F405136

General Info

Members Datasets Scaffolds Average Seq Length
319 157 319 121

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10004841|Ga0265325_100048416
Length 119
Sequence VYNETFLDHFQNPRNVGELPSPPALFASVENPVCGDTLVLYARVEDGRIIEVRYQVRGCTASIATASAFTELLKGMTRAEVKALRADDAEAAIGGLAAESKHAAVLCVQAAKMLVLAWG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 2.51
Rhizosphere 96.24
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10860132 3300005327 Unclassified 788
2 Ga0070683_100039487 3300005329 Bacteria 4333
3 Ga0070683_100044992 3300005329 Bacteria 4074
4 Ga0070683_100163076 3300005329 Bacteria 2115
5 Ga0070683_100251709 3300005329 Unclassified 1680
6 Ga0070683_100356113 3300005329 Bacteria 1394
7 Ga0070690_101430170 3300005330 Bacteria 557
8 Ga0070670_100541494 3300005331 Unclassified 1038
9 Ga0068869_100030842 3300005334 Bacteria 3768
10 Ga0068869_101891683 3300005334 Unclassified 535
11 Ga0070680_100930452 3300005336 Bacteria 750
12 Ga0070682_100747722 3300005337 Bacteria 789
13 Ga0068868_101502346 3300005338 Bacteria 631
14 Ga0070689_100030046 3300005340 Bacteria 4121
15 Ga0070689_100460875 3300005340 Unclassified 1083
16 Ga0070661_101331703 3300005344 Bacteria 603
17 Ga0070709_10239760 3300005434 Bacteria 1302
18 Ga0070709_10365695 3300005434 Bacteria 1069
19 Ga0070709_10639880 3300005434 Bacteria 822
20 Ga0070714_100243693 3300005435 Bacteria 1660
21 Ga0070713_100022646 3300005436 Bacteria 4858
22 Ga0070713_100066938 3300005436 Bacteria 3023
23 Ga0070710_11256423 3300005437 Bacteria 549
24 Ga0070705_101237537 3300005440 Unclassified 616
25 Ga0070708_101068529 3300005445 Bacteria 756
26 Ga0070681_10445481 3300005458 Bacteria 1207
27 Ga0070699_101636352 3300005518 Unclassified 590
28 Ga0070684_100028901 3300005535 Bacteria 4692
29 Ga0070684_100064043 3300005535 Bacteria 3225
30 Ga0070684_100068602 3300005535 Bacteria 3117
31 Ga0070684_100862423 3300005535 Bacteria 848
32 Ga0070697_101042945 3300005536 Bacteria 727
33 Ga0068853_100363027 3300005539 Bacteria 1349
34 Ga0070695_100525963 3300005545 Bacteria 918
35 Ga0070696_100049769 3300005546 Unclassified 2912
36 Ga0070693_100216464 3300005547 Bacteria 1253
37 Ga0068855_100023676 3300005563 Bacteria 7353
38 Ga0070664_101283729 3300005564 Bacteria 691
39 Ga0070664_101766376 3300005564 Bacteria 586
40 Ga0068857_100017761 3300005577 Bacteria 6235
41 Ga0068857_101165243 3300005577 Bacteria 746
42 Ga0068856_100213635 3300005614 Bacteria 1944
43 Ga0068856_100228392 3300005614 Bacteria 1877
44 Ga0068852_100141075 3300005616 Bacteria 2230
45 Ga0068852_100658480 3300005616 Unclassified 1055
46 Ga0068859_101005819 3300005617 Bacteria 916
47 Ga0068864_100599045 3300005618 Unclassified 1069
48 Ga0068861_100258331 3300005719 Unclassified 1490
49 Ga0068861_101324974 3300005719 Bacteria 701
50 Ga0068863_100016202 3300005841 Bacteria 7151
51 Ga0068863_101212046 3300005841 Unclassified 761
52 Ga0068858_100080015 3300005842 Bacteria 3036
53 Ga0068858_100269107 3300005842 Unclassified 1621
54 Ga0068858_100479769 3300005842 Unclassified 1200
55 Ga0097621_100069536 3300006237 Bacteria 2907
56 Ga0097621_100452749 3300006237 Bacteria 1156
57 Ga0068871_100022886 3300006358 Bacteria 4824
58 Ga0068871_100086539 3300006358 Bacteria 2604
59 Ga0068871_100353566 3300006358 Bacteria 1300
60 Ga0068871_101140152 3300006358 Bacteria 730
61 Ga0068871_101934985 3300006358 Unclassified 561
62 Ga0068871_102216522 3300006358 Bacteria 524
63 Ga0075428_101240158 3300006844 Unclassified 785
64 Ga0075434_101364807 3300006871 Bacteria 719
65 Ga0068865_100340379 3300006881 Bacteria 1212
66 Ga0097620_100110685 3300006931 Bacteria 2808
67 Ga0097620_101005815 3300006931 Bacteria 916
68 Ga0105240_10000981 3300009093 Bacteria 50908
69 Ga0105240_10066990 3300009093 Bacteria 4452
70 Ga0105240_10129391 3300009093 Bacteria 3030
71 Ga0105240_10299110 3300009093 Bacteria 1841
72 Ga0105240_12299181 3300009093 Unclassified 558
73 Ga0105245_10003759 3300009098 Bacteria 13512
74 Ga0105245_10015567 3300009098 Bacteria 6631
75 Ga0105245_10393782 3300009098 Bacteria 1383
76 Ga0105245_10427847 3300009098 Bacteria 1328
77 Ga0105245_10450319 3300009098 Bacteria 1296
78 Ga0105245_10585741 3300009098 Bacteria 1140
79 Ga0105245_10998671 3300009098 Unclassified 881
80 Ga0105245_11620515 3300009098 Bacteria 699
81 Ga0105243_10250856 3300009148 Bacteria 1580
82 Ga0105243_10516737 3300009148 Unclassified 1135
83 Ga0105243_11641500 3300009148 Bacteria 670
84 Ga0105243_12112418 3300009148 Unclassified 599
85 Ga0105241_10131540 3300009174 Bacteria 2027
86 Ga0105241_10202928 3300009174 Bacteria 1657
87 Ga0105241_10320856 3300009174 Bacteria 1336
88 Ga0105241_10850923 3300009174 Unclassified 844
89 Ga0105241_11585299 3300009174 Unclassified 633
90 Ga0105242_10008946 3300009176 Bacteria 7686
91 Ga0105242_10019789 3300009176 Bacteria 5274
92 Ga0105242_10027848 3300009176 Bacteria 4493
93 Ga0105242_10103632 3300009176 Bacteria 2414
94 Ga0105242_10482012 3300009176 Unclassified 1176
95 Ga0105242_10600558 3300009176 Bacteria 1063
96 Ga0105242_11117669 3300009176 Unclassified 803
97 Ga0105242_11379915 3300009176 Bacteria 731
98 Ga0105242_12252166 3300009176 Bacteria 591
99 Ga0105242_13179685 3300009176 Bacteria 510
100 Ga0105248_10019926 3300009177 Bacteria 7425
101 Ga0105248_10048060 3300009177 Bacteria 4786
102 Ga0105248_10139846 3300009177 Bacteria 2731
103 Ga0105248_10191969 3300009177 Bacteria 2301
104 Ga0105248_10211026 3300009177 Bacteria 2188
105 Ga0105248_10227761 3300009177 Bacteria 2098
106 Ga0105248_10521002 3300009177 Bacteria 1340
107 Ga0105248_10822815 3300009177 Unclassified 1048
108 Ga0105248_11214182 3300009177 Unclassified 853
109 Ga0105248_12460932 3300009177 Bacteria 593
110 Ga0105237_10047760 3300009545 Bacteria 4303
111 Ga0105237_10310446 3300009545 Unclassified 1580
112 Ga0105237_10657217 3300009545 Unclassified 1055
113 Ga0105238_10004060 3300009551 Bacteria 14509
114 Ga0105238_10050577 3300009551 Unclassified 4183
115 Ga0105238_12006614 3300009551 Bacteria 612
116 Ga0105249_10003304 3300009553 Bacteria 13972
117 Ga0105249_10192832 3300009553 Bacteria 1989
118 Ga0105239_10010394 3300010375 Bacteria 10414
119 Ga0105239_10512451 3300010375 Bacteria 1364
120 Ga0105239_12952459 3300010375 Bacteria 554
121 Ga0105246_10014302 3300011119 Bacteria 4989
122 Ga0105246_10254911 3300011119 Unclassified 1394
123 Ga0105246_10944258 3300011119 Bacteria 777
124 Ga0157370_10004624 3300013104 Bacteria 15741
125 Ga0157369_10004503 3300013105 Bacteria 16417
126 Ga0157369_10532147 3300013105 Unclassified 1215
127 Ga0157374_10099491 3300013296 Bacteria 2786
128 Ga0157374_10206845 3300013296 Bacteria 1923
129 Ga0157374_10411727 3300013296 Unclassified 1350
130 Ga0157378_10471293 3300013297 Bacteria 1249
131 Ga0157378_10822290 3300013297 Unclassified 956
132 Ga0163162_10690998 3300013306 Bacteria 1142
133 Ga0163162_10997717 3300013306 Bacteria 947
134 Ga0157372_10026063 3300013307 Bacteria 6360
135 Ga0157372_10044529 3300013307 Bacteria 4918
136 Ga0157372_11382359 3300013307 Bacteria 812
137 Ga0157372_12111369 3300013307 Unclassified 647
138 Ga0157375_10532123 3300013308 Bacteria 1338
139 Ga0157375_11703978 3300013308 Unclassified 746
140 Ga0157375_11812912 3300013308 Bacteria 723
141 Ga0163163_10010067 3300014325 Bacteria 8483
142 Ga0163163_10407277 3300014325 Bacteria 1418
143 Ga0163163_11394431 3300014325 Bacteria 762
144 Ga0163163_11784096 3300014325 Bacteria 676
145 Ga0157380_12645066 3300014326 Unclassified 568
146 Ga0157379_10465303 3300014968 Bacteria 1169
147 Ga0157379_12126879 3300014968 Bacteria 556
148 Ga0157376_10175542 3300014969 Bacteria 1954
149 Ga0157376_12538881 3300014969 Bacteria 552
150 Ga0213875_10018110 3300021388 Bacteria 3398
151 Ga0207642_10037102 3300025899 Bacteria 2097
152 Ga0207699_10142469 3300025906 Bacteria 1577
153 Ga0207654_10139333 3300025911 Bacteria 1545
154 Ga0207654_10195124 3300025911 Bacteria 1330
155 Ga0207654_11240980 3300025911 Unclassified 543
156 Ga0207707_10381496 3300025912 Bacteria 1211
157 Ga0207695_10057134 3300025913 Bacteria 4056
158 Ga0207695_10076868 3300025913 Bacteria 3393
159 Ga0207695_11008495 3300025913 Bacteria 712
160 Ga0207671_10235629 3300025914 Bacteria 1437
161 Ga0207663_10076753 3300025916 Bacteria 2172
162 Ga0207662_10690618 3300025918 Bacteria 715
163 Ga0207681_10421909 3300025923 Unclassified 1081
164 Ga0207694_10002574 3300025924 Bacteria 14722
165 Ga0207694_10014511 3300025924 Bacteria 5940
166 Ga0207694_10066880 3300025924 Bacteria 2804
167 Ga0207694_10654613 3300025924 Unclassified 885
168 Ga0207687_10000991 3300025927 Bacteria 19255
169 Ga0207687_10551982 3300025927 Unclassified 967
170 Ga0207687_11246529 3300025927 Unclassified 639
171 Ga0207700_10007193 3300025928 Bacteria 6788
172 Ga0207700_10081541 3300025928 Bacteria 2526
173 Ga0207700_11117185 3300025928 Unclassified 704
174 Ga0207664_10685010 3300025929 Bacteria 922
175 Ga0207644_11447995 3300025931 Unclassified 577
176 Ga0207686_10009925 3300025934 Bacteria 5174
177 Ga0207686_11227463 3300025934 Bacteria 614
178 Ga0207709_10061750 3300025935 Bacteria 2343
179 Ga0207670_10243353 3300025936 Bacteria 1387
180 Ga0207670_10455094 3300025936 Bacteria 1032
181 Ga0207670_11728549 3300025936 Unclassified 532
182 Ga0207704_10114195 3300025938 Bacteria 1833
183 Ga0207665_11233838 3300025939 Unclassified 596
184 Ga0207711_10001218 3300025941 Bacteria 24359
185 Ga0207711_10083652 3300025941 Bacteria 2792
186 Ga0207711_10126196 3300025941 Bacteria 2289
187 Ga0207711_10371676 3300025941 Bacteria 1326
188 Ga0207711_10483634 3300025941 Unclassified 1153
189 Ga0207711_10631340 3300025941 Unclassified 999
190 Ga0207689_10036256 3300025942 Bacteria 4095
191 Ga0207689_11528762 3300025942 Unclassified 557
192 Ga0207661_10010996 3300025944 Bacteria 6539
193 Ga0207661_10020734 3300025944 Bacteria 4917
194 Ga0207661_10425184 3300025944 Bacteria 1207
195 Ga0207661_10981121 3300025944 Bacteria 778
196 Ga0207679_10231818 3300025945 Bacteria 1559
197 Ga0207679_11933554 3300025945 Bacteria 538
198 Ga0207667_10029672 3300025949 Bacteria 5928
199 Ga0207712_10008797 3300025961 Bacteria 6384
200 Ga0207703_10143607 3300026035 Unclassified 2074
201 Ga0207703_10270584 3300026035 Bacteria 1539
202 Ga0207703_10273134 3300026035 Bacteria 1532
203 Ga0207703_10781834 3300026035 Unclassified 911
204 Ga0207639_10225487 3300026041 Bacteria 1621
205 Ga0207639_10563867 3300026041 Bacteria 1047
206 Ga0207639_11532191 3300026041 Bacteria 626
207 Ga0207702_10056929 3300026078 Bacteria 3321
208 Ga0207702_11867905 3300026078 Bacteria 592
209 Ga0207641_10147401 3300026088 Bacteria 2129
210 Ga0207676_10485156 3300026095 Unclassified 1171
211 Ga0207674_10004644 3300026116 Bacteria 16494
212 Ga0207675_101947560 3300026118 Unclassified 606
213 Ga0207698_10328933 3300026142 Bacteria 1435
214 Ga0207698_10569427 3300026142 Unclassified 1113
215 Ga0268264_11062238 3300028381 Unclassified 817
216 Ga0265337_1037426 3300028556 Bacteria 1412
217 Ga0265336_10076269 3300028666 Bacteria 1001
218 Ga0265338_10021581 3300028800 Bacteria 6709
219 Ga0265338_10339782 3300028800 Bacteria 1082
220 Ga0265324_10066743 3300029957 Unclassified 1227
221 Ga0265332_10008260 3300031238 Bacteria 4677
222 Ga0265328_10002820 3300031239 Bacteria 7775
223 Ga0265320_10104888 3300031240 Bacteria 1299
224 Ga0265325_10004841 3300031241 Bacteria 8419
225 Ga0265329_10167670 3300031242 Unclassified 715
226 Ga0265340_10000527 3300031247 Bacteria 21112
227 Ga0265340_10061781 3300031247 Bacteria 1791
228 Ga0265331_10052585 3300031250 Bacteria 1945
229 Ga0265331_10365391 3300031250 Unclassified 646
230 Ga0265316_10001734 3300031344 Bacteria 23126
231 Ga0265316_10002009 3300031344 Bacteria 21419
232 Ga0265316_10014840 3300031344 Bacteria 6835
233 Ga0265316_10015285 3300031344 Bacteria 6716
234 Ga0265316_10049509 3300031344 Bacteria 3310
235 Ga0265316_10122711 3300031344 Bacteria 1961
236 Ga0265316_10252427 3300031344 Bacteria 1295
237 Ga0265313_10001131 3300031595 Bacteria 25506
238 Ga0265314_10002594 3300031711 Bacteria 18280
239 Ga0265342_10011368 3300031712 Bacteria 6100
240 Ga0373934_0001013 3300035086 Bacteria 10168
241 Ga0373934_0224856 3300035086 Unclassified 774
242 Ga0373934_0225838 3300035086 Bacteria 773
243 Ga0373934_0329892 3300035086 Bacteria 634
244 Ga0373923_0017167 3300035111 Bacteria 2764
245 Ga0373953_0030844 3300035117 Bacteria 2081
246 Ga0373954_0031446 3300035118 Bacteria 2451
247 Ga0373954_0032995 3300035118 Bacteria 2395
248 Ga0373954_0181268 3300035118 Bacteria 1033
249 Ga0373956_0156482 3300035119 Bacteria 1073
250 Ga0373957_0201018 3300035120 Bacteria 830
251 Ga0373955_0006581 3300035172 Bacteria 5300
252 Ga0373955_0016921 3300035172 Bacteria 3596
253 Ga0373955_0461628 3300035172 Bacteria 774
254 Ga0373924_0295685 3300035410 Bacteria 719
255 Ga0373935_0206647 3300035692 Bacteria 1359
256 Ga0373927_0000509 3300035695 Bacteria 29593
257 Ga0373927_0322082 3300035695 Bacteria 1018
258 Ga0373933_0070108 3300035724 Bacteria 2132
259 Ga0373933_0628076 3300035724 Unclassified 706
260 Ga0373937_0007994 3300036401 Bacteria 9171
261 Ga0373937_0076690 3300036401 Bacteria 3088
262 Ga0373937_0095288 3300036401 Bacteria 2760
263 Ga0373937_0185670 3300036401 Unclassified 1953
264 Ga0373937_0693364 3300036401 Bacteria 965
265 Ga0373925_0004399 3300037068 Bacteria 10644
266 Ga0373925_0233618 3300037068 Bacteria 1471
267 Ga0373925_0457991 3300037068 Bacteria 1045
268 Ga0373925_1260191 3300037068 Unclassified 607
269 Ga0436364_0561252 3300037853 Unclassified 508
270 Ga0436365_0036783 3300039437 Bacteria 2184
271 Ga0451576_0030246 3300045051 Bacteria 5790
272 Ga0451576_1271538 3300045051 Bacteria 767
273 Ga0495592_0276834 3300046454 Bacteria 1099
274 Ga0495580_0043304 3300046472 Bacteria 3204
275 Ga0495580_0137178 3300046472 Bacteria 1696
276 Ga0495580_0157519 3300046472 Bacteria 1572
277 Ga0495580_0341477 3300046472 Bacteria 1015
278 Ga0495580_0382056 3300046472 Bacteria 951
279 Ga0495608_0158236 3300046511 Bacteria 1441
280 Ga0495618_0921144 3300046514 Unclassified 504
281 Ga0495665_0468225 3300046531 Unclassified 636
282 Ga0495665_0583628 3300046531 Bacteria 559
283 Ga0495587_0010425 3300046536 Bacteria 5916
284 Ga0495587_0222698 3300046536 Bacteria 1064
285 Ga0495645_0600869 3300046543 Bacteria 677
286 Ga0495667_0029287 3300046559 Unclassified 3706
287 Ga0495667_0081509 3300046559 Bacteria 2103
288 Ga0495667_0152314 3300046559 Bacteria 1488
289 Ga0495635_0289222 3300046663 Unclassified 1100
290 Ga0495599_0775505 3300046678 Unclassified 549
291 Ga0495623_0008885 3300046679 Bacteria 6523
292 Ga0495623_0035060 3300046679 Bacteria 3216
293 Ga0495623_0598061 3300046679 Unclassified 573
294 Ga0495669_0309173 3300046684 Unclassified 762
295 Ga0495600_0381548 3300046809 Bacteria 879
296 Ga0495604_0050334 3300047317 Unclassified 3235
297 Ga0495604_0403855 3300047317 Bacteria 899
298 Ga0495604_0411037 3300047317 Bacteria 890
299 Ga0495636_0052254 3300047318 Bacteria 1714
300 Ga0495674_1347028 3300047319 Bacteria 534
301 Ga0495680_0055467 3300047322 Unclassified 3074
302 Ga0495675_0121064 3300047444 Bacteria 1630
303 Ga0495684_0006279 3300047471 Bacteria 9236
304 Ga0495684_0022437 3300047471 Bacteria 4857
305 Ga0495684_1087458 3300047471 Unclassified 502
306 Ga0495593_0118465 3300047673 Unclassified 1348
307 Ga0495602_0009445 3300048088 Bacteria 10146
308 Ga0495602_0012060 3300048088 Bacteria 8907
309 Ga0495602_0533744 3300048088 Bacteria 815
310 Ga0496102_0166580 3300048905 Bacteria 2074
311 Ga0496104_0065663 3300048907 Bacteria 3444
312 Ga0496104_0090897 3300048907 Bacteria 2918
313 Ga0496105_0708898 3300048908 Unclassified 772
314 Ga0496112_0478355 3300048915 Bacteria 1182
315 Ga0496112_0798069 3300048915 Bacteria 869
316 Ga0496113_0623811 3300048916 Unclassified 863
317 Ga0496115_0169838 3300048918 Unclassified 1803
318 nmdc:mga08x19_1279601_c1 3300050514 Bacteria 519
319 Ga0500568_0000303 3300053139 Bacteria 39449

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031344 Ga0265316_10015285 Ga0265316_100152851 106
2 3300009093 Ga0105240_10066990 Ga0105240_100669903 112
3 3300009551 Ga0105238_10050577 Ga0105238_100505771 112
4 3300010375 Ga0105239_12952459 Ga0105239_129524592 112
5 3300013105 Ga0157369_10532147 Ga0157369_105321472 114
6 3300005331 Ga0070670_100541494 Ga0070670_1005414941 115
7 3300005618 Ga0068864_100599045 Ga0068864_1005990451 115
8 3300005841 Ga0068863_100016202 Ga0068863_1000162026 115
9 3300005842 Ga0068858_100269107 Ga0068858_1002691073 115
10 3300005842 Ga0068858_100479769 Ga0068858_1004797693 115
11 3300006358 Ga0068871_102216522 Ga0068871_1022165221 115
12 3300006931 Ga0097620_100110685 Ga0097620_1001106852 115
13 3300009176 Ga0105242_10482012 Ga0105242_104820123 115
14 3300009176 Ga0105242_10600558 Ga0105242_106005582 115
15 3300009177 Ga0105248_10139846 Ga0105248_101398462 115
16 3300009177 Ga0105248_10211026 Ga0105248_102110261 115
17 3300009177 Ga0105248_10521002 Ga0105248_105210022 115
18 3300009545 Ga0105237_10657217 Ga0105237_106572172 115
19 3300013296 Ga0157374_10411727 Ga0157374_104117272 115
20 3300014325 Ga0163163_10010067 Ga0163163_100100675 115
21 3300014968 Ga0157379_10465303 Ga0157379_104653031 115
22 3300025931 Ga0207644_11447995 Ga0207644_114479952 115
23 3300025936 Ga0207670_11728549 Ga0207670_117285491 115
24 3300025941 Ga0207711_10083652 Ga0207711_100836523 115
25 3300025941 Ga0207711_10371676 Ga0207711_103716762 115
26 3300025941 Ga0207711_10483634 Ga0207711_104836342 115
27 3300026035 Ga0207703_10270584 Ga0207703_102705842 115
28 3300026035 Ga0207703_10781834 Ga0207703_107818341 115
29 3300026088 Ga0207641_10147401 Ga0207641_101474011 115
30 3300026095 Ga0207676_10485156 Ga0207676_104851562 115
31 3300031344 Ga0265316_10049509 Ga0265316_100495092 115
32 3300031344 Ga0265316_10122711 Ga0265316_101227112 115
33 3300035086 Ga0373934_0225838 Ga0373934_0225838_96_452 115
34 3300035118 Ga0373954_0181268 Ga0373954_0181268_661_1017 115
35 3300035695 Ga0373927_0322082 Ga0373927_0322082_165_530 115
36 3300036401 Ga0373937_0185670 Ga0373937_0185670_116_475 115
37 3300036401 Ga0373937_0693364 Ga0373937_0693364_202_558 115
38 3300037068 Ga0373925_0233618 Ga0373925_0233618_389_754 115
39 3300046454 Ga0495592_0276834 Ga0495592_0276834_638_997 115
40 3300046472 Ga0495580_0341477 Ga0495580_0341477_171_536 115
41 3300046511 Ga0495608_0158236 Ga0495608_0158236_1072_1431 115
42 3300046514 Ga0495618_0921144 Ga0495618_0921144_21_377 115
43 3300046536 Ga0495587_0222698 Ga0495587_0222698_526_882 115
44 3300046559 Ga0495667_0029287 Ga0495667_0029287_1335_1694 115
45 3300046663 Ga0495635_0289222 Ga0495635_0289222_393_752 115
46 3300046678 Ga0495599_0775505 Ga0495599_0775505_150_509 115
47 3300046679 Ga0495623_0008885 Ga0495623_0008885_1063_1422 115
48 3300046679 Ga0495623_0598061 Ga0495623_0598061_10_366 115
49 3300046809 Ga0495600_0381548 Ga0495600_0381548_173_532 115
50 3300047317 Ga0495604_0050334 Ga0495604_0050334_2859_3218 115
51 3300047317 Ga0495604_0411037 Ga0495604_0411037_95_451 115
52 3300047319 Ga0495674_1347028 Ga0495674_1347028_133_498 115
53 3300047322 Ga0495680_0055467 Ga0495680_0055467_132_491 115
54 3300047444 Ga0495675_0121064 Ga0495675_0121064_730_1086 115
55 3300047471 Ga0495684_0006279 Ga0495684_0006279_4956_5315 115
56 3300047471 Ga0495684_1087458 Ga0495684_1087458_83_457 115
57 3300047673 Ga0495593_0118465 Ga0495593_0118465_241_600 115
58 3300048088 Ga0495602_0012060 Ga0495602_0012060_5427_5786 115
59 3300048088 Ga0495602_0533744 Ga0495602_0533744_70_426 115
60 3300048915 Ga0496112_0798069 Ga0496112_0798069_269_634 115
61 3300048916 Ga0496113_0623811 Ga0496113_0623811_15_380 115
62 3300025929 Ga0207664_10685010 Ga0207664_106850102 116
63 3300031344 Ga0265316_10001734 Ga0265316_1000173410 116
64 3300035695 Ga0373927_0000509 Ga0373927_0000509_8358_8708 116
65 3300045051 Ga0451576_1271538 Ga0451576_1271538_69_419 116
66 3300046472 Ga0495580_0137178 Ga0495580_0137178_712_1062 116
67 3300046543 Ga0495645_0600869 Ga0495645_0600869_303_665 116
68 3300005329 Ga0070683_100251709 Ga0070683_1002517092 117
69 3300005434 Ga0070709_10639880 Ga0070709_106398802 117
70 3300005437 Ga0070710_11256423 Ga0070710_112564231 117
71 3300005564 Ga0070664_101283729 Ga0070664_1012837292 117
72 3300005616 Ga0068852_100658480 Ga0068852_1006584802 117
73 3300013308 Ga0157375_11703978 Ga0157375_117039782 117
74 3300025913 Ga0207695_10057134 Ga0207695_100571343 117
75 3300025924 Ga0207694_10654613 Ga0207694_106546131 117
76 3300025928 Ga0207700_11117185 Ga0207700_111171852 117
77 3300025945 Ga0207679_11933554 Ga0207679_119335541 117
78 3300026142 Ga0207698_10569427 Ga0207698_105694272 117
79 3300037068 Ga0373925_1260191 Ga0373925_1260191_50_415 117
80 3300053139 Ga0500568_0000303 Ga0500568_0000303_2056_2415 117
81 3300005330 Ga0070690_101430170 Ga0070690_1014301701 118
82 3300005340 Ga0070689_100030046 Ga0070689_1000300462 118
83 3300005435 Ga0070714_100243693 Ga0070714_1002436931 118
84 3300005436 Ga0070713_100066938 Ga0070713_1000669382 118
85 3300005445 Ga0070708_101068529 Ga0070708_1010685291 118
86 3300005614 Ga0068856_100228392 Ga0068856_1002283922 118
87 3300009098 Ga0105245_10393782 Ga0105245_103937821 118
88 3300009098 Ga0105245_10427847 Ga0105245_104278472 118
89 3300009176 Ga0105242_10008946 Ga0105242_100089467 118
90 3300009176 Ga0105242_11379915 Ga0105242_113799151 118
91 3300009177 Ga0105248_10191969 Ga0105248_101919693 118
92 3300009177 Ga0105248_11214182 Ga0105248_112141821 118
93 3300013296 Ga0157374_10099491 Ga0157374_100994912 118
94 3300013306 Ga0163162_10690998 Ga0163162_106909982 118
95 3300013308 Ga0157375_10532123 Ga0157375_105321232 118
96 3300014325 Ga0163163_11784096 Ga0163163_117840962 118
97 3300014968 Ga0157379_12126879 Ga0157379_121268791 118
98 3300025916 Ga0207663_10076753 Ga0207663_100767532 118
99 3300025928 Ga0207700_10081541 Ga0207700_100815413 118
100 3300025936 Ga0207670_10243353 Ga0207670_102433532 118
101 3300026035 Ga0207703_10273134 Ga0207703_102731342 118
102 3300031241 Ga0265325_10004841 Ga0265325_100048416 118
103 3300031344 Ga0265316_10002009 Ga0265316_1000200914 118
104 3300047318 Ga0495636_0052254 Ga0495636_0052254_1195_1557 118
105 3300005327 Ga0070658_10860132 Ga0070658_108601322 119
106 3300005329 Ga0070683_100039487 Ga0070683_1000394875 119
107 3300005329 Ga0070683_100044992 Ga0070683_1000449924 119
108 3300005329 Ga0070683_100163076 Ga0070683_1001630762 119
109 3300005329 Ga0070683_100356113 Ga0070683_1003561131 119
110 3300005334 Ga0068869_100030842 Ga0068869_1000308425 119
111 3300005334 Ga0068869_101891683 Ga0068869_1018916831 119
112 3300005336 Ga0070680_100930452 Ga0070680_1009304522 119
113 3300005337 Ga0070682_100747722 Ga0070682_1007477222 119
114 3300005338 Ga0068868_101502346 Ga0068868_1015023462 119
115 3300005340 Ga0070689_100460875 Ga0070689_1004608752 119
116 3300005344 Ga0070661_101331703 Ga0070661_1013317031 119
117 3300005434 Ga0070709_10239760 Ga0070709_102397602 119
118 3300005434 Ga0070709_10365695 Ga0070709_103656951 119
119 3300005436 Ga0070713_100022646 Ga0070713_1000226465 119
120 3300005440 Ga0070705_101237537 Ga0070705_1012375372 119
121 3300005458 Ga0070681_10445481 Ga0070681_104454812 119
122 3300005518 Ga0070699_101636352 Ga0070699_1016363521 119
123 3300005535 Ga0070684_100028901 Ga0070684_1000289014 119
124 3300005535 Ga0070684_100064043 Ga0070684_1000640435 119
125 3300005535 Ga0070684_100068602 Ga0070684_1000686021 119
126 3300005535 Ga0070684_100862423 Ga0070684_1008624232 119
127 3300005536 Ga0070697_101042945 Ga0070697_1010429452 119
128 3300005539 Ga0068853_100363027 Ga0068853_1003630272 119
129 3300005545 Ga0070695_100525963 Ga0070695_1005259632 119
130 3300005546 Ga0070696_100049769 Ga0070696_1000497695 119
131 3300005547 Ga0070693_100216464 Ga0070693_1002164642 119
132 3300005563 Ga0068855_100023676 Ga0068855_1000236763 119
133 3300005564 Ga0070664_101766376 Ga0070664_1017663762 119
134 3300005577 Ga0068857_100017761 Ga0068857_1000177612 119
135 3300005577 Ga0068857_101165243 Ga0068857_1011652431 119
136 3300005614 Ga0068856_100213635 Ga0068856_1002136353 119
137 3300005616 Ga0068852_100141075 Ga0068852_1001410752 119
138 3300005617 Ga0068859_101005819 Ga0068859_1010058192 119
139 3300005719 Ga0068861_100258331 Ga0068861_1002583312 119
140 3300005719 Ga0068861_101324974 Ga0068861_1013249742 119
141 3300005841 Ga0068863_101212046 Ga0068863_1012120461 119
142 3300005842 Ga0068858_100080015 Ga0068858_1000800154 119
143 3300006237 Ga0097621_100069536 Ga0097621_1000695361 119
144 3300006237 Ga0097621_100452749 Ga0097621_1004527492 119
145 3300006358 Ga0068871_100022886 Ga0068871_1000228862 119
146 3300006358 Ga0068871_100086539 Ga0068871_1000865393 119
147 3300006358 Ga0068871_100353566 Ga0068871_1003535662 119
148 3300006358 Ga0068871_101140152 Ga0068871_1011401522 119
149 3300006358 Ga0068871_101934985 Ga0068871_1019349851 119
150 3300006844 Ga0075428_101240158 Ga0075428_1012401582 119
151 3300006871 Ga0075434_101364807 Ga0075434_1013648072 119
152 3300006881 Ga0068865_100340379 Ga0068865_1003403792 119
153 3300006931 Ga0097620_101005815 Ga0097620_1010058152 119
154 3300009093 Ga0105240_10000981 Ga0105240_1000098112 119
155 3300009093 Ga0105240_10129391 Ga0105240_101293913 119
156 3300009093 Ga0105240_10299110 Ga0105240_102991102 119
157 3300009093 Ga0105240_12299181 Ga0105240_122991811 119
158 3300009098 Ga0105245_10003759 Ga0105245_1000375916 119
159 3300009098 Ga0105245_10015567 Ga0105245_100155675 119
160 3300009098 Ga0105245_10450319 Ga0105245_104503192 119
161 3300009098 Ga0105245_10585741 Ga0105245_105857412 119
162 3300009098 Ga0105245_10998671 Ga0105245_109986711 119
163 3300009098 Ga0105245_11620515 Ga0105245_116205151 119
164 3300009148 Ga0105243_10250856 Ga0105243_102508562 119
165 3300009148 Ga0105243_10516737 Ga0105243_105167372 119
166 3300009148 Ga0105243_11641500 Ga0105243_116415001 119
167 3300009148 Ga0105243_12112418 Ga0105243_121124181 119
168 3300009174 Ga0105241_10131540 Ga0105241_101315402 119
169 3300009174 Ga0105241_10202928 Ga0105241_102029282 119
170 3300009174 Ga0105241_10320856 Ga0105241_103208561 119
171 3300009174 Ga0105241_10850923 Ga0105241_108509232 119
172 3300009174 Ga0105241_11585299 Ga0105241_115852991 119
173 3300009176 Ga0105242_10019789 Ga0105242_100197895 119
174 3300009176 Ga0105242_10027848 Ga0105242_100278482 119
175 3300009176 Ga0105242_10103632 Ga0105242_101036323 119
176 3300009176 Ga0105242_11117669 Ga0105242_111176692 119
177 3300009176 Ga0105242_12252166 Ga0105242_122521661 119
178 3300009176 Ga0105242_13179685 Ga0105242_131796851 119
179 3300009177 Ga0105248_10019926 Ga0105248_100199262 119
180 3300009177 Ga0105248_10048060 Ga0105248_100480604 119
181 3300009177 Ga0105248_10227761 Ga0105248_102277613 119
182 3300009177 Ga0105248_10822815 Ga0105248_108228152 119
183 3300009177 Ga0105248_12460932 Ga0105248_124609321 119
184 3300009545 Ga0105237_10047760 Ga0105237_100477603 119
185 3300009545 Ga0105237_10310446 Ga0105237_103104461 119
186 3300009551 Ga0105238_10004060 Ga0105238_100040606 119
187 3300009551 Ga0105238_12006614 Ga0105238_120066141 119
188 3300009553 Ga0105249_10003304 Ga0105249_100033044 119
189 3300009553 Ga0105249_10192832 Ga0105249_101928323 119
190 3300010375 Ga0105239_10010394 Ga0105239_100103948 119
191 3300010375 Ga0105239_10512451 Ga0105239_105124511 119
192 3300011119 Ga0105246_10014302 Ga0105246_100143022 119
193 3300011119 Ga0105246_10254911 Ga0105246_102549112 119
194 3300011119 Ga0105246_10944258 Ga0105246_109442582 119
195 3300013104 Ga0157370_10004624 Ga0157370_100046249 119
196 3300013105 Ga0157369_10004503 Ga0157369_100045039 119
197 3300013296 Ga0157374_10206845 Ga0157374_102068452 119
198 3300013297 Ga0157378_10471293 Ga0157378_104712932 119
199 3300013297 Ga0157378_10822290 Ga0157378_108222902 119
200 3300013306 Ga0163162_10997717 Ga0163162_109977172 119
201 3300013307 Ga0157372_10026063 Ga0157372_100260636 119
202 3300013307 Ga0157372_10044529 Ga0157372_100445293 119
203 3300013307 Ga0157372_11382359 Ga0157372_113823592 119
204 3300013307 Ga0157372_12111369 Ga0157372_121113692 119
205 3300013308 Ga0157375_11812912 Ga0157375_118129122 119
206 3300014325 Ga0163163_10407277 Ga0163163_104072771 119
207 3300014325 Ga0163163_11394431 Ga0163163_113944312 119
208 3300014326 Ga0157380_12645066 Ga0157380_126450661 119
209 3300014969 Ga0157376_10175542 Ga0157376_101755422 119
210 3300014969 Ga0157376_12538881 Ga0157376_125388811 119
211 3300021388 Ga0213875_10018110 Ga0213875_100181101 119
212 3300025899 Ga0207642_10037102 Ga0207642_100371023 119
213 3300025906 Ga0207699_10142469 Ga0207699_101424692 119
214 3300025911 Ga0207654_10139333 Ga0207654_101393331 119
215 3300025911 Ga0207654_10195124 Ga0207654_101951242 119
216 3300025911 Ga0207654_11240980 Ga0207654_112409801 119
217 3300025912 Ga0207707_10381496 Ga0207707_103814961 119
218 3300025913 Ga0207695_10076868 Ga0207695_100768683 119
219 3300025913 Ga0207695_11008495 Ga0207695_110084951 119
220 3300025914 Ga0207671_10235629 Ga0207671_102356292 119
221 3300025918 Ga0207662_10690618 Ga0207662_106906181 119
222 3300025923 Ga0207681_10421909 Ga0207681_104219092 119
223 3300025924 Ga0207694_10002574 Ga0207694_100025746 119
224 3300025924 Ga0207694_10014511 Ga0207694_100145114 119
225 3300025924 Ga0207694_10066880 Ga0207694_100668802 119
226 3300025927 Ga0207687_10000991 Ga0207687_1000099116 119
227 3300025927 Ga0207687_10551982 Ga0207687_105519822 119
228 3300025927 Ga0207687_11246529 Ga0207687_112465292 119
229 3300025928 Ga0207700_10007193 Ga0207700_100071935 119
230 3300025934 Ga0207686_10009925 Ga0207686_100099255 119
231 3300025934 Ga0207686_11227463 Ga0207686_112274632 119
232 3300025935 Ga0207709_10061750 Ga0207709_100617502 119
233 3300025936 Ga0207670_10455094 Ga0207670_104550942 119
234 3300025938 Ga0207704_10114195 Ga0207704_101141952 119
235 3300025939 Ga0207665_11233838 Ga0207665_112338382 119
236 3300025941 Ga0207711_10001218 Ga0207711_1000121810 119
237 3300025941 Ga0207711_10126196 Ga0207711_101261962 119
238 3300025941 Ga0207711_10631340 Ga0207711_106313402 119
239 3300025942 Ga0207689_10036256 Ga0207689_100362562 119
240 3300025942 Ga0207689_11528762 Ga0207689_115287621 119
241 3300025944 Ga0207661_10010996 Ga0207661_100109964 119
242 3300025944 Ga0207661_10020734 Ga0207661_100207345 119
243 3300025944 Ga0207661_10425184 Ga0207661_104251842 119
244 3300025944 Ga0207661_10981121 Ga0207661_109811212 119
245 3300025945 Ga0207679_10231818 Ga0207679_102318182 119
246 3300025949 Ga0207667_10029672 Ga0207667_100296723 119
247 3300025961 Ga0207712_10008797 Ga0207712_100087974 119
248 3300026035 Ga0207703_10143607 Ga0207703_101436073 119
249 3300026041 Ga0207639_10225487 Ga0207639_102254872 119
250 3300026041 Ga0207639_10563867 Ga0207639_105638672 119
251 3300026041 Ga0207639_11532191 Ga0207639_115321912 119
252 3300026078 Ga0207702_10056929 Ga0207702_100569292 119
253 3300026078 Ga0207702_11867905 Ga0207702_118679052 119
254 3300026116 Ga0207674_10004644 Ga0207674_100046448 119
255 3300026118 Ga0207675_101947560 Ga0207675_1019475602 119
256 3300026142 Ga0207698_10328933 Ga0207698_103289332 119
257 3300028381 Ga0268264_11062238 Ga0268264_110622381 119
258 3300028556 Ga0265337_1037426 Ga0265337_10374261 119
259 3300028666 Ga0265336_10076269 Ga0265336_100762692 119
260 3300028800 Ga0265338_10021581 Ga0265338_100215812 119
261 3300028800 Ga0265338_10339782 Ga0265338_103397821 119
262 3300029957 Ga0265324_10066743 Ga0265324_100667431 119
263 3300031238 Ga0265332_10008260 Ga0265332_100082602 119
264 3300031239 Ga0265328_10002820 Ga0265328_100028204 119
265 3300031240 Ga0265320_10104888 Ga0265320_101048882 119
266 3300031242 Ga0265329_10167670 Ga0265329_101676702 119
267 3300031247 Ga0265340_10000527 Ga0265340_1000052726 119
268 3300031247 Ga0265340_10061781 Ga0265340_100617812 119
269 3300031250 Ga0265331_10052585 Ga0265331_100525852 119
270 3300031250 Ga0265331_10365391 Ga0265331_103653911 119
271 3300031344 Ga0265316_10014840 Ga0265316_100148408 119
272 3300031344 Ga0265316_10252427 Ga0265316_102524271 119
273 3300031595 Ga0265313_10001131 Ga0265313_1000113118 119
274 3300031711 Ga0265314_10002594 Ga0265314_1000259420 119
275 3300031712 Ga0265342_10011368 Ga0265342_100113683 119
276 3300035086 Ga0373934_0001013 Ga0373934_0001013_8955_9314 119
277 3300035086 Ga0373934_0224856 Ga0373934_0224856_243_602 119
278 3300035086 Ga0373934_0329892 Ga0373934_0329892_115_480 119
279 3300035111 Ga0373923_0017167 Ga0373923_0017167_1763_2122 119
280 3300035117 Ga0373953_0030844 Ga0373953_0030844_1267_1626 119
281 3300035118 Ga0373954_0031446 Ga0373954_0031446_1658_2017 119
282 3300035118 Ga0373954_0032995 Ga0373954_0032995_818_1177 119
283 3300035119 Ga0373956_0156482 Ga0373956_0156482_104_463 119
284 3300035120 Ga0373957_0201018 Ga0373957_0201018_318_683 119
285 3300035172 Ga0373955_0006581 Ga0373955_0006581_357_716 119
286 3300035172 Ga0373955_0016921 Ga0373955_0016921_404_769 119
287 3300035172 Ga0373955_0461628 Ga0373955_0461628_38_469 119
288 3300035410 Ga0373924_0295685 Ga0373924_0295685_162_521 119
289 3300035692 Ga0373935_0206647 Ga0373935_0206647_298_672 119
290 3300035724 Ga0373933_0070108 Ga0373933_0070108_220_585 119
291 3300035724 Ga0373933_0628076 Ga0373933_0628076_32_391 119
292 3300036401 Ga0373937_0007994 Ga0373937_0007994_5018_5383 119
293 3300036401 Ga0373937_0076690 Ga0373937_0076690_2673_3032 119
294 3300036401 Ga0373937_0095288 Ga0373937_0095288_1554_1913 119
295 3300037068 Ga0373925_0004399 Ga0373925_0004399_1918_2280 119
296 3300037068 Ga0373925_0457991 Ga0373925_0457991_246_620 119
297 3300037853 Ga0436364_0561252 Ga0436364_0561252_99_461 119
298 3300039437 Ga0436365_0036783 Ga0436365_0036783_898_1260 119
299 3300045051 Ga0451576_0030246 Ga0451576_0030246_453_818 119
300 3300046472 Ga0495580_0043304 Ga0495580_0043304_1674_2036 119
301 3300046472 Ga0495580_0157519 Ga0495580_0157519_1181_1540 119
302 3300046472 Ga0495580_0382056 Ga0495580_0382056_130_504 119
303 3300046531 Ga0495665_0468225 Ga0495665_0468225_190_564 119
304 3300046531 Ga0495665_0583628 Ga0495665_0583628_70_501 119
305 3300046536 Ga0495587_0010425 Ga0495587_0010425_90_449 119
306 3300046559 Ga0495667_0081509 Ga0495667_0081509_384_743 119
307 3300046559 Ga0495667_0152314 Ga0495667_0152314_904_1263 119
308 3300046679 Ga0495623_0035060 Ga0495623_0035060_60_419 119
309 3300046684 Ga0495669_0309173 Ga0495669_0309173_288_671 119
310 3300047317 Ga0495604_0403855 Ga0495604_0403855_79_438 119
311 3300047471 Ga0495684_0022437 Ga0495684_0022437_3066_3425 119
312 3300048088 Ga0495602_0009445 Ga0495602_0009445_112_471 119
313 3300048905 Ga0496102_0166580 Ga0496102_0166580_109_468 119
314 3300048907 Ga0496104_0065663 Ga0496104_0065663_1667_2026 119
315 3300048907 Ga0496104_0090897 Ga0496104_0090897_1684_2043 119
316 3300048908 Ga0496105_0708898 Ga0496105_0708898_184_543 119
317 3300048915 Ga0496112_0478355 Ga0496112_0478355_19_402 119
318 3300048918 Ga0496115_0169838 Ga0496115_0169838_1166_1525 119
319 3300050514 nmdc:mga08x19_1279601_c1 nmdc:mga08x19_1279601_c1_132_491 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

1

118

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eb5-assembly1.cif.gz_D a. fulgidus iscs-iscu complex structure 0.9414 2 109
5wlw-assembly1.cif.gz_H crystal structure of the human mitochondrial cysteine desulfurase with active cysteine loop within iscu1 active site, coordinating zn ion. complexed with human isd11 and e. coli acp1 at 3.3a. 0.932 3 114
3lvl-assembly1.cif.gz_A-2 crystal structure of e.coli iscs-iscu complex 0.9268 1 114
4eb5-assembly1.cif.gz_C a. fulgidus iscs-iscu complex structure 0.9267 2 111
5wkp-assembly1.cif.gz_D crystal structure of the human mitochondrial cysteine desulfurase in complex with isd11 and iron-sulfur cluster scaffold protein iscu1, and e. coli acp1 protein at 3.15a 0.9156 8 112
ID Description Score Start End Superfamily
4eb5D00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9414 2 109 3.90.1010.10
5wlwD01 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9298 23 114 3.90.1010.10
af_Q9MAB6_26_163_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9264 1 115 3.90.1010.10
af_Q8IKT4_39_161_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9253 2 115 3.90.1010.10
4eb7C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.912 2 111 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A2V8UX25-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.993 1 115 GO:0005506
GO:0016226
GO:0051536
AF-Q023P2-F1-model_v4 Nitrogen-fixing NifU domain protein 0.9882 1 115 GO:0005506
GO:0016226
GO:0051536
AF-A0A350ULQ1-F1-model_v4 NIF system FeS cluster assembly NifU N-terminal domain-containing protein 0.9801 2 117 GO:0005506
GO:0016226
GO:0051536
AF-A0A2N6FQ18-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9719 1 116 GO:0005506
GO:0016226
GO:0051536
AF-A0A7R8B8X9-F1-model_v4 deleted 0.9715 1 115

Feature Viewer

pLDDT pTM Quality
94.45 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map