0495675_0060947
588 Ga0495684_0202239
589 Ga0495593_0131191
590 Ga0496100_0502111
591 Ga0496100_0522454
592 Ga0496101_0018894
593 Ga0496101_0101401
594 Ga0496102_0000002
595 Ga0496102_0261612
596 Ga0496103_0000066
597 Ga0496103_0680364
598 Ga0496104_0023743
599 Ga0496104_0268573
600 Ga0496105_0255634
601 Ga0496105_0309103
602 Ga0496105_0605364
603 Ga0496105_1029343
604 Ga0496106_0001346
605 Ga0496106_0062788
606 Ga0496107_0008599
607 Ga0496107_0059080
608 Ga0496109_0051354
609 Ga0496109_0054449
610 Ga0496109_0758172
611 Ga0496110_0422327
612 Ga0496111_0340324
613 Ga0496112_0073438
614 Ga0496112_0279847
615 Ga0496112_1169900
616 Ga0496113_0019444
617 Ga0496113_0230855
618 Ga0496113_0357856
619 Ga0496114_0121668
620 Ga0496115_0098385
621 Ga0496115_0314886
622 Ga0496115_0342224
623 Ga0501067_0413318
624 nmdc:mga08y16_301131_c1
625 nmdc:mga08y16_922874_c1
626 nmdc:mga0n895_1214094_c1
627 nmdc:mga0rr50_550978_c1
628 nmdc:mga08x19_579266_c1
629 nmdc:mga08x19_911853_c1
630 Ga0495601_0000656
631 Ga0495612_0094669
632 Ga0495595_0005374
633 Ga0495619_0000412
634 Ga0495619_0008321
635 Ga0495619_0016018
636 Ga0495619_0858050
637 Ga0587091_129971
638 Ga0501082_0603059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00829

Ribosomal_L21p

Ribosomal prokaryotic L21 protein

1

96

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvm-assembly1.cif.gz_q cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.8943 1 101
7y41-assembly1.cif.gz_S mycobacterium smegmatis 50s ribosomal subunit from log phase of growth 0.8835 1 99
8cvm-assembly1.cif.gz_q cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.8779 1 101
5v93-assembly1.cif.gz_R cryo-em structure of the 70s ribosome from mycobacterium tuberculosis bound with capreomycin 0.874 2 98
6qnq-assembly1.cif.gz_D8 70s ribosome initiation complex (ic) with experimentally assigned potassium ions 0.8716 1 100
ID Description Score Start End Superfamily
af_P9WHC3_3_102_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8989 1 99 2.40.10.190
af_C0H4Y5_87_186_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8883 2 98 2.40.10.190
af_P9WHC3_3_102_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8821 1 99 2.40.10.190
af_Q54IF0_61_161_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8767 1 99 2.40.10.190
af_Q4DUK1_23_123_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8609 1 99 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2T2R9T8-F1-model_v4 Large ribosomal subunit protein bL21 0.9004 2 100 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-D7WC78-F1-model_v4 Large ribosomal subunit protein bL21 0.8985 1 100 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A4R4TQC5-F1-model_v4 Large ribosomal subunit protein bL21 0.8964 1 103 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6J6C4K9-F1-model_v4 Unannotated protein 0.893 1 100 GO:0003723
GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-Q6A9I3-F1-model_v4 Large ribosomal subunit protein bL21 (50S ribosomal protein L21) 0.8927 1 101 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map