F405136
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 319 | 157 | 319 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300031241|Ga0265325_10004841|Ga0265325_100048416 |
| Length | 119 |
| Sequence | VYNETFLDHFQNPRNVGELPSPPALFASVENPVCGDTLVLYARVEDGRIIEVRYQVRGCTASIATASAFTELLKGMTRAEVKALRADDAEAAIGGLAAESKHAAVLCVQAAKMLVLAWG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 64 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 99 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 104 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 106 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 107 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 108 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 115 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 116 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 117 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 118 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 119 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 120 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 122 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 123 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 127 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 128 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 129 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 151 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 152 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 153 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 154 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 155 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 156 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0 |
| Rhizoplane | 2.51 |
| Rhizosphere | 96.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10860132 | 3300005327 | Unclassified | 788 |
| 2 | Ga0070683_100039487 | 3300005329 | Bacteria | 4333 |
| 3 | Ga0070683_100044992 | 3300005329 | Bacteria | 4074 |
| 4 | Ga0070683_100163076 | 3300005329 | Bacteria | 2115 |
| 5 | Ga0070683_100251709 | 3300005329 | Unclassified | 1680 |
| 6 | Ga0070683_100356113 | 3300005329 | Bacteria | 1394 |
| 7 | Ga0070690_101430170 | 3300005330 | Bacteria | 557 |
| 8 | Ga0070670_100541494 | 3300005331 | Unclassified | 1038 |
| 9 | Ga0068869_100030842 | 3300005334 | Bacteria | 3768 |
| 10 | Ga0068869_101891683 | 3300005334 | Unclassified | 535 |
| 11 | Ga0070680_100930452 | 3300005336 | Bacteria | 750 |
| 12 | Ga0070682_100747722 | 3300005337 | Bacteria | 789 |
| 13 | Ga0068868_101502346 | 3300005338 | Bacteria | 631 |
| 14 | Ga0070689_100030046 | 3300005340 | Bacteria | 4121 |
| 15 | Ga0070689_100460875 | 3300005340 | Unclassified | 1083 |
| 16 | Ga0070661_101331703 | 3300005344 | Bacteria | 603 |
| 17 | Ga0070709_10239760 | 3300005434 | Bacteria | 1302 |
| 18 | Ga0070709_10365695 | 3300005434 | Bacteria | 1069 |
| 19 | Ga0070709_10639880 | 3300005434 | Bacteria | 822 |
| 20 | Ga0070714_100243693 | 3300005435 | Bacteria | 1660 |
| 21 | Ga0070713_100022646 | 3300005436 | Bacteria | 4858 |
| 22 | Ga0070713_100066938 | 3300005436 | Bacteria | 3023 |
| 23 | Ga0070710_11256423 | 3300005437 | Bacteria | 549 |
| 24 | Ga0070705_101237537 | 3300005440 | Unclassified | 616 |
| 25 | Ga0070708_101068529 | 3300005445 | Bacteria | 756 |
| 26 | Ga0070681_10445481 | 3300005458 | Bacteria | 1207 |
| 27 | Ga0070699_101636352 | 3300005518 | Unclassified | 590 |
| 28 | Ga0070684_100028901 | 3300005535 | Bacteria | 4692 |
| 29 | Ga0070684_100064043 | 3300005535 | Bacteria | 3225 |
| 30 | Ga0070684_100068602 | 3300005535 | Bacteria | 3117 |
| 31 | Ga0070684_100862423 | 3300005535 | Bacteria | 848 |
| 32 | Ga0070697_101042945 | 3300005536 | Bacteria | 727 |
| 33 | Ga0068853_100363027 | 3300005539 | Bacteria | 1349 |
| 34 | Ga0070695_100525963 | 3300005545 | Bacteria | 918 |
| 35 | Ga0070696_100049769 | 3300005546 | Unclassified | 2912 |
| 36 | Ga0070693_100216464 | 3300005547 | Bacteria | 1253 |
| 37 | Ga0068855_100023676 | 3300005563 | Bacteria | 7353 |
| 38 | Ga0070664_101283729 | 3300005564 | Bacteria | 691 |
| 39 | Ga0070664_101766376 | 3300005564 | Bacteria | 586 |
| 40 | Ga0068857_100017761 | 3300005577 | Bacteria | 6235 |
| 41 | Ga0068857_101165243 | 3300005577 | Bacteria | 746 |
| 42 | Ga0068856_100213635 | 3300005614 | Bacteria | 1944 |
| 43 | Ga0068856_100228392 | 3300005614 | Bacteria | 1877 |
| 44 | Ga0068852_100141075 | 3300005616 | Bacteria | 2230 |
| 45 | Ga0068852_100658480 | 3300005616 | Unclassified | 1055 |
| 46 | Ga0068859_101005819 | 3300005617 | Bacteria | 916 |
| 47 | Ga0068864_100599045 | 3300005618 | Unclassified | 1069 |
| 48 | Ga0068861_100258331 | 3300005719 | Unclassified | 1490 |
| 49 | Ga0068861_101324974 | 3300005719 | Bacteria | 701 |
| 50 | Ga0068863_100016202 | 3300005841 | Bacteria | 7151 |
| 51 | Ga0068863_101212046 | 3300005841 | Unclassified | 761 |
| 52 | Ga0068858_100080015 | 3300005842 | Bacteria | 3036 |
| 53 | Ga0068858_100269107 | 3300005842 | Unclassified | 1621 |
| 54 | Ga0068858_100479769 | 3300005842 | Unclassified | 1200 |
| 55 | Ga0097621_100069536 | 3300006237 | Bacteria | 2907 |
| 56 | Ga0097621_100452749 | 3300006237 | Bacteria | 1156 |
| 57 | Ga0068871_100022886 | 3300006358 | Bacteria | 4824 |
| 58 | Ga0068871_100086539 | 3300006358 | Bacteria | 2604 |
| 59 | Ga0068871_100353566 | 3300006358 | Bacteria | 1300 |
| 60 | Ga0068871_101140152 | 3300006358 | Bacteria | 730 |
| 61 | Ga0068871_101934985 | 3300006358 | Unclassified | 561 |
| 62 | Ga0068871_102216522 | 3300006358 | Bacteria | 524 |
| 63 | Ga0075428_101240158 | 3300006844 | Unclassified | 785 |
| 64 | Ga0075434_101364807 | 3300006871 | Bacteria | 719 |
| 65 | Ga0068865_100340379 | 3300006881 | Bacteria | 1212 |
| 66 | Ga0097620_100110685 | 3300006931 | Bacteria | 2808 |
| 67 | Ga0097620_101005815 | 3300006931 | Bacteria | 916 |
| 68 | Ga0105240_10000981 | 3300009093 | Bacteria | 50908 |
| 69 | Ga0105240_10066990 | 3300009093 | Bacteria | 4452 |
| 70 | Ga0105240_10129391 | 3300009093 | Bacteria | 3030 |
| 71 | Ga0105240_10299110 | 3300009093 | Bacteria | 1841 |
| 72 | Ga0105240_12299181 | 3300009093 | Unclassified | 558 |
| 73 | Ga0105245_10003759 | 3300009098 | Bacteria | 13512 |
| 74 | Ga0105245_10015567 | 3300009098 | Bacteria | 6631 |
| 75 | Ga0105245_10393782 | 3300009098 | Bacteria | 1383 |
| 76 | Ga0105245_10427847 | 3300009098 | Bacteria | 1328 |
| 77 | Ga0105245_10450319 | 3300009098 | Bacteria | 1296 |
| 78 | Ga0105245_10585741 | 3300009098 | Bacteria | 1140 |
| 79 | Ga0105245_10998671 | 3300009098 | Unclassified | 881 |
| 80 | Ga0105245_11620515 | 3300009098 | Bacteria | 699 |
| 81 | Ga0105243_10250856 | 3300009148 | Bacteria | 1580 |
| 82 | Ga0105243_10516737 | 3300009148 | Unclassified | 1135 |
| 83 | Ga0105243_11641500 | 3300009148 | Bacteria | 670 |
| 84 | Ga0105243_12112418 | 3300009148 | Unclassified | 599 |
| 85 | Ga0105241_10131540 | 3300009174 | Bacteria | 2027 |
| 86 | Ga0105241_10202928 | 3300009174 | Bacteria | 1657 |
| 87 | Ga0105241_10320856 | 3300009174 | Bacteria | 1336 |
| 88 | Ga0105241_10850923 | 3300009174 | Unclassified | 844 |
| 89 | Ga0105241_11585299 | 3300009174 | Unclassified | 633 |
| 90 | Ga0105242_10008946 | 3300009176 | Bacteria | 7686 |
| 91 | Ga0105242_10019789 | 3300009176 | Bacteria | 5274 |
| 92 | Ga0105242_10027848 | 3300009176 | Bacteria | 4493 |
| 93 | Ga0105242_10103632 | 3300009176 | Bacteria | 2414 |
| 94 | Ga0105242_10482012 | 3300009176 | Unclassified | 1176 |
| 95 | Ga0105242_10600558 | 3300009176 | Bacteria | 1063 |
| 96 | Ga0105242_11117669 | 3300009176 | Unclassified | 803 |
| 97 | Ga0105242_11379915 | 3300009176 | Bacteria | 731 |
| 98 | Ga0105242_12252166 | 3300009176 | Bacteria | 591 |
| 99 | Ga0105242_13179685 | 3300009176 | Bacteria | 510 |
| 100 | Ga0105248_10019926 | 3300009177 | Bacteria | 7425 |
| 101 | Ga0105248_10048060 | 3300009177 | Bacteria | 4786 |
| 102 | Ga0105248_10139846 | 3300009177 | Bacteria | 2731 |
| 103 | Ga0105248_10191969 | 3300009177 | Bacteria | 2301 |
| 104 | Ga0105248_10211026 | 3300009177 | Bacteria | 2188 |
| 105 | Ga0105248_10227761 | 3300009177 | Bacteria | 2098 |
| 106 | Ga0105248_10521002 | 3300009177 | Bacteria | 1340 |
| 107 | Ga0105248_10822815 | 3300009177 | Unclassified | 1048 |
| 108 | Ga0105248_11214182 | 3300009177 | Unclassified | 853 |
| 109 | Ga0105248_12460932 | 3300009177 | Bacteria | 593 |
| 110 | Ga0105237_10047760 | 3300009545 | Bacteria | 4303 |
| 111 | Ga0105237_10310446 | 3300009545 | Unclassified | 1580 |
| 112 | Ga0105237_10657217 | 3300009545 | Unclassified | 1055 |
| 113 | Ga0105238_10004060 | 3300009551 | Bacteria | 14509 |
| 114 | Ga0105238_10050577 | 3300009551 | Unclassified | 4183 |
| 115 | Ga0105238_12006614 | 3300009551 | Bacteria | 612 |
| 116 | Ga0105249_10003304 | 3300009553 | Bacteria | 13972 |
| 117 | Ga0105249_10192832 | 3300009553 | Bacteria | 1989 |
| 118 | Ga0105239_10010394 | 3300010375 | Bacteria | 10414 |
| 119 | Ga0105239_10512451 | 3300010375 | Bacteria | 1364 |
| 120 | Ga0105239_12952459 | 3300010375 | Bacteria | 554 |
| 121 | Ga0105246_10014302 | 3300011119 | Bacteria | 4989 |
| 122 | Ga0105246_10254911 | 3300011119 | Unclassified | 1394 |
| 123 | Ga0105246_10944258 | 3300011119 | Bacteria | 777 |
| 124 | Ga0157370_10004624 | 3300013104 | Bacteria | 15741 |
| 125 | Ga0157369_10004503 | 3300013105 | Bacteria | 16417 |
| 126 | Ga0157369_10532147 | 3300013105 | Unclassified | 1215 |
| 127 | Ga0157374_10099491 | 3300013296 | Bacteria | 2786 |
| 128 | Ga0157374_10206845 | 3300013296 | Bacteria | 1923 |
| 129 | Ga0157374_10411727 | 3300013296 | Unclassified | 1350 |
| 130 | Ga0157378_10471293 | 3300013297 | Bacteria | 1249 |
| 131 | Ga0157378_10822290 | 3300013297 | Unclassified | 956 |
| 132 | Ga0163162_10690998 | 3300013306 | Bacteria | 1142 |
| 133 | Ga0163162_10997717 | 3300013306 | Bacteria | 947 |
| 134 | Ga0157372_10026063 | 3300013307 | Bacteria | 6360 |
| 135 | Ga0157372_10044529 | 3300013307 | Bacteria | 4918 |
| 136 | Ga0157372_11382359 | 3300013307 | Bacteria | 812 |
| 137 | Ga0157372_12111369 | 3300013307 | Unclassified | 647 |
| 138 | Ga0157375_10532123 | 3300013308 | Bacteria | 1338 |
| 139 | Ga0157375_11703978 | 3300013308 | Unclassified | 746 |
| 140 | Ga0157375_11812912 | 3300013308 | Bacteria | 723 |
| 141 | Ga0163163_10010067 | 3300014325 | Bacteria | 8483 |
| 142 | Ga0163163_10407277 | 3300014325 | Bacteria | 1418 |
| 143 | Ga0163163_11394431 | 3300014325 | Bacteria | 762 |
| 144 | Ga0163163_11784096 | 3300014325 | Bacteria | 676 |
| 145 | Ga0157380_12645066 | 3300014326 | Unclassified | 568 |
| 146 | Ga0157379_10465303 | 3300014968 | Bacteria | 1169 |
| 147 | Ga0157379_12126879 | 3300014968 | Bacteria | 556 |
| 148 | Ga0157376_10175542 | 3300014969 | Bacteria | 1954 |
| 149 | Ga0157376_12538881 | 3300014969 | Bacteria | 552 |
| 150 | Ga0213875_10018110 | 3300021388 | Bacteria | 3398 |
| 151 | Ga0207642_10037102 | 3300025899 | Bacteria | 2097 |
| 152 | Ga0207699_10142469 | 3300025906 | Bacteria | 1577 |
| 153 | Ga0207654_10139333 | 3300025911 | Bacteria | 1545 |
| 154 | Ga0207654_10195124 | 3300025911 | Bacteria | 1330 |
| 155 | Ga0207654_11240980 | 3300025911 | Unclassified | 543 |
| 156 | Ga0207707_10381496 | 3300025912 | Bacteria | 1211 |
| 157 | Ga0207695_10057134 | 3300025913 | Bacteria | 4056 |
| 158 | Ga0207695_10076868 | 3300025913 | Bacteria | 3393 |
| 159 | Ga0207695_11008495 | 3300025913 | Bacteria | 712 |
| 160 | Ga0207671_10235629 | 3300025914 | Bacteria | 1437 |
| 161 | Ga0207663_10076753 | 3300025916 | Bacteria | 2172 |
| 162 | Ga0207662_10690618 | 3300025918 | Bacteria | 715 |
| 163 | Ga0207681_10421909 | 3300025923 | Unclassified | 1081 |
| 164 | Ga0207694_10002574 | 3300025924 | Bacteria | 14722 |
| 165 | Ga0207694_10014511 | 3300025924 | Bacteria | 5940 |
| 166 | Ga0207694_10066880 | 3300025924 | Bacteria | 2804 |
| 167 | Ga0207694_10654613 | 3300025924 | Unclassified | 885 |
| 168 | Ga0207687_10000991 | 3300025927 | Bacteria | 19255 |
| 169 | Ga0207687_10551982 | 3300025927 | Unclassified | 967 |
| 170 | Ga0207687_11246529 | 3300025927 | Unclassified | 639 |
| 171 | Ga0207700_10007193 | 3300025928 | Bacteria | 6788 |
| 172 | Ga0207700_10081541 | 3300025928 | Bacteria | 2526 |
| 173 | Ga0207700_11117185 | 3300025928 | Unclassified | 704 |
| 174 | Ga0207664_10685010 | 3300025929 | Bacteria | 922 |
| 175 | Ga0207644_11447995 | 3300025931 | Unclassified | 577 |
| 176 | Ga0207686_10009925 | 3300025934 | Bacteria | 5174 |
| 177 | Ga0207686_11227463 | 3300025934 | Bacteria | 614 |
| 178 | Ga0207709_10061750 | 3300025935 | Bacteria | 2343 |
| 179 | Ga0207670_10243353 | 3300025936 | Bacteria | 1387 |
| 180 | Ga0207670_10455094 | 3300025936 | Bacteria | 1032 |
| 181 | Ga0207670_11728549 | 3300025936 | Unclassified | 532 |
| 182 | Ga0207704_10114195 | 3300025938 | Bacteria | 1833 |
| 183 | Ga0207665_11233838 | 3300025939 | Unclassified | 596 |
| 184 | Ga0207711_10001218 | 3300025941 | Bacteria | 24359 |
| 185 | Ga0207711_10083652 | 3300025941 | Bacteria | 2792 |
| 186 | Ga0207711_10126196 | 3300025941 | Bacteria | 2289 |
| 187 | Ga0207711_10371676 | 3300025941 | Bacteria | 1326 |
| 188 | Ga0207711_10483634 | 3300025941 | Unclassified | 1153 |
| 189 | Ga0207711_10631340 | 3300025941 | Unclassified | 999 |
| 190 | Ga0207689_10036256 | 3300025942 | Bacteria | 4095 |
| 191 | Ga0207689_11528762 | 3300025942 | Unclassified | 557 |
| 192 | Ga0207661_10010996 | 3300025944 | Bacteria | 6539 |
| 193 | Ga0207661_10020734 | 3300025944 | Bacteria | 4917 |
| 194 | Ga0207661_10425184 | 3300025944 | Bacteria | 1207 |
| 195 | Ga0207661_10981121 | 3300025944 | Bacteria | 778 |
| 196 | Ga0207679_10231818 | 3300025945 | Bacteria | 1559 |
| 197 | Ga0207679_11933554 | 3300025945 | Bacteria | 538 |
| 198 | Ga0207667_10029672 | 3300025949 | Bacteria | 5928 |
| 199 | Ga0207712_10008797 | 3300025961 | Bacteria | 6384 |
| 200 | Ga0207703_10143607 | 3300026035 | Unclassified | 2074 |
| 201 | Ga0207703_10270584 | 3300026035 | Bacteria | 1539 |
| 202 | Ga0207703_10273134 | 3300026035 | Bacteria | 1532 |
| 203 | Ga0207703_10781834 | 3300026035 | Unclassified | 911 |
| 204 | Ga0207639_10225487 | 3300026041 | Bacteria | 1621 |
| 205 | Ga0207639_10563867 | 3300026041 | Bacteria | 1047 |
| 206 | Ga0207639_11532191 | 3300026041 | Bacteria | 626 |
| 207 | Ga0207702_10056929 | 3300026078 | Bacteria | 3321 |
| 208 | Ga0207702_11867905 | 3300026078 | Bacteria | 592 |
| 209 | Ga0207641_10147401 | 3300026088 | Bacteria | 2129 |
| 210 | Ga0207676_10485156 | 3300026095 | Unclassified | 1171 |
| 211 | Ga0207674_10004644 | 3300026116 | Bacteria | 16494 |
| 212 | Ga0207675_101947560 | 3300026118 | Unclassified | 606 |
| 213 | Ga0207698_10328933 | 3300026142 | Bacteria | 1435 |
| 214 | Ga0207698_10569427 | 3300026142 | Unclassified | 1113 |
| 215 | Ga0268264_11062238 | 3300028381 | Unclassified | 817 |
| 216 | Ga0265337_1037426 | 3300028556 | Bacteria | 1412 |
| 217 | Ga0265336_10076269 | 3300028666 | Bacteria | 1001 |
| 218 | Ga0265338_10021581 | 3300028800 | Bacteria | 6709 |
| 219 | Ga0265338_10339782 | 3300028800 | Bacteria | 1082 |
| 220 | Ga0265324_10066743 | 3300029957 | Unclassified | 1227 |
| 221 | Ga0265332_10008260 | 3300031238 | Bacteria | 4677 |
| 222 | Ga0265328_10002820 | 3300031239 | Bacteria | 7775 |
| 223 | Ga0265320_10104888 | 3300031240 | Bacteria | 1299 |
| 224 | Ga0265325_10004841 | 3300031241 | Bacteria | 8419 |
| 225 | Ga0265329_10167670 | 3300031242 | Unclassified | 715 |
| 226 | Ga0265340_10000527 | 3300031247 | Bacteria | 21112 |
| 227 | Ga0265340_10061781 | 3300031247 | Bacteria | 1791 |
| 228 | Ga0265331_10052585 | 3300031250 | Bacteria | 1945 |
| 229 | Ga0265331_10365391 | 3300031250 | Unclassified | 646 |
| 230 | Ga0265316_10001734 | 3300031344 | Bacteria | 23126 |
| 231 | Ga0265316_10002009 | 3300031344 | Bacteria | 21419 |
| 232 | Ga0265316_10014840 | 3300031344 | Bacteria | 6835 |
| 233 | Ga0265316_10015285 | 3300031344 | Bacteria | 6716 |
| 234 | Ga0265316_10049509 | 3300031344 | Bacteria | 3310 |
| 235 | Ga0265316_10122711 | 3300031344 | Bacteria | 1961 |
| 236 | Ga0265316_10252427 | 3300031344 | Bacteria | 1295 |
| 237 | Ga0265313_10001131 | 3300031595 | Bacteria | 25506 |
| 238 | Ga0265314_10002594 | 3300031711 | Bacteria | 18280 |
| 239 | Ga0265342_10011368 | 3300031712 | Bacteria | 6100 |
| 240 | Ga0373934_0001013 | 3300035086 | Bacteria | 10168 |
| 241 | Ga0373934_0224856 | 3300035086 | Unclassified | 774 |
| 242 | Ga0373934_0225838 | 3300035086 | Bacteria | 773 |
| 243 | Ga0373934_0329892 | 3300035086 | Bacteria | 634 |
| 244 | Ga0373923_0017167 | 3300035111 | Bacteria | 2764 |
| 245 | Ga0373953_0030844 | 3300035117 | Bacteria | 2081 |
| 246 | Ga0373954_0031446 | 3300035118 | Bacteria | 2451 |
| 247 | Ga0373954_0032995 | 3300035118 | Bacteria | 2395 |
| 248 | Ga0373954_0181268 | 3300035118 | Bacteria | 1033 |
| 249 | Ga0373956_0156482 | 3300035119 | Bacteria | 1073 |
| 250 | Ga0373957_0201018 | 3300035120 | Bacteria | 830 |
| 251 | Ga0373955_0006581 | 3300035172 | Bacteria | 5300 |
| 252 | Ga0373955_0016921 | 3300035172 | Bacteria | 3596 |
| 253 | Ga0373955_0461628 | 3300035172 | Bacteria | 774 |
| 254 | Ga0373924_0295685 | 3300035410 | Bacteria | 719 |
| 255 | Ga0373935_0206647 | 3300035692 | Bacteria | 1359 |
| 256 | Ga0373927_0000509 | 3300035695 | Bacteria | 29593 |
| 257 | Ga0373927_0322082 | 3300035695 | Bacteria | 1018 |
| 258 | Ga0373933_0070108 | 3300035724 | Bacteria | 2132 |
| 259 | Ga0373933_0628076 | 3300035724 | Unclassified | 706 |
| 260 | Ga0373937_0007994 | 3300036401 | Bacteria | 9171 |
| 261 | Ga0373937_0076690 | 3300036401 | Bacteria | 3088 |
| 262 | Ga0373937_0095288 | 3300036401 | Bacteria | 2760 |
| 263 | Ga0373937_0185670 | 3300036401 | Unclassified | 1953 |
| 264 | Ga0373937_0693364 | 3300036401 | Bacteria | 965 |
| 265 | Ga0373925_0004399 | 3300037068 | Bacteria | 10644 |
| 266 | Ga0373925_0233618 | 3300037068 | Bacteria | 1471 |
| 267 | Ga0373925_0457991 | 3300037068 | Bacteria | 1045 |
| 268 | Ga0373925_1260191 | 3300037068 | Unclassified | 607 |
| 269 | Ga0436364_0561252 | 3300037853 | Unclassified | 508 |
| 270 | Ga0436365_0036783 | 3300039437 | Bacteria | 2184 |
| 271 | Ga0451576_0030246 | 3300045051 | Bacteria | 5790 |
| 272 | Ga0451576_1271538 | 3300045051 | Bacteria | 767 |
| 273 | Ga0495592_0276834 | 3300046454 | Bacteria | 1099 |
| 274 | Ga0495580_0043304 | 3300046472 | Bacteria | 3204 |
| 275 | Ga0495580_0137178 | 3300046472 | Bacteria | 1696 |
| 276 | Ga0495580_0157519 | 3300046472 | Bacteria | 1572 |
| 277 | Ga0495580_0341477 | 3300046472 | Bacteria | 1015 |
| 278 | Ga0495580_0382056 | 3300046472 | Bacteria | 951 |
| 279 | Ga0495608_0158236 | 3300046511 | Bacteria | 1441 |
| 280 | Ga0495618_0921144 | 3300046514 | Unclassified | 504 |
| 281 | Ga0495665_0468225 | 3300046531 | Unclassified | 636 |
| 282 | Ga0495665_0583628 | 3300046531 | Bacteria | 559 |
| 283 | Ga0495587_0010425 | 3300046536 | Bacteria | 5916 |
| 284 | Ga0495587_0222698 | 3300046536 | Bacteria | 1064 |
| 285 | Ga0495645_0600869 | 3300046543 | Bacteria | 677 |
| 286 | Ga0495667_0029287 | 3300046559 | Unclassified | 3706 |
| 287 | Ga0495667_0081509 | 3300046559 | Bacteria | 2103 |
| 288 | Ga0495667_0152314 | 3300046559 | Bacteria | 1488 |
| 289 | Ga0495635_0289222 | 3300046663 | Unclassified | 1100 |
| 290 | Ga0495599_0775505 | 3300046678 | Unclassified | 549 |
| 291 | Ga0495623_0008885 | 3300046679 | Bacteria | 6523 |
| 292 | Ga0495623_0035060 | 3300046679 | Bacteria | 3216 |
| 293 | Ga0495623_0598061 | 3300046679 | Unclassified | 573 |
| 294 | Ga0495669_0309173 | 3300046684 | Unclassified | 762 |
| 295 | Ga0495600_0381548 | 3300046809 | Bacteria | 879 |
| 296 | Ga0495604_0050334 | 3300047317 | Unclassified | 3235 |
| 297 | Ga0495604_0403855 | 3300047317 | Bacteria | 899 |
| 298 | Ga0495604_0411037 | 3300047317 | Bacteria | 890 |
| 299 | Ga0495636_0052254 | 3300047318 | Bacteria | 1714 |
| 300 | Ga0495674_1347028 | 3300047319 | Bacteria | 534 |
| 301 | Ga0495680_0055467 | 3300047322 | Unclassified | 3074 |
| 302 | Ga0495675_0121064 | 3300047444 | Bacteria | 1630 |
| 303 | Ga0495684_0006279 | 3300047471 | Bacteria | 9236 |
| 304 | Ga0495684_0022437 | 3300047471 | Bacteria | 4857 |
| 305 | Ga0495684_1087458 | 3300047471 | Unclassified | 502 |
| 306 | Ga0495593_0118465 | 3300047673 | Unclassified | 1348 |
| 307 | Ga0495602_0009445 | 3300048088 | Bacteria | 10146 |
| 308 | Ga0495602_0012060 | 3300048088 | Bacteria | 8907 |
| 309 | Ga0495602_0533744 | 3300048088 | Bacteria | 815 |
| 310 | Ga0496102_0166580 | 3300048905 | Bacteria | 2074 |
| 311 | Ga0496104_0065663 | 3300048907 | Bacteria | 3444 |
| 312 | Ga0496104_0090897 | 3300048907 | Bacteria | 2918 |
| 313 | Ga0496105_0708898 | 3300048908 | Unclassified | 772 |
| 314 | Ga0496112_0478355 | 3300048915 | Bacteria | 1182 |
| 315 | Ga0496112_0798069 | 3300048915 | Bacteria | 869 |
| 316 | Ga0496113_0623811 | 3300048916 | Unclassified | 863 |
| 317 | Ga0496115_0169838 | 3300048918 | Unclassified | 1803 |
| 318 | nmdc:mga08x19_1279601_c1 | 3300050514 | Bacteria | 519 |
| 319 | Ga0500568_0000303 | 3300053139 | Bacteria | 39449 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031344 | Ga0265316_10015285 | Ga0265316_100152851 | 106 |
| 2 | 3300009093 | Ga0105240_10066990 | Ga0105240_100669903 | 112 |
| 3 | 3300009551 | Ga0105238_10050577 | Ga0105238_100505771 | 112 |
| 4 | 3300010375 | Ga0105239_12952459 | Ga0105239_129524592 | 112 |
| 5 | 3300013105 | Ga0157369_10532147 | Ga0157369_105321472 | 114 |
| 6 | 3300005331 | Ga0070670_100541494 | Ga0070670_1005414941 | 115 |
| 7 | 3300005618 | Ga0068864_100599045 | Ga0068864_1005990451 | 115 |
| 8 | 3300005841 | Ga0068863_100016202 | Ga0068863_1000162026 | 115 |
| 9 | 3300005842 | Ga0068858_100269107 | Ga0068858_1002691073 | 115 |
| 10 | 3300005842 | Ga0068858_100479769 | Ga0068858_1004797693 | 115 |
| 11 | 3300006358 | Ga0068871_102216522 | Ga0068871_1022165221 | 115 |
| 12 | 3300006931 | Ga0097620_100110685 | Ga0097620_1001106852 | 115 |
| 13 | 3300009176 | Ga0105242_10482012 | Ga0105242_104820123 | 115 |
| 14 | 3300009176 | Ga0105242_10600558 | Ga0105242_106005582 | 115 |
| 15 | 3300009177 | Ga0105248_10139846 | Ga0105248_101398462 | 115 |
| 16 | 3300009177 | Ga0105248_10211026 | Ga0105248_102110261 | 115 |
| 17 | 3300009177 | Ga0105248_10521002 | Ga0105248_105210022 | 115 |
| 18 | 3300009545 | Ga0105237_10657217 | Ga0105237_106572172 | 115 |
| 19 | 3300013296 | Ga0157374_10411727 | Ga0157374_104117272 | 115 |
| 20 | 3300014325 | Ga0163163_10010067 | Ga0163163_100100675 | 115 |
| 21 | 3300014968 | Ga0157379_10465303 | Ga0157379_104653031 | 115 |
| 22 | 3300025931 | Ga0207644_11447995 | Ga0207644_114479952 | 115 |
| 23 | 3300025936 | Ga0207670_11728549 | Ga0207670_117285491 | 115 |
| 24 | 3300025941 | Ga0207711_10083652 | Ga0207711_100836523 | 115 |
| 25 | 3300025941 | Ga0207711_10371676 | Ga0207711_103716762 | 115 |
| 26 | 3300025941 | Ga0207711_10483634 | Ga0207711_104836342 | 115 |
| 27 | 3300026035 | Ga0207703_10270584 | Ga0207703_102705842 | 115 |
| 28 | 3300026035 | Ga0207703_10781834 | Ga0207703_107818341 | 115 |
| 29 | 3300026088 | Ga0207641_10147401 | Ga0207641_101474011 | 115 |
| 30 | 3300026095 | Ga0207676_10485156 | Ga0207676_104851562 | 115 |
| 31 | 3300031344 | Ga0265316_10049509 | Ga0265316_100495092 | 115 |
| 32 | 3300031344 | Ga0265316_10122711 | Ga0265316_101227112 | 115 |
| 33 | 3300035086 | Ga0373934_0225838 | Ga0373934_0225838_96_452 | 115 |
| 34 | 3300035118 | Ga0373954_0181268 | Ga0373954_0181268_661_1017 | 115 |
| 35 | 3300035695 | Ga0373927_0322082 | Ga0373927_0322082_165_530 | 115 |
| 36 | 3300036401 | Ga0373937_0185670 | Ga0373937_0185670_116_475 | 115 |
| 37 | 3300036401 | Ga0373937_0693364 | Ga0373937_0693364_202_558 | 115 |
| 38 | 3300037068 | Ga0373925_0233618 | Ga0373925_0233618_389_754 | 115 |
| 39 | 3300046454 | Ga0495592_0276834 | Ga0495592_0276834_638_997 | 115 |
| 40 | 3300046472 | Ga0495580_0341477 | Ga0495580_0341477_171_536 | 115 |
| 41 | 3300046511 | Ga0495608_0158236 | Ga0495608_0158236_1072_1431 | 115 |
| 42 | 3300046514 | Ga0495618_0921144 | Ga0495618_0921144_21_377 | 115 |
| 43 | 3300046536 | Ga0495587_0222698 | Ga0495587_0222698_526_882 | 115 |
| 44 | 3300046559 | Ga0495667_0029287 | Ga0495667_0029287_1335_1694 | 115 |
| 45 | 3300046663 | Ga0495635_0289222 | Ga0495635_0289222_393_752 | 115 |
| 46 | 3300046678 | Ga0495599_0775505 | Ga0495599_0775505_150_509 | 115 |
| 47 | 3300046679 | Ga0495623_0008885 | Ga0495623_0008885_1063_1422 | 115 |
| 48 | 3300046679 | Ga0495623_0598061 | Ga0495623_0598061_10_366 | 115 |
| 49 | 3300046809 | Ga0495600_0381548 | Ga0495600_0381548_173_532 | 115 |
| 50 | 3300047317 | Ga0495604_0050334 | Ga0495604_0050334_2859_3218 | 115 |
| 51 | 3300047317 | Ga0495604_0411037 | Ga0495604_0411037_95_451 | 115 |
| 52 | 3300047319 | Ga0495674_1347028 | Ga0495674_1347028_133_498 | 115 |
| 53 | 3300047322 | Ga0495680_0055467 | Ga0495680_0055467_132_491 | 115 |
| 54 | 3300047444 | Ga0495675_0121064 | Ga0495675_0121064_730_1086 | 115 |
| 55 | 3300047471 | Ga0495684_0006279 | Ga0495684_0006279_4956_5315 | 115 |
| 56 | 3300047471 | Ga0495684_1087458 | Ga0495684_1087458_83_457 | 115 |
| 57 | 3300047673 | Ga0495593_0118465 | Ga0495593_0118465_241_600 | 115 |
| 58 | 3300048088 | Ga0495602_0012060 | Ga0495602_0012060_5427_5786 | 115 |
| 59 | 3300048088 | Ga0495602_0533744 | Ga0495602_0533744_70_426 | 115 |
| 60 | 3300048915 | Ga0496112_0798069 | Ga0496112_0798069_269_634 | 115 |
| 61 | 3300048916 | Ga0496113_0623811 | Ga0496113_0623811_15_380 | 115 |
| 62 | 3300025929 | Ga0207664_10685010 | Ga0207664_106850102 | 116 |
| 63 | 3300031344 | Ga0265316_10001734 | Ga0265316_1000173410 | 116 |
| 64 | 3300035695 | Ga0373927_0000509 | Ga0373927_0000509_8358_8708 | 116 |
| 65 | 3300045051 | Ga0451576_1271538 | Ga0451576_1271538_69_419 | 116 |
| 66 | 3300046472 | Ga0495580_0137178 | Ga0495580_0137178_712_1062 | 116 |
| 67 | 3300046543 | Ga0495645_0600869 | Ga0495645_0600869_303_665 | 116 |
| 68 | 3300005329 | Ga0070683_100251709 | Ga0070683_1002517092 | 117 |
| 69 | 3300005434 | Ga0070709_10639880 | Ga0070709_106398802 | 117 |
| 70 | 3300005437 | Ga0070710_11256423 | Ga0070710_112564231 | 117 |
| 71 | 3300005564 | Ga0070664_101283729 | Ga0070664_1012837292 | 117 |
| 72 | 3300005616 | Ga0068852_100658480 | Ga0068852_1006584802 | 117 |
| 73 | 3300013308 | Ga0157375_11703978 | Ga0157375_117039782 | 117 |
| 74 | 3300025913 | Ga0207695_10057134 | Ga0207695_100571343 | 117 |
| 75 | 3300025924 | Ga0207694_10654613 | Ga0207694_106546131 | 117 |
| 76 | 3300025928 | Ga0207700_11117185 | Ga0207700_111171852 | 117 |
| 77 | 3300025945 | Ga0207679_11933554 | Ga0207679_119335541 | 117 |
| 78 | 3300026142 | Ga0207698_10569427 | Ga0207698_105694272 | 117 |
| 79 | 3300037068 | Ga0373925_1260191 | Ga0373925_1260191_50_415 | 117 |
| 80 | 3300053139 | Ga0500568_0000303 | Ga0500568_0000303_2056_2415 | 117 |
| 81 | 3300005330 | Ga0070690_101430170 | Ga0070690_1014301701 | 118 |
| 82 | 3300005340 | Ga0070689_100030046 | Ga0070689_1000300462 | 118 |
| 83 | 3300005435 | Ga0070714_100243693 | Ga0070714_1002436931 | 118 |
| 84 | 3300005436 | Ga0070713_100066938 | Ga0070713_1000669382 | 118 |
| 85 | 3300005445 | Ga0070708_101068529 | Ga0070708_1010685291 | 118 |
| 86 | 3300005614 | Ga0068856_100228392 | Ga0068856_1002283922 | 118 |
| 87 | 3300009098 | Ga0105245_10393782 | Ga0105245_103937821 | 118 |
| 88 | 3300009098 | Ga0105245_10427847 | Ga0105245_104278472 | 118 |
| 89 | 3300009176 | Ga0105242_10008946 | Ga0105242_100089467 | 118 |
| 90 | 3300009176 | Ga0105242_11379915 | Ga0105242_113799151 | 118 |
| 91 | 3300009177 | Ga0105248_10191969 | Ga0105248_101919693 | 118 |
| 92 | 3300009177 | Ga0105248_11214182 | Ga0105248_112141821 | 118 |
| 93 | 3300013296 | Ga0157374_10099491 | Ga0157374_100994912 | 118 |
| 94 | 3300013306 | Ga0163162_10690998 | Ga0163162_106909982 | 118 |
| 95 | 3300013308 | Ga0157375_10532123 | Ga0157375_105321232 | 118 |
| 96 | 3300014325 | Ga0163163_11784096 | Ga0163163_117840962 | 118 |
| 97 | 3300014968 | Ga0157379_12126879 | Ga0157379_121268791 | 118 |
| 98 | 3300025916 | Ga0207663_10076753 | Ga0207663_100767532 | 118 |
| 99 | 3300025928 | Ga0207700_10081541 | Ga0207700_100815413 | 118 |
| 100 | 3300025936 | Ga0207670_10243353 | Ga0207670_102433532 | 118 |
| 101 | 3300026035 | Ga0207703_10273134 | Ga0207703_102731342 | 118 |
| 102 | 3300031241 | Ga0265325_10004841 | Ga0265325_100048416 | 118 |
| 103 | 3300031344 | Ga0265316_10002009 | Ga0265316_1000200914 | 118 |
| 104 | 3300047318 | Ga0495636_0052254 | Ga0495636_0052254_1195_1557 | 118 |
| 105 | 3300005327 | Ga0070658_10860132 | Ga0070658_108601322 | 119 |
| 106 | 3300005329 | Ga0070683_100039487 | Ga0070683_1000394875 | 119 |
| 107 | 3300005329 | Ga0070683_100044992 | Ga0070683_1000449924 | 119 |
| 108 | 3300005329 | Ga0070683_100163076 | Ga0070683_1001630762 | 119 |
| 109 | 3300005329 | Ga0070683_100356113 | Ga0070683_1003561131 | 119 |
| 110 | 3300005334 | Ga0068869_100030842 | Ga0068869_1000308425 | 119 |
| 111 | 3300005334 | Ga0068869_101891683 | Ga0068869_1018916831 | 119 |
| 112 | 3300005336 | Ga0070680_100930452 | Ga0070680_1009304522 | 119 |
| 113 | 3300005337 | Ga0070682_100747722 | Ga0070682_1007477222 | 119 |
| 114 | 3300005338 | Ga0068868_101502346 | Ga0068868_1015023462 | 119 |
| 115 | 3300005340 | Ga0070689_100460875 | Ga0070689_1004608752 | 119 |
| 116 | 3300005344 | Ga0070661_101331703 | Ga0070661_1013317031 | 119 |
| 117 | 3300005434 | Ga0070709_10239760 | Ga0070709_102397602 | 119 |
| 118 | 3300005434 | Ga0070709_10365695 | Ga0070709_103656951 | 119 |
| 119 | 3300005436 | Ga0070713_100022646 | Ga0070713_1000226465 | 119 |
| 120 | 3300005440 | Ga0070705_101237537 | Ga0070705_1012375372 | 119 |
| 121 | 3300005458 | Ga0070681_10445481 | Ga0070681_104454812 | 119 |
| 122 | 3300005518 | Ga0070699_101636352 | Ga0070699_1016363521 | 119 |
| 123 | 3300005535 | Ga0070684_100028901 | Ga0070684_1000289014 | 119 |
| 124 | 3300005535 | Ga0070684_100064043 | Ga0070684_1000640435 | 119 |
| 125 | 3300005535 | Ga0070684_100068602 | Ga0070684_1000686021 | 119 |
| 126 | 3300005535 | Ga0070684_100862423 | Ga0070684_1008624232 | 119 |
| 127 | 3300005536 | Ga0070697_101042945 | Ga0070697_1010429452 | 119 |
| 128 | 3300005539 | Ga0068853_100363027 | Ga0068853_1003630272 | 119 |
| 129 | 3300005545 | Ga0070695_100525963 | Ga0070695_1005259632 | 119 |
| 130 | 3300005546 | Ga0070696_100049769 | Ga0070696_1000497695 | 119 |
| 131 | 3300005547 | Ga0070693_100216464 | Ga0070693_1002164642 | 119 |
| 132 | 3300005563 | Ga0068855_100023676 | Ga0068855_1000236763 | 119 |
| 133 | 3300005564 | Ga0070664_101766376 | Ga0070664_1017663762 | 119 |
| 134 | 3300005577 | Ga0068857_100017761 | Ga0068857_1000177612 | 119 |
| 135 | 3300005577 | Ga0068857_101165243 | Ga0068857_1011652431 | 119 |
| 136 | 3300005614 | Ga0068856_100213635 | Ga0068856_1002136353 | 119 |
| 137 | 3300005616 | Ga0068852_100141075 | Ga0068852_1001410752 | 119 |
| 138 | 3300005617 | Ga0068859_101005819 | Ga0068859_1010058192 | 119 |
| 139 | 3300005719 | Ga0068861_100258331 | Ga0068861_1002583312 | 119 |
| 140 | 3300005719 | Ga0068861_101324974 | Ga0068861_1013249742 | 119 |
| 141 | 3300005841 | Ga0068863_101212046 | Ga0068863_1012120461 | 119 |
| 142 | 3300005842 | Ga0068858_100080015 | Ga0068858_1000800154 | 119 |
| 143 | 3300006237 | Ga0097621_100069536 | Ga0097621_1000695361 | 119 |
| 144 | 3300006237 | Ga0097621_100452749 | Ga0097621_1004527492 | 119 |
| 145 | 3300006358 | Ga0068871_100022886 | Ga0068871_1000228862 | 119 |
| 146 | 3300006358 | Ga0068871_100086539 | Ga0068871_1000865393 | 119 |
| 147 | 3300006358 | Ga0068871_100353566 | Ga0068871_1003535662 | 119 |
| 148 | 3300006358 | Ga0068871_101140152 | Ga0068871_1011401522 | 119 |
| 149 | 3300006358 | Ga0068871_101934985 | Ga0068871_1019349851 | 119 |
| 150 | 3300006844 | Ga0075428_101240158 | Ga0075428_1012401582 | 119 |
| 151 | 3300006871 | Ga0075434_101364807 | Ga0075434_1013648072 | 119 |
| 152 | 3300006881 | Ga0068865_100340379 | Ga0068865_1003403792 | 119 |
| 153 | 3300006931 | Ga0097620_101005815 | Ga0097620_1010058152 | 119 |
| 154 | 3300009093 | Ga0105240_10000981 | Ga0105240_1000098112 | 119 |
| 155 | 3300009093 | Ga0105240_10129391 | Ga0105240_101293913 | 119 |
| 156 | 3300009093 | Ga0105240_10299110 | Ga0105240_102991102 | 119 |
| 157 | 3300009093 | Ga0105240_12299181 | Ga0105240_122991811 | 119 |
| 158 | 3300009098 | Ga0105245_10003759 | Ga0105245_1000375916 | 119 |
| 159 | 3300009098 | Ga0105245_10015567 | Ga0105245_100155675 | 119 |
| 160 | 3300009098 | Ga0105245_10450319 | Ga0105245_104503192 | 119 |
| 161 | 3300009098 | Ga0105245_10585741 | Ga0105245_105857412 | 119 |
| 162 | 3300009098 | Ga0105245_10998671 | Ga0105245_109986711 | 119 |
| 163 | 3300009098 | Ga0105245_11620515 | Ga0105245_116205151 | 119 |
| 164 | 3300009148 | Ga0105243_10250856 | Ga0105243_102508562 | 119 |
| 165 | 3300009148 | Ga0105243_10516737 | Ga0105243_105167372 | 119 |
| 166 | 3300009148 | Ga0105243_11641500 | Ga0105243_116415001 | 119 |
| 167 | 3300009148 | Ga0105243_12112418 | Ga0105243_121124181 | 119 |
| 168 | 3300009174 | Ga0105241_10131540 | Ga0105241_101315402 | 119 |
| 169 | 3300009174 | Ga0105241_10202928 | Ga0105241_102029282 | 119 |
| 170 | 3300009174 | Ga0105241_10320856 | Ga0105241_103208561 | 119 |
| 171 | 3300009174 | Ga0105241_10850923 | Ga0105241_108509232 | 119 |
| 172 | 3300009174 | Ga0105241_11585299 | Ga0105241_115852991 | 119 |
| 173 | 3300009176 | Ga0105242_10019789 | Ga0105242_100197895 | 119 |
| 174 | 3300009176 | Ga0105242_10027848 | Ga0105242_100278482 | 119 |
| 175 | 3300009176 | Ga0105242_10103632 | Ga0105242_101036323 | 119 |
| 176 | 3300009176 | Ga0105242_11117669 | Ga0105242_111176692 | 119 |
| 177 | 3300009176 | Ga0105242_12252166 | Ga0105242_122521661 | 119 |
| 178 | 3300009176 | Ga0105242_13179685 | Ga0105242_131796851 | 119 |
| 179 | 3300009177 | Ga0105248_10019926 | Ga0105248_100199262 | 119 |
| 180 | 3300009177 | Ga0105248_10048060 | Ga0105248_100480604 | 119 |
| 181 | 3300009177 | Ga0105248_10227761 | Ga0105248_102277613 | 119 |
| 182 | 3300009177 | Ga0105248_10822815 | Ga0105248_108228152 | 119 |
| 183 | 3300009177 | Ga0105248_12460932 | Ga0105248_124609321 | 119 |
| 184 | 3300009545 | Ga0105237_10047760 | Ga0105237_100477603 | 119 |
| 185 | 3300009545 | Ga0105237_10310446 | Ga0105237_103104461 | 119 |
| 186 | 3300009551 | Ga0105238_10004060 | Ga0105238_100040606 | 119 |
| 187 | 3300009551 | Ga0105238_12006614 | Ga0105238_120066141 | 119 |
| 188 | 3300009553 | Ga0105249_10003304 | Ga0105249_100033044 | 119 |
| 189 | 3300009553 | Ga0105249_10192832 | Ga0105249_101928323 | 119 |
| 190 | 3300010375 | Ga0105239_10010394 | Ga0105239_100103948 | 119 |
| 191 | 3300010375 | Ga0105239_10512451 | Ga0105239_105124511 | 119 |
| 192 | 3300011119 | Ga0105246_10014302 | Ga0105246_100143022 | 119 |
| 193 | 3300011119 | Ga0105246_10254911 | Ga0105246_102549112 | 119 |
| 194 | 3300011119 | Ga0105246_10944258 | Ga0105246_109442582 | 119 |
| 195 | 3300013104 | Ga0157370_10004624 | Ga0157370_100046249 | 119 |
| 196 | 3300013105 | Ga0157369_10004503 | Ga0157369_100045039 | 119 |
| 197 | 3300013296 | Ga0157374_10206845 | Ga0157374_102068452 | 119 |
| 198 | 3300013297 | Ga0157378_10471293 | Ga0157378_104712932 | 119 |
| 199 | 3300013297 | Ga0157378_10822290 | Ga0157378_108222902 | 119 |
| 200 | 3300013306 | Ga0163162_10997717 | Ga0163162_109977172 | 119 |
| 201 | 3300013307 | Ga0157372_10026063 | Ga0157372_100260636 | 119 |
| 202 | 3300013307 | Ga0157372_10044529 | Ga0157372_100445293 | 119 |
| 203 | 3300013307 | Ga0157372_11382359 | Ga0157372_113823592 | 119 |
| 204 | 3300013307 | Ga0157372_12111369 | Ga0157372_121113692 | 119 |
| 205 | 3300013308 | Ga0157375_11812912 | Ga0157375_118129122 | 119 |
| 206 | 3300014325 | Ga0163163_10407277 | Ga0163163_104072771 | 119 |
| 207 | 3300014325 | Ga0163163_11394431 | Ga0163163_113944312 | 119 |
| 208 | 3300014326 | Ga0157380_12645066 | Ga0157380_126450661 | 119 |
| 209 | 3300014969 | Ga0157376_10175542 | Ga0157376_101755422 | 119 |
| 210 | 3300014969 | Ga0157376_12538881 | Ga0157376_125388811 | 119 |
| 211 | 3300021388 | Ga0213875_10018110 | Ga0213875_100181101 | 119 |
| 212 | 3300025899 | Ga0207642_10037102 | Ga0207642_100371023 | 119 |
| 213 | 3300025906 | Ga0207699_10142469 | Ga0207699_101424692 | 119 |
| 214 | 3300025911 | Ga0207654_10139333 | Ga0207654_101393331 | 119 |
| 215 | 3300025911 | Ga0207654_10195124 | Ga0207654_101951242 | 119 |
| 216 | 3300025911 | Ga0207654_11240980 | Ga0207654_112409801 | 119 |
| 217 | 3300025912 | Ga0207707_10381496 | Ga0207707_103814961 | 119 |
| 218 | 3300025913 | Ga0207695_10076868 | Ga0207695_100768683 | 119 |
| 219 | 3300025913 | Ga0207695_11008495 | Ga0207695_110084951 | 119 |
| 220 | 3300025914 | Ga0207671_10235629 | Ga0207671_102356292 | 119 |
| 221 | 3300025918 | Ga0207662_10690618 | Ga0207662_106906181 | 119 |
| 222 | 3300025923 | Ga0207681_10421909 | Ga0207681_104219092 | 119 |
| 223 | 3300025924 | Ga0207694_10002574 | Ga0207694_100025746 | 119 |
| 224 | 3300025924 | Ga0207694_10014511 | Ga0207694_100145114 | 119 |
| 225 | 3300025924 | Ga0207694_10066880 | Ga0207694_100668802 | 119 |
| 226 | 3300025927 | Ga0207687_10000991 | Ga0207687_1000099116 | 119 |
| 227 | 3300025927 | Ga0207687_10551982 | Ga0207687_105519822 | 119 |
| 228 | 3300025927 | Ga0207687_11246529 | Ga0207687_112465292 | 119 |
| 229 | 3300025928 | Ga0207700_10007193 | Ga0207700_100071935 | 119 |
| 230 | 3300025934 | Ga0207686_10009925 | Ga0207686_100099255 | 119 |
| 231 | 3300025934 | Ga0207686_11227463 | Ga0207686_112274632 | 119 |
| 232 | 3300025935 | Ga0207709_10061750 | Ga0207709_100617502 | 119 |
| 233 | 3300025936 | Ga0207670_10455094 | Ga0207670_104550942 | 119 |
| 234 | 3300025938 | Ga0207704_10114195 | Ga0207704_101141952 | 119 |
| 235 | 3300025939 | Ga0207665_11233838 | Ga0207665_112338382 | 119 |
| 236 | 3300025941 | Ga0207711_10001218 | Ga0207711_1000121810 | 119 |
| 237 | 3300025941 | Ga0207711_10126196 | Ga0207711_101261962 | 119 |
| 238 | 3300025941 | Ga0207711_10631340 | Ga0207711_106313402 | 119 |
| 239 | 3300025942 | Ga0207689_10036256 | Ga0207689_100362562 | 119 |
| 240 | 3300025942 | Ga0207689_11528762 | Ga0207689_115287621 | 119 |
| 241 | 3300025944 | Ga0207661_10010996 | Ga0207661_100109964 | 119 |
| 242 | 3300025944 | Ga0207661_10020734 | Ga0207661_100207345 | 119 |
| 243 | 3300025944 | Ga0207661_10425184 | Ga0207661_104251842 | 119 |
| 244 | 3300025944 | Ga0207661_10981121 | Ga0207661_109811212 | 119 |
| 245 | 3300025945 | Ga0207679_10231818 | Ga0207679_102318182 | 119 |
| 246 | 3300025949 | Ga0207667_10029672 | Ga0207667_100296723 | 119 |
| 247 | 3300025961 | Ga0207712_10008797 | Ga0207712_100087974 | 119 |
| 248 | 3300026035 | Ga0207703_10143607 | Ga0207703_101436073 | 119 |
| 249 | 3300026041 | Ga0207639_10225487 | Ga0207639_102254872 | 119 |
| 250 | 3300026041 | Ga0207639_10563867 | Ga0207639_105638672 | 119 |
| 251 | 3300026041 | Ga0207639_11532191 | Ga0207639_115321912 | 119 |
| 252 | 3300026078 | Ga0207702_10056929 | Ga0207702_100569292 | 119 |
| 253 | 3300026078 | Ga0207702_11867905 | Ga0207702_118679052 | 119 |
| 254 | 3300026116 | Ga0207674_10004644 | Ga0207674_100046448 | 119 |
| 255 | 3300026118 | Ga0207675_101947560 | Ga0207675_1019475602 | 119 |
| 256 | 3300026142 | Ga0207698_10328933 | Ga0207698_103289332 | 119 |
| 257 | 3300028381 | Ga0268264_11062238 | Ga0268264_110622381 | 119 |
| 258 | 3300028556 | Ga0265337_1037426 | Ga0265337_10374261 | 119 |
| 259 | 3300028666 | Ga0265336_10076269 | Ga0265336_100762692 | 119 |
| 260 | 3300028800 | Ga0265338_10021581 | Ga0265338_100215812 | 119 |
| 261 | 3300028800 | Ga0265338_10339782 | Ga0265338_103397821 | 119 |
| 262 | 3300029957 | Ga0265324_10066743 | Ga0265324_100667431 | 119 |
| 263 | 3300031238 | Ga0265332_10008260 | Ga0265332_100082602 | 119 |
| 264 | 3300031239 | Ga0265328_10002820 | Ga0265328_100028204 | 119 |
| 265 | 3300031240 | Ga0265320_10104888 | Ga0265320_101048882 | 119 |
| 266 | 3300031242 | Ga0265329_10167670 | Ga0265329_101676702 | 119 |
| 267 | 3300031247 | Ga0265340_10000527 | Ga0265340_1000052726 | 119 |
| 268 | 3300031247 | Ga0265340_10061781 | Ga0265340_100617812 | 119 |
| 269 | 3300031250 | Ga0265331_10052585 | Ga0265331_100525852 | 119 |
| 270 | 3300031250 | Ga0265331_10365391 | Ga0265331_103653911 | 119 |
| 271 | 3300031344 | Ga0265316_10014840 | Ga0265316_100148408 | 119 |
| 272 | 3300031344 | Ga0265316_10252427 | Ga0265316_102524271 | 119 |
| 273 | 3300031595 | Ga0265313_10001131 | Ga0265313_1000113118 | 119 |
| 274 | 3300031711 | Ga0265314_10002594 | Ga0265314_1000259420 | 119 |
| 275 | 3300031712 | Ga0265342_10011368 | Ga0265342_100113683 | 119 |
| 276 | 3300035086 | Ga0373934_0001013 | Ga0373934_0001013_8955_9314 | 119 |
| 277 | 3300035086 | Ga0373934_0224856 | Ga0373934_0224856_243_602 | 119 |
| 278 | 3300035086 | Ga0373934_0329892 | Ga0373934_0329892_115_480 | 119 |
| 279 | 3300035111 | Ga0373923_0017167 | Ga0373923_0017167_1763_2122 | 119 |
| 280 | 3300035117 | Ga0373953_0030844 | Ga0373953_0030844_1267_1626 | 119 |
| 281 | 3300035118 | Ga0373954_0031446 | Ga0373954_0031446_1658_2017 | 119 |
| 282 | 3300035118 | Ga0373954_0032995 | Ga0373954_0032995_818_1177 | 119 |
| 283 | 3300035119 | Ga0373956_0156482 | Ga0373956_0156482_104_463 | 119 |
| 284 | 3300035120 | Ga0373957_0201018 | Ga0373957_0201018_318_683 | 119 |
| 285 | 3300035172 | Ga0373955_0006581 | Ga0373955_0006581_357_716 | 119 |
| 286 | 3300035172 | Ga0373955_0016921 | Ga0373955_0016921_404_769 | 119 |
| 287 | 3300035172 | Ga0373955_0461628 | Ga0373955_0461628_38_469 | 119 |
| 288 | 3300035410 | Ga0373924_0295685 | Ga0373924_0295685_162_521 | 119 |
| 289 | 3300035692 | Ga0373935_0206647 | Ga0373935_0206647_298_672 | 119 |
| 290 | 3300035724 | Ga0373933_0070108 | Ga0373933_0070108_220_585 | 119 |
| 291 | 3300035724 | Ga0373933_0628076 | Ga0373933_0628076_32_391 | 119 |
| 292 | 3300036401 | Ga0373937_0007994 | Ga0373937_0007994_5018_5383 | 119 |
| 293 | 3300036401 | Ga0373937_0076690 | Ga0373937_0076690_2673_3032 | 119 |
| 294 | 3300036401 | Ga0373937_0095288 | Ga0373937_0095288_1554_1913 | 119 |
| 295 | 3300037068 | Ga0373925_0004399 | Ga0373925_0004399_1918_2280 | 119 |
| 296 | 3300037068 | Ga0373925_0457991 | Ga0373925_0457991_246_620 | 119 |
| 297 | 3300037853 | Ga0436364_0561252 | Ga0436364_0561252_99_461 | 119 |
| 298 | 3300039437 | Ga0436365_0036783 | Ga0436365_0036783_898_1260 | 119 |
| 299 | 3300045051 | Ga0451576_0030246 | Ga0451576_0030246_453_818 | 119 |
| 300 | 3300046472 | Ga0495580_0043304 | Ga0495580_0043304_1674_2036 | 119 |
| 301 | 3300046472 | Ga0495580_0157519 | Ga0495580_0157519_1181_1540 | 119 |
| 302 | 3300046472 | Ga0495580_0382056 | Ga0495580_0382056_130_504 | 119 |
| 303 | 3300046531 | Ga0495665_0468225 | Ga0495665_0468225_190_564 | 119 |
| 304 | 3300046531 | Ga0495665_0583628 | Ga0495665_0583628_70_501 | 119 |
| 305 | 3300046536 | Ga0495587_0010425 | Ga0495587_0010425_90_449 | 119 |
| 306 | 3300046559 | Ga0495667_0081509 | Ga0495667_0081509_384_743 | 119 |
| 307 | 3300046559 | Ga0495667_0152314 | Ga0495667_0152314_904_1263 | 119 |
| 308 | 3300046679 | Ga0495623_0035060 | Ga0495623_0035060_60_419 | 119 |
| 309 | 3300046684 | Ga0495669_0309173 | Ga0495669_0309173_288_671 | 119 |
| 310 | 3300047317 | Ga0495604_0403855 | Ga0495604_0403855_79_438 | 119 |
| 311 | 3300047471 | Ga0495684_0022437 | Ga0495684_0022437_3066_3425 | 119 |
| 312 | 3300048088 | Ga0495602_0009445 | Ga0495602_0009445_112_471 | 119 |
| 313 | 3300048905 | Ga0496102_0166580 | Ga0496102_0166580_109_468 | 119 |
| 314 | 3300048907 | Ga0496104_0065663 | Ga0496104_0065663_1667_2026 | 119 |
| 315 | 3300048907 | Ga0496104_0090897 | Ga0496104_0090897_1684_2043 | 119 |
| 316 | 3300048908 | Ga0496105_0708898 | Ga0496105_0708898_184_543 | 119 |
| 317 | 3300048915 | Ga0496112_0478355 | Ga0496112_0478355_19_402 | 119 |
| 318 | 3300048918 | Ga0496115_0169838 | Ga0496115_0169838_1166_1525 | 119 |
| 319 | 3300050514 | nmdc:mga08x19_1279601_c1 | nmdc:mga08x19_1279601_c1_132_491 | 119 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4eb5-assembly1.cif.gz_D | a. fulgidus iscs-iscu complex structure | 0.9414 | 2 | 109 |
| 5wlw-assembly1.cif.gz_H | crystal structure of the human mitochondrial cysteine desulfurase with active cysteine loop within iscu1 active site, coordinating zn ion. complexed with human isd11 and e. coli acp1 at 3.3a. | 0.932 | 3 | 114 |
| 3lvl-assembly1.cif.gz_A-2 | crystal structure of e.coli iscs-iscu complex | 0.9268 | 1 | 114 |
| 4eb5-assembly1.cif.gz_C | a. fulgidus iscs-iscu complex structure | 0.9267 | 2 | 111 |
| 5wkp-assembly1.cif.gz_D | crystal structure of the human mitochondrial cysteine desulfurase in complex with isd11 and iron-sulfur cluster scaffold protein iscu1, and e. coli acp1 protein at 3.15a | 0.9156 | 8 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4eb5D00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9414 | 2 | 109 | 3.90.1010.10 |
| 5wlwD01 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9298 | 23 | 114 | 3.90.1010.10 |
| af_Q9MAB6_26_163_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9264 | 1 | 115 | 3.90.1010.10 |
| af_Q8IKT4_39_161_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9253 | 2 | 115 | 3.90.1010.10 |
| 4eb7C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.912 | 2 | 111 | 3.90.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8UX25-F1-model_v4 | Iron-sulfur cluster assembly scaffold protein | 0.993 | 1 | 115 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-Q023P2-F1-model_v4 | Nitrogen-fixing NifU domain protein | 0.9882 | 1 | 115 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A350ULQ1-F1-model_v4 | NIF system FeS cluster assembly NifU N-terminal domain-containing protein | 0.9801 | 2 | 117 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A2N6FQ18-F1-model_v4 | Iron-sulfur cluster assembly scaffold protein | 0.9719 | 1 | 116 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A7R8B8X9-F1-model_v4 | deleted | 0.9715 | 1 | 115 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar