F405043

General Info

Members Datasets Scaffolds Average Seq Length
319 245 251 221

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10011019|Ga0105240_100110193
Length 233
Sequence MIDTDAKTSPSKILVLGATGGTGRLIVSQALARGHQVTALVRSPAKASDLKGARLVVGDVRDETALREALKGQDAVVSALGTPASPYREVTLLSTATRALVDAMKAEHVSRLVCITGMGAGESAGHGGLLFDRLIFPLLLRKVYADKDRQEAIVRDSGLDWVLVRPAVLNDKPGRDAIRSLEELSKFRGGTISRRRCGVRPGSAAVRCLAASFSVDHMVTEICVSTDAVIHAA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
6 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
7 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
8 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
9 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
10 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
11 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
12 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
13 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
14 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
15 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
16 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
17 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
18 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
19 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
20 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
21 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
22 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
23 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
24 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
25 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
26 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
27 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
28 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
29 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
30 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
31 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
32 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
33 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
34 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
35 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
36 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
37 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
38 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
39 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
40 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
41 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
42 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
43 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
44 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
45 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
46 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
47 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
48 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
49 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
50 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
51 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
52 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
53 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
54 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
55 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
56 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
57 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
58 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
59 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
60 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
61 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
62 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
63 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
64 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
65 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
66 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
139 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
153 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
154 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
155 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
210 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
211 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
212 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
215 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
216 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
217 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
218 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
226 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
227 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
228 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
229 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
232 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
235 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
236 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
237 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
238 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
239 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
240 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
241 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
242 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
243 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
244 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
245 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79
Metatranscriptomes 0
Isolates 21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.51
Nodule 17.87
Rhizoplane 3.76
Rhizosphere 34.17
Stem 0
Stem Tuber 0
Unclassified 20.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000012 3300002705 Bacteria 194393
2 JGI25154J39366_1000029 3300002738 Bacteria 194393
3 JGI25157J39369_1000014 3300002741 Bacteria 194393
4 JGI25152J39213_1001737 3300002773 Bacteria 8909
5 JGI25153J46596_10021140 3300003215 Bacteria 2434
6 rootH1_10052037 3300003323 Bacteria 3057
7 rootH1_10296371 3300003323 Bacteria 1528
8 JGI25160J50197_1004895 3300003354 Bacteria 5699
9 JGI25160J50197_1026234 3300003354 Bacteria 1611
10 Ga0065165_1026459 3300005262 Bacteria 1908
11 Ga0065165_1032214 3300005262 Bacteria 1645
12 Ga0070660_100281160 3300005339 Bacteria 1362
13 Ga0070709_10000625 3300005434 Bacteria 20227
14 Ga0070714_100019151 3300005435 Bacteria 5572
15 Ga0070714_100057837 3300005435 Bacteria 3320
16 Ga0070713_100148363 3300005436 Bacteria 2084
17 Ga0070710_10000838 3300005437 Bacteria 14792
18 Ga0070711_100001438 3300005439 Bacteria 13086
19 Ga0070665_100197939 3300005548 Bacteria 2010
20 Ga0068855_100006596 3300005563 Bacteria 14110
21 Ga0068852_100051909 3300005616 Bacteria 3522
22 Ga0068858_100817009 3300005842 Bacteria 910
23 Ga0068860_100001582 3300005843 Bacteria 24502
24 Ga0081540_1021405 3300005983 Bacteria 3851
25 Ga0081540_1094441 3300005983 Bacteria 1306
26 Ga0070717_10057981 3300006028 Bacteria 3201
27 Ga0075365_10275013 3300006038 Bacteria 1185
28 Ga0075368_10124993 3300006042 Bacteria 1067
29 Ga0070715_10019578 3300006163 Bacteria 2598
30 Ga0070716_100040133 3300006173 Bacteria 2603
31 Ga0070712_100013166 3300006175 Bacteria 5277
32 Ga0075367_10257051 3300006178 Bacteria 1096
33 Ga0075369_10054906 3300006186 Bacteria 1730
34 Ga0075366_10146900 3300006195 Bacteria 1427
35 Ga0075366_10299411 3300006195 Bacteria 984
36 Ga0079104_1000454 3300006946 Bacteria 46459
37 Ga0105240_10011019 3300009093 Bacteria 12649
38 Ga0105240_10094639 3300009093 Bacteria 3643
39 Ga0105245_10150127 3300009098 Bacteria 2203
40 Ga0105247_10066828 3300009101 Bacteria 2239
41 Ga0105247_10307576 3300009101 Bacteria 1102
42 Ga0105243_10001509 3300009148 Bacteria 20338
43 Ga0105241_10043114 3300009174 Bacteria 3416
44 Ga0105237_10000384 3300009545 Bacteria 62866
45 Ga0105237_10010820 3300009545 Bacteria 9682
46 Ga0105237_10013574 3300009545 Bacteria 8534
47 Ga0105249_10234752 3300009553 Bacteria 1810
48 Ga0105239_10000394 3300010375 Bacteria 64001
49 Ga0105239_10075381 3300010375 Bacteria 3709
50 Ga0105239_10078287 3300010375 Bacteria 3638
51 Ga0105239_10190570 3300010375 Bacteria 2295
52 Ga0105239_10580654 3300010375 Bacteria 1278
53 Ga0157370_10055810 3300013104 Bacteria 3761
54 Ga0157369_10675834 3300013105 Bacteria 1064
55 Ga0157378_10183856 3300013297 Bacteria 1968
56 Ga0157378_10836246 3300013297 Bacteria 948
57 Ga0157372_10094188 3300013307 Bacteria 3410
58 Ga0182005_1000547 3300015265 Bacteria 18966
59 Ga0209435_100002 3300025206 Bacteria 794178
60 Ga0209646_1000001 3300025246 Bacteria 3092932
61 Ga0209026_1000040 3300025250 Bacteria 277470
62 Ga0209759_1000001 3300025256 Bacteria 2799452
63 Ga0209129_1000241 3300025258 Bacteria 59288
64 Ga0209233_1003451 3300025261 Bacteria 5566
65 Ga0209455_1004770 3300025272 Bacteria 4346
66 Ga0209673_1003125 3300025273 Bacteria 10119
67 Ga0209130_1011826 3300025284 Bacteria 2316
68 Ga0209675_1001455 3300025291 Bacteria 13665
69 Ga0209676_1015735 3300025292 Bacteria 2769
70 Ga0209758_1000168 3300025297 Bacteria 150965
71 Ga0209758_1002285 3300025297 Bacteria 19840
72 Ga0209758_1002617 3300025297 Bacteria 17908
73 Ga0209758_1051224 3300025297 Bacteria 1439
74 Ga0209050_1014892 3300025298 Bacteria 3310
75 Ga0209256_1029705 3300025299 Bacteria 1519
76 Ga0207426_1000433 3300025302 Bacteria 68187
77 Ga0207426_1003205 3300025302 Bacteria 9213
78 Ga0209051_1004643 3300025303 Bacteria 8366
79 Ga0209051_1021844 3300025303 Bacteria 2710
80 Ga0209257_1000303 3300025304 Bacteria 107862
81 Ga0207692_10003808 3300025898 Bacteria 5930
82 Ga0207710_10122353 3300025900 Bacteria 1244
83 Ga0207710_10130987 3300025900 Bacteria 1204
84 Ga0207699_10000819 3300025906 Bacteria 14818
85 Ga0207654_10143343 3300025911 Bacteria 1526
86 Ga0207695_10001156 3300025913 Bacteria 45753
87 Ga0207695_10036749 3300025913 Bacteria 5291
88 Ga0207671_10000379 3300025914 Bacteria 63039
89 Ga0207671_10020073 3300025914 Bacteria 5097
90 Ga0207671_10290503 3300025914 Bacteria 1291
91 Ga0207693_10113686 3300025915 Bacteria 2124
92 Ga0207663_10001031 3300025916 Bacteria 12763
93 Ga0207694_10225083 3300025924 Bacteria 1531
94 Ga0207687_10020083 3300025927 Bacteria 4430
95 Ga0207700_10003681 3300025928 Bacteria 8939
96 Ga0207700_10516675 3300025928 Bacteria 1058
97 Ga0207664_10006413 3300025929 Bacteria 8095
98 Ga0207709_10005405 3300025935 Bacteria 7265
99 Ga0207665_10062546 3300025939 Bacteria 2526
100 Ga0207665_10124053 3300025939 Bacteria 1827
101 Ga0207667_10027334 3300025949 Bacteria 6211
102 Ga0207640_10151888 3300025981 Bacteria 1702
103 Ga0207640_10166926 3300025981 Bacteria 1635
104 Ga0207640_10266361 3300025981 Bacteria 1338
105 Ga0207702_10304003 3300026078 Bacteria 1514
106 Ga0207675_100007592 3300026118 Bacteria 10244
107 Ga0209281_1000035 3300027111 Bacteria 382327
108 Ga0209371_1000045 3300027312 Bacteria 316174
109 Ga0268266_10375250 3300028379 Bacteria 1340
110 Ga0268264_10000020 3300028381 Bacteria 483593
111 Ga0307515_10023549 3300028794 Bacteria 10783
112 Ga0268256_1000047 3300030500 Bacteria 316174
113 Ga0307509_10119908 3300031507 Bacteria 2610
114 Ga0307508_10160744 3300031616 Bacteria 1850
115 Ga0307508_10397807 3300031616 Bacteria 969
116 Ga0307516_10025539 3300031730 Bacteria 6014
117 Ga0307516_10055318 3300031730 Bacteria 3874
118 Ga0307409_100258639 3300031995 Bacteria 1596
119 Ga0307415_100519526 3300032126 Bacteria 1045
120 Ga0307510_10211014 3300033180 Bacteria 1464
121 Ga0395905_0773790 3300037471 Bacteria 863
122 Ga0436365_0715603 3300039437 Bacteria 1323
123 Ga0451789_0746309 3300041443 Bacteria 625
124 Ga0451835_0854982 3300041492 Bacteria 2188
125 Ga0451841_0003535 3300041498 Bacteria 1181
126 Ga0451841_0810372 3300041498 Bacteria 1580
127 Ga0451843_0665282 3300041509 Bacteria 813
128 Ga0451853_0219044 3300041512 Bacteria 2536
129 Ga0495592_0125484 3300046454 Bacteria 1802
130 Ga0495603_0415471 3300046455 Bacteria 771
131 Ga0495629_0004287 3300046459 Bacteria 10692
132 Ga0495638_0040243 3300046460 Bacteria 2962
133 Ga0495638_0042547 3300046460 Bacteria 2868
134 Ga0495651_0019895 3300046462 Bacteria 5206
135 Ga0495582_0191436 3300046473 Bacteria 1167
136 Ga0495585_0050387 3300046492 Bacteria 2310
137 Ga0495585_0159283 3300046492 Unclassified 1172
138 Ga0495596_0045028 3300046500 Unclassified 1735
139 Ga0495608_0068968 3300046511 Bacteria 2311
140 Ga0495618_0170982 3300046514 Bacteria 1383
141 Ga0495631_0168686 3300046518 Unclassified 939
142 Ga0495648_0025842 3300046524 Bacteria 3966
143 Ga0495640_0018182 3300046533 Bacteria 5222
144 Ga0495622_0041044 3300046557 Bacteria 2152
145 Ga0495668_0277974 3300046616 Bacteria 917
146 Ga0495668_0302824 3300046616 Bacteria 876
147 Ga0495625_0041972 3300046660 Bacteria 3326
148 Ga0495625_0289316 3300046660 Bacteria 1052
149 Ga0495635_0006167 3300046663 Bacteria 8355
150 Ga0495613_0049401 3300046689 Bacteria 3105
151 Ga0495624_0014642 3300046690 Bacteria 5315
152 Ga0495600_0006121 3300046809 Bacteria 7288
153 Ga0495604_0009755 3300047317 Bacteria 7595
154 Ga0495636_0069574 3300047318 Bacteria 1500
155 Ga0495676_0123322 3300047321 Bacteria 1881
156 Ga0495686_0055659 3300047472 Bacteria 2473
157 Ga0495593_0101501 3300047673 Bacteria 1475
158 Ga0495615_0049732 3300048090 Bacteria 1075
159 Ga0496100_0000431 3300048903 Bacteria 20358
160 Ga0496101_0394230 3300048904 Bacteria 1090
161 Ga0496102_0000625 3300048905 Bacteria 36336
162 Ga0496103_0001783 3300048906 Bacteria 14051
163 Ga0496104_0001254 3300048907 Bacteria 21878
164 Ga0496105_0010492 3300048908 Bacteria 7286
165 Ga0496106_0004540 3300048909 Bacteria 10285
166 Ga0496112_0678584 3300048915 Bacteria 959
167 Ga0496113_0436176 3300048916 Bacteria 1052
168 Ga0496115_0034390 3300048918 Bacteria 4005
169 Ga0496116_0000868 3300048919 Bacteria 37701
170 Ga0496116_0062070 3300048919 Bacteria 2415
171 Ga0496117_0001345 3300048920 Bacteria 36055
172 Ga0496117_0019453 3300048920 Bacteria 5575
173 Ga0496117_0048015 3300048920 Bacteria 3054
174 Ga0496117_0098119 3300048920 Bacteria 1864
175 Ga0496118_0000524 3300048921 Bacteria 63074
176 Ga0496118_0001252 3300048921 Bacteria 39012
177 Ga0496118_0023556 3300048921 Bacteria 5343
178 Ga0496118_0053757 3300048921 Bacteria 3057
179 Ga0496118_0237963 3300048921 Bacteria 1045
180 Ga0496119_0008470 3300048922 Bacteria 9027
181 Ga0496119_0017837 3300048922 Bacteria 5321
182 Ga0496120_0001015 3300048923 Bacteria 37573
183 Ga0496120_0011655 3300048923 Bacteria 6031
184 Ga0496121_0001402 3300048924 Bacteria 40798
185 Ga0496121_0003137 3300048924 Bacteria 23845
186 Ga0496121_0042418 3300048924 Bacteria 3958
187 Ga0496121_0055270 3300048924 Bacteria 3309
188 Ga0496121_0170264 3300048924 Bacteria 1583
189 Ga0496121_0179589 3300048924 Bacteria 1529
190 Ga0496122_0002943 3300048925 Bacteria 23224
191 Ga0496123_0007068 3300048926 Bacteria 10671
192 Ga0496123_0073531 3300048926 Bacteria 2120
193 Ga0496123_0166164 3300048926 Bacteria 1170
194 Ga0496124_0002118 3300048927 Bacteria 26720
195 Ga0496124_0007990 3300048927 Bacteria 11131
196 Ga0496124_0121934 3300048927 Bacteria 2082
197 Ga0496125_0047627 3300048928 Bacteria 3582
198 Ga0496125_0050824 3300048928 Bacteria 3427
199 Ga0496125_0061720 3300048928 Bacteria 3004
200 Ga0496125_0189891 3300048928 Bacteria 1358
201 Ga0496125_0221888 3300048928 Bacteria 1217
202 Ga0496126_0002170 3300048929 Bacteria 27261
203 Ga0496126_0014344 3300048929 Bacteria 8014
204 Ga0496126_0018774 3300048929 Bacteria 6838
205 Ga0496126_0141595 3300048929 Bacteria 2069
206 nmdc:mga0yw44_390014_c1 3300050492 Bacteria 941
207 nmdc:mga0k408_158676_c1 3300050493 Bacteria 1347
208 nmdc:mga06z11_201070_c1 3300050494 Bacteria 1157
209 nmdc:mga0sz30_113147_c1 3300050516 Bacteria 1190
210 Ga0495619_0162042 3300053085 Bacteria 1545
211 Ga0500578_0126350 3300053086 Bacteria 1606
212 Ga0500644_0008809 3300053088 Bacteria 2675
213 Ga0500646_0004678 3300053090 Bacteria 3459
214 Ga0500583_0013023 3300053092 Bacteria 3200
215 Ga0500583_0071795 3300053092 Bacteria 1657
216 Ga0500651_0073695 3300053093 Bacteria 2122
217 Ga0500566_0000562 3300053094 Bacteria 20869
218 Ga0500566_0011095 3300053094 Bacteria 5308
219 Ga0500566_0151302 3300053094 Bacteria 1220
220 Ga0500557_000019 3300053105 Bacteria 93216
221 Ga0500572_007750 3300053111 Bacteria 2492
222 Ga0500593_000094 3300053117 Bacteria 33196
223 Ga0500607_019782 3300053121 Bacteria 3807
224 Ga0500642_0000087 3300053130 Bacteria 48287
225 Ga0500655_004434 3300053133 Bacteria 2531
226 Ga0500658_0071670 3300053134 Bacteria 1464
227 Ga0500559_0000053 3300053136 Bacteria 90779
228 Ga0500559_0040540 3300053136 Bacteria 2028
229 Ga0500564_059002 3300053138 Bacteria 1744
230 Ga0500568_0002738 3300053139 Bacteria 10206
231 Ga0500568_0054411 3300053139 Bacteria 1565
232 Ga0500573_0016082 3300053140 Bacteria 4245
233 Ga0500585_027034 3300053144 Bacteria 1943
234 Ga0500604_0000564 3300053151 Bacteria 10201
235 Ga0500620_022064 3300053155 Bacteria 1912
236 Ga0500639_011002 3300053163 Bacteria 4745
237 Ga0500636_0001690 3300053177 Bacteria 12085
238 Ga0500636_0154732 3300053177 Bacteria 1256
239 Ga0500636_0198768 3300053177 Bacteria 1062
240 Ga0500637_0340012 3300053178 Bacteria 803
241 Ga0500576_024976 3300053725 Bacteria 2725
242 Ga0500576_068669 3300053725 Bacteria 1529
243 Ga0500645_009471 3300053730 Bacteria 3270
244 Ga0500645_027878 3300053730 Bacteria 1711
245 Ga0500645_072684 3300053730 Bacteria 986
246 Ga0500609_002521 3300053731 Bacteria 2612
247 Ga0500596_004510 3300053735 Bacteria 2547
248 Ga0500601_000043 3300053737 Bacteria 25667
249 Ga0500601_002189 3300053737 Bacteria 2100
250 Ga0500661_000339 3300055283 Bacteria 8529
251 Ga0500661_010948 3300055283 Bacteria 1646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041443 Ga0451789_0746309 Ga0451789_0746309_19_606 195
2 3300041509 Ga0451843_0665282 Ga0451843_0665282_158_763 201
3 3300053178 Ga0500637_0340012 Ga0500637_0340012_140_757 205
4 3300025900 Ga0207710_10130987 Ga0207710_101309872 206
5 3300048921 Ga0496118_0237963 Ga0496118_0237963_321_941 206
6 3300031616 Ga0307508_10160744 Ga0307508_101607442 209
7 3300009101 Ga0105247_10307576 Ga0105247_103075762 210
8 iso_pu_bacteria 2523231067 2523468968 211
9 iso_pu_bacteria 8024486573 8024491318 213
10 3300006946 Ga0079104_1000454 Ga0079104_100045415 214
11 3300009093 Ga0105240_10011019 Ga0105240_100110193 214
12 3300025913 Ga0207695_10001156 Ga0207695_1000115631 214
13 3300027111 Ga0209281_1000035 Ga0209281_1000035296 214
14 3300027111 Ga0209281_1000035 Ga0209281_100003594 214
15 3300053725 Ga0500576_068669 Ga0500576_068669_33_722 214
16 iso_pu_bacteria 2507262055 2507507526 214
17 iso_pu_bacteria 2508501009 2508541644 214
18 iso_pu_bacteria 2508501042 2508692817 214
19 iso_pu_bacteria 2515154112 2515626210 214
20 iso_pu_bacteria 2874590934 2874598641 214
21 iso_pu_bacteria 2874645413 2874652095 214
22 iso_pu_bacteria 2876771140 2876778680 214
23 iso_pu_bacteria 2876818435 2876823484 214
24 iso_pu_bacteria 2879074833 2879082473 214
25 iso_pu_bacteria 2879127579 2879131747 214
26 iso_pu_bacteria 2879142872 2879150083 214
27 iso_pu_bacteria 2935648319 2935652003 214
28 iso_pu_bacteria 2935656913 2935660024 214
29 iso_pu_bacteria 2935819856 2935823125 214
30 iso_pu_bacteria 2935847175 2935848707 214
31 iso_pu_bacteria 2935975950 2935976383 214
32 iso_pu_bacteria 2935984226 2935987169 214
33 iso_pu_bacteria 2936011229 2936014440 214
34 iso_pu_bacteria 2936019824 2936023720 214
35 iso_pu_bacteria 2936028420 2936031363 214
36 iso_pu_bacteria 2936046547 2936049546 214
37 iso_pu_bacteria 2936055302 2936061239 214
38 iso_pu_bacteria 8016630954 8016639024 214
39 iso_pu_bacteria 8019629233 8019633153 214
40 iso_pu_bacteria 8019659431 8019661026 214
41 iso_pu_bacteria 8019668869 8019670592 214
42 iso_pu_bacteria 8019678201 8019685643 214
43 iso_pu_bacteria 2738543031 2739351136 215
44 3300053121 Ga0500607_019782 Ga0500607_019782_2828_3502 216
45 iso_pu_bacteria 2509276021 2509391527 216
46 iso_pu_bacteria 2838680041 2838685928 216
47 iso_pu_bacteria 2838694306 2838699438 216
48 iso_pu_bacteria 2838707686 2838712919 216
49 iso_pu_bacteria 2841851746 2841856728 216
50 iso_pu_bacteria 2842077413 2842082428 216
51 iso_pu_bacteria 2842118031 2842123437 216
52 iso_pu_bacteria 2842237096 2842242385 216
53 iso_pu_bacteria 2842291075 2842296452 216
54 iso_pu_bacteria 2842370503 2842375401 216
55 iso_pu_bacteria 2842377471 2842382735 216
56 iso_pu_bacteria 2842384541 2842389550 216
57 iso_pu_bacteria 2919130084 2919133240 216
58 iso_pu_bacteria 2929195423 2929195713 216
59 iso_pu_bacteria 2935894831 2935899346 216
60 3300005983 Ga0081540_1021405 Ga0081540_10214052 217
61 3300025297 Ga0209758_1002617 Ga0209758_10026176 217
62 3300053138 Ga0500564_059002 Ga0500564_059002_794_1468 217
63 3300053155 Ga0500620_022064 Ga0500620_022064_1221_1895 217
64 iso_pu_bacteria 2513237161 2514010207 217
65 iso_pu_bacteria 2513237162 2514018635 217
66 iso_pu_bacteria 2515154116 2515659879 217
67 iso_pu_bacteria 2599185156 2599336208 217
68 iso_pu_bacteria 2617270735 2617350152 217
69 iso_pu_bacteria 2841941048 2841942727 217
70 iso_pu_bacteria 2841974524 2841977691 217
71 3300005339 Ga0070660_100281160 Ga0070660_1002811602 218
72 3300006038 Ga0075365_10275013 Ga0075365_102750132 218
73 3300013105 Ga0157369_10675834 Ga0157369_106758342 218
74 3300025981 Ga0207640_10266361 Ga0207640_102663612 218
75 3300026078 Ga0207702_10304003 Ga0207702_103040032 218
76 3300041498 Ga0451841_0003535 Ga0451841_0003535_132_806 218
77 3300048921 Ga0496118_0053757 Ga0496118_0053757_2326_2982 218
78 3300048928 Ga0496125_0047627 Ga0496125_0047627_1338_1994 218
79 3300050492 nmdc:mga0yw44_390014_c1 nmdc:mga0yw44_390014_c1_99_755 218
80 3300053094 Ga0500566_0000562 Ga0500566_0000562_14201_14875 218
81 3300053094 Ga0500566_0151302 Ga0500566_0151302_440_1114 218
82 3300053139 Ga0500568_0054411 Ga0500568_0054411_732_1388 218
83 iso_pu_bacteria 2513237098 2513676738 218
84 iso_pu_bacteria 2582581308 2585281468 218
85 iso_pu_bacteria 2615840626 2616310805 218
86 iso_pu_bacteria 2643221689 2644497840 218
87 iso_pu_bacteria 2824773399 2824780310 218
88 iso_pu_bacteria 2852684882 2852689480 218
89 iso_pu_bacteria 2928521798 2928525505 218
90 iso_pu_bacteria 2932794094 2932795014 218
91 iso_pu_bacteria 2932801729 2932805541 218
92 iso_pu_bacteria 2935883170 2935885741 218
93 iso_pu_bacteria 2954011201 2954012445 218
94 iso_pu_bacteria 2958064165 2958070141 218
95 iso_pu_bacteria 3002141150 3002145253 218
96 iso_pu_bacteria 8005688590 8005689637 218
97 iso_pu_bacteria 8018163183 8018163412 218
98 3300005616 Ga0068852_100051909 Ga0068852_1000519095 219
99 3300006186 Ga0075369_10054906 Ga0075369_100549062 219
100 3300009098 Ga0105245_10150127 Ga0105245_101501272 219
101 3300009174 Ga0105241_10043114 Ga0105241_100431141 219
102 3300010375 Ga0105239_10075381 Ga0105239_100753816 219
103 3300025911 Ga0207654_10143343 Ga0207654_101433431 219
104 3300025927 Ga0207687_10020083 Ga0207687_100200832 219
105 3300025981 Ga0207640_10166926 Ga0207640_101669262 219
106 3300050516 nmdc:mga0sz30_113147_c1 nmdc:mga0sz30_113147_c1_211_870 219
107 3300053086 Ga0500578_0126350 Ga0500578_0126350_207_866 219
108 3300053092 Ga0500583_0013023 Ga0500583_0013023_1804_2463 219
109 3300053093 Ga0500651_0073695 Ga0500651_0073695_698_1357 219
110 3300053177 Ga0500636_0001690 Ga0500636_0001690_10507_11181 219
111 3300053730 Ga0500645_027878 Ga0500645_027878_516_1175 219
112 3300053731 Ga0500609_002521 Ga0500609_002521_1507_2166 219
113 3300053737 Ga0500601_000043 Ga0500601_000043_18692_19351 219
114 3300055283 Ga0500661_010948 Ga0500661_010948_538_1197 219
115 3300025924 Ga0207694_10225083 Ga0207694_102250832 220
116 3300046460 Ga0495638_0042547 Ga0495638_0042547_604_1266 220
117 3300048928 Ga0496125_0050824 Ga0496125_0050824_515_1180 220
118 3300025261 Ga0209233_1003451 Ga0209233_10034513 221
119 3300025272 Ga0209455_1004770 Ga0209455_10047703 221
120 3300041492 Ga0451835_0854982 Ga0451835_0854982_978_1643 221
121 3300041498 Ga0451841_0810372 Ga0451841_0810372_61_726 221
122 3300041512 Ga0451853_0219044 Ga0451853_0219044_1326_1991 221
123 3300046492 Ga0495585_0050387 Ga0495585_0050387_493_1158 221
124 3300046524 Ga0495648_0025842 Ga0495648_0025842_2301_2966 221
125 3300046616 Ga0495668_0277974 Ga0495668_0277974_48_713 221
126 3300046660 Ga0495625_0041972 Ga0495625_0041972_2276_2941 221
127 3300048090 Ga0495615_0049732 Ga0495615_0049732_285_950 221
128 3300053134 Ga0500658_0071670 Ga0500658_0071670_547_1212 221
129 3300002705 JGI25156J39149_1000012 JGI25156J39149_1000012103 222
130 3300002738 JGI25154J39366_1000029 JGI25154J39366_100002968 222
131 3300002741 JGI25157J39369_1000014 JGI25157J39369_1000014103 222
132 3300002773 JGI25152J39213_1001737 JGI25152J39213_10017372 222
133 3300003215 JGI25153J46596_10021140 JGI25153J46596_100211403 222
134 3300003323 rootH1_10052037 rootH1_100520372 222
135 3300003323 rootH1_10296371 rootH1_102963712 222
136 3300003354 JGI25160J50197_1004895 JGI25160J50197_10048953 222
137 3300003354 JGI25160J50197_1026234 JGI25160J50197_10262342 222
138 3300005262 Ga0065165_1026459 Ga0065165_10264593 222
139 3300005262 Ga0065165_1032214 Ga0065165_10322143 222
140 3300005434 Ga0070709_10000625 Ga0070709_1000062522 222
141 3300005435 Ga0070714_100019151 Ga0070714_1000191516 222
142 3300005435 Ga0070714_100057837 Ga0070714_1000578372 222
143 3300005436 Ga0070713_100148363 Ga0070713_1001483632 222
144 3300005437 Ga0070710_10000838 Ga0070710_1000083813 222
145 3300005439 Ga0070711_100001438 Ga0070711_10000143810 222
146 3300005548 Ga0070665_100197939 Ga0070665_1001979391 222
147 3300005563 Ga0068855_100006596 Ga0068855_1000065963 222
148 3300005842 Ga0068858_100817009 Ga0068858_1008170091 222
149 3300005843 Ga0068860_100001582 Ga0068860_10000158213 222
150 3300005983 Ga0081540_1094441 Ga0081540_10944411 222
151 3300006028 Ga0070717_10057981 Ga0070717_100579815 222
152 3300006042 Ga0075368_10124993 Ga0075368_101249932 222
153 3300006163 Ga0070715_10019578 Ga0070715_100195783 222
154 3300006173 Ga0070716_100040133 Ga0070716_1000401334 222
155 3300006175 Ga0070712_100013166 Ga0070712_1000131663 222
156 3300006178 Ga0075367_10257051 Ga0075367_102570512 222
157 3300006195 Ga0075366_10146900 Ga0075366_101469003 222
158 3300006195 Ga0075366_10299411 Ga0075366_102994112 222
159 3300009093 Ga0105240_10094639 Ga0105240_100946393 222
160 3300009101 Ga0105247_10066828 Ga0105247_100668282 222
161 3300009148 Ga0105243_10001509 Ga0105243_1000150917 222
162 3300009545 Ga0105237_10000384 Ga0105237_1000038433 222
163 3300009545 Ga0105237_10010820 Ga0105237_100108203 222
164 3300009545 Ga0105237_10013574 Ga0105237_100135746 222
165 3300009553 Ga0105249_10234752 Ga0105249_102347522 222
166 3300010375 Ga0105239_10000394 Ga0105239_1000039433 222
167 3300010375 Ga0105239_10078287 Ga0105239_100782872 222
168 3300010375 Ga0105239_10190570 Ga0105239_101905702 222
169 3300010375 Ga0105239_10580654 Ga0105239_105806542 222
170 3300013104 Ga0157370_10055810 Ga0157370_100558103 222
171 3300013297 Ga0157378_10183856 Ga0157378_101838561 222
172 3300013297 Ga0157378_10836246 Ga0157378_108362462 222
173 3300013307 Ga0157372_10094188 Ga0157372_100941883 222
174 3300015265 Ga0182005_1000547 Ga0182005_100054715 222
175 3300025206 Ga0209435_100002 Ga0209435_100002506 222
176 3300025246 Ga0209646_1000001 Ga0209646_10000012649 222
177 3300025250 Ga0209026_1000040 Ga0209026_1000040126 222
178 3300025256 Ga0209759_1000001 Ga0209759_10000012280 222
179 3300025258 Ga0209129_1000241 Ga0209129_100024118 222
180 3300025273 Ga0209673_1003125 Ga0209673_10031257 222
181 3300025284 Ga0209130_1011826 Ga0209130_10118261 222
182 3300025291 Ga0209675_1001455 Ga0209675_10014556 222
183 3300025292 Ga0209676_1015735 Ga0209676_10157354 222
184 3300025297 Ga0209758_1000168 Ga0209758_100016892 222
185 3300025297 Ga0209758_1002285 Ga0209758_10022853 222
186 3300025297 Ga0209758_1051224 Ga0209758_10512242 222
187 3300025298 Ga0209050_1014892 Ga0209050_10148921 222
188 3300025299 Ga0209256_1029705 Ga0209256_10297052 222
189 3300025302 Ga0207426_1000433 Ga0207426_100043327 222
190 3300025302 Ga0207426_1003205 Ga0207426_10032057 222
191 3300025303 Ga0209051_1004643 Ga0209051_10046437 222
192 3300025303 Ga0209051_1021844 Ga0209051_10218443 222
193 3300025304 Ga0209257_1000303 Ga0209257_100030328 222
194 3300025898 Ga0207692_10003808 Ga0207692_100038083 222
195 3300025900 Ga0207710_10122353 Ga0207710_101223532 222
196 3300025906 Ga0207699_10000819 Ga0207699_100008199 222
197 3300025913 Ga0207695_10036749 Ga0207695_100367493 222
198 3300025914 Ga0207671_10000379 Ga0207671_1000037935 222
199 3300025914 Ga0207671_10020073 Ga0207671_100200732 222
200 3300025914 Ga0207671_10290503 Ga0207671_102905032 222
201 3300025915 Ga0207693_10113686 Ga0207693_101136863 222
202 3300025916 Ga0207663_10001031 Ga0207663_100010315 222
203 3300025928 Ga0207700_10003681 Ga0207700_100036815 222
204 3300025928 Ga0207700_10516675 Ga0207700_105166751 222
205 3300025929 Ga0207664_10006413 Ga0207664_100064135 222
206 3300025935 Ga0207709_10005405 Ga0207709_100054059 222
207 3300025939 Ga0207665_10062546 Ga0207665_100625463 222
208 3300025939 Ga0207665_10124053 Ga0207665_101240532 222
209 3300025949 Ga0207667_10027334 Ga0207667_100273345 222
210 3300025981 Ga0207640_10151888 Ga0207640_101518883 222
211 3300026118 Ga0207675_100007592 Ga0207675_1000075927 222
212 3300027312 Ga0209371_1000045 Ga0209371_1000045233 222
213 3300028379 Ga0268266_10375250 Ga0268266_103752502 222
214 3300028381 Ga0268264_10000020 Ga0268264_1000002091 222
215 3300028794 Ga0307515_10023549 Ga0307515_100235498 222
216 3300030500 Ga0268256_1000047 Ga0268256_1000047233 222
217 3300031507 Ga0307509_10119908 Ga0307509_101199082 222
218 3300031616 Ga0307508_10397807 Ga0307508_103978072 222
219 3300031730 Ga0307516_10025539 Ga0307516_100255393 222
220 3300031730 Ga0307516_10055318 Ga0307516_100553183 222
221 3300031995 Ga0307409_100258639 Ga0307409_1002586392 222
222 3300032126 Ga0307415_100519526 Ga0307415_1005195262 222
223 3300033180 Ga0307510_10211014 Ga0307510_102110141 222
224 3300037471 Ga0395905_0773790 Ga0395905_0773790_124_792 222
225 3300039437 Ga0436365_0715603 Ga0436365_0715603_560_1228 222
226 3300046454 Ga0495592_0125484 Ga0495592_0125484_326_994 222
227 3300046455 Ga0495603_0415471 Ga0495603_0415471_48_716 222
228 3300046459 Ga0495629_0004287 Ga0495629_0004287_8599_9267 222
229 3300046460 Ga0495638_0040243 Ga0495638_0040243_654_1322 222
230 3300046462 Ga0495651_0019895 Ga0495651_0019895_3964_4632 222
231 3300046473 Ga0495582_0191436 Ga0495582_0191436_103_771 222
232 3300046492 Ga0495585_0159283 Ga0495585_0159283_44_712 222
233 3300046500 Ga0495596_0045028 Ga0495596_0045028_28_696 222
234 3300046511 Ga0495608_0068968 Ga0495608_0068968_1164_1832 222
235 3300046514 Ga0495618_0170982 Ga0495618_0170982_164_832 222
236 3300046518 Ga0495631_0168686 Ga0495631_0168686_175_843 222
237 3300046533 Ga0495640_0018182 Ga0495640_0018182_1284_1952 222
238 3300046557 Ga0495622_0041044 Ga0495622_0041044_1342_2010 222
239 3300046616 Ga0495668_0302824 Ga0495668_0302824_146_814 222
240 3300046660 Ga0495625_0289316 Ga0495625_0289316_63_731 222
241 3300046663 Ga0495635_0006167 Ga0495635_0006167_2454_3122 222
242 3300046689 Ga0495613_0049401 Ga0495613_0049401_1980_2648 222
243 3300046690 Ga0495624_0014642 Ga0495624_0014642_197_865 222
244 3300046809 Ga0495600_0006121 Ga0495600_0006121_4836_5504 222
245 3300047317 Ga0495604_0009755 Ga0495604_0009755_2694_3362 222
246 3300047318 Ga0495636_0069574 Ga0495636_0069574_262_930 222
247 3300047321 Ga0495676_0123322 Ga0495676_0123322_1058_1726 222
248 3300047472 Ga0495686_0055659 Ga0495686_0055659_1335_2003 222
249 3300047673 Ga0495593_0101501 Ga0495593_0101501_475_1143 222
250 3300048903 Ga0496100_0000431 Ga0496100_0000431_3160_3828 222
251 3300048904 Ga0496101_0394230 Ga0496101_0394230_134_802 222
252 3300048905 Ga0496102_0000625 Ga0496102_0000625_32885_33553 222
253 3300048906 Ga0496103_0001783 Ga0496103_0001783_1336_2004 222
254 3300048907 Ga0496104_0001254 Ga0496104_0001254_11467_12135 222
255 3300048908 Ga0496105_0010492 Ga0496105_0010492_2324_2992 222
256 3300048909 Ga0496106_0004540 Ga0496106_0004540_1475_2155 222
257 3300048915 Ga0496112_0678584 Ga0496112_0678584_224_892 222
258 3300048916 Ga0496113_0436176 Ga0496113_0436176_171_839 222
259 3300048918 Ga0496115_0034390 Ga0496115_0034390_648_1316 222
260 3300048919 Ga0496116_0000868 Ga0496116_0000868_4161_4829 222
261 3300048919 Ga0496116_0062070 Ga0496116_0062070_199_897 222
262 3300048920 Ga0496117_0001345 Ga0496117_0001345_32885_33553 222
263 3300048920 Ga0496117_0019453 Ga0496117_0019453_2733_3437 222
264 3300048920 Ga0496117_0048015 Ga0496117_0048015_1074_1754 222
265 3300048920 Ga0496117_0098119 Ga0496117_0098119_703_1371 222
266 3300048921 Ga0496118_0000524 Ga0496118_0000524_32885_33553 222
267 3300048921 Ga0496118_0001252 Ga0496118_0001252_1440_2120 222
268 3300048921 Ga0496118_0023556 Ga0496118_0023556_4625_5293 222
269 3300048922 Ga0496119_0008470 Ga0496119_0008470_4327_4995 222
270 3300048922 Ga0496119_0017837 Ga0496119_0017837_1571_2239 222
271 3300048923 Ga0496120_0001015 Ga0496120_0001015_32873_33541 222
272 3300048923 Ga0496120_0011655 Ga0496120_0011655_1608_2276 222
273 3300048924 Ga0496121_0001402 Ga0496121_0001402_7258_7926 222
274 3300048924 Ga0496121_0003137 Ga0496121_0003137_1497_2177 222
275 3300048924 Ga0496121_0042418 Ga0496121_0042418_1811_2479 222
276 3300048924 Ga0496121_0055270 Ga0496121_0055270_714_1418 222
277 3300048924 Ga0496121_0170264 Ga0496121_0170264_362_1030 222
278 3300048924 Ga0496121_0179589 Ga0496121_0179589_244_912 222
279 3300048925 Ga0496122_0002943 Ga0496122_0002943_7288_7956 222
280 3300048926 Ga0496123_0007068 Ga0496123_0007068_9253_9921 222
281 3300048926 Ga0496123_0073531 Ga0496123_0073531_1068_1766 222
282 3300048926 Ga0496123_0166164 Ga0496123_0166164_491_1159 222
283 3300048927 Ga0496124_0002118 Ga0496124_0002118_22020_22688 222
284 3300048927 Ga0496124_0007990 Ga0496124_0007990_3115_3783 222
285 3300048927 Ga0496124_0121934 Ga0496124_0121934_775_1443 222
286 3300048928 Ga0496125_0061720 Ga0496125_0061720_170_838 222
287 3300048928 Ga0496125_0189891 Ga0496125_0189891_56_724 222
288 3300048928 Ga0496125_0221888 Ga0496125_0221888_173_853 222
289 3300048929 Ga0496126_0002170 Ga0496126_0002170_23968_24636 222
290 3300048929 Ga0496126_0014344 Ga0496126_0014344_1275_1943 222
291 3300048929 Ga0496126_0018774 Ga0496126_0018774_4714_5394 222
292 3300048929 Ga0496126_0141595 Ga0496126_0141595_1342_2010 222
293 3300050493 nmdc:mga0k408_158676_c1 nmdc:mga0k408_158676_c1_219_887 222
294 3300050494 nmdc:mga06z11_201070_c1 nmdc:mga06z11_201070_c1_208_888 222
295 3300053085 Ga0495619_0162042 Ga0495619_0162042_665_1333 222
296 3300053088 Ga0500644_0008809 Ga0500644_0008809_1055_1723 222
297 3300053090 Ga0500646_0004678 Ga0500646_0004678_358_1026 222
298 3300053092 Ga0500583_0071795 Ga0500583_0071795_425_1093 222
299 3300053094 Ga0500566_0011095 Ga0500566_0011095_2338_3006 222
300 3300053105 Ga0500557_000019 Ga0500557_000019_91477_92145 222
301 3300053111 Ga0500572_007750 Ga0500572_007750_1545_2213 222
302 3300053117 Ga0500593_000094 Ga0500593_000094_18904_19572 222
303 3300053130 Ga0500642_0000087 Ga0500642_0000087_26326_26994 222
304 3300053133 Ga0500655_004434 Ga0500655_004434_1006_1674 222
305 3300053136 Ga0500559_0000053 Ga0500559_0000053_23185_23853 222
306 3300053136 Ga0500559_0040540 Ga0500559_0040540_1222_1890 222
307 3300053139 Ga0500568_0002738 Ga0500568_0002738_8672_9340 222
308 3300053140 Ga0500573_0016082 Ga0500573_0016082_2934_3602 222
309 3300053144 Ga0500585_027034 Ga0500585_027034_1254_1922 222
310 3300053151 Ga0500604_0000564 Ga0500604_0000564_4310_4978 222
311 3300053163 Ga0500639_011002 Ga0500639_011002_3757_4425 222
312 3300053177 Ga0500636_0154732 Ga0500636_0154732_235_903 222
313 3300053177 Ga0500636_0198768 Ga0500636_0198768_84_752 222
314 3300053725 Ga0500576_024976 Ga0500576_024976_107_775 222
315 3300053730 Ga0500645_009471 Ga0500645_009471_814_1482 222
316 3300053730 Ga0500645_072684 Ga0500645_072684_284_952 222
317 3300053735 Ga0500596_004510 Ga0500596_004510_252_920 222
318 3300053737 Ga0500601_002189 Ga0500601_002189_1399_2067 222
319 3300055283 Ga0500661_000339 Ga0500661_000339_3765_4433 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13460

NAD_binding_10

NAD(P)H-binding

17

198

0.9

PF05368

NmrA

NmrA-like family

13

127

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

13

167

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7er7-assembly1.cif.gz_A crystal structure of hyman biliverdin ix-beta reductase b with tamibarotene (a80) 0.8606 11 222
3qvo-assembly1.cif.gz_A structure of a rossmann-fold nad(p)-binding family protein from shigella flexneri. 0.8586 14 221
3orr-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole synthetase from staphylococcus aureus 0.8582 14 81
3ax6-assembly2.cif.gz_C crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima 0.8576 13 83
3ax6-assembly2.cif.gz_D crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima 0.8565 13 83
ID Description Score Start End Superfamily
af_I1KVW6_141_273_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9168 14 110 3.40.50.20
af_I1KG15_128_276_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9092 14 110 3.40.50.720
af_A0A1D6GVM8_196_300_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9056 14 110 3.40.50.20
af_A0A1D6H4Q8_14_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8926 16 84 3.40.50.720
af_A0A1D6IP12_4_87_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8826 15 84 3.40.50.20
ID Description Score Start End GO Terms
AF-Q98N92-F1-model_v4 Mlr0241 protein 0.9064 15 222
AF-A0A7W9BE48-F1-model_v4 Putative NADH-flavin reductase 0.9057 14 222 GO:0004074
GO:0042602
AF-A0A2P1VIR4-F1-model_v4 deleted 0.9052 13 222
AF-A0A7R9L5A7-F1-model_v4 NAD(P)-binding domain-containing protein 0.9005 11 222 GO:0004074
GO:0042602
AF-Q98N92-F1-model_v4 Mlr0241 protein 0.8979 15 222

Feature Viewer

pLDDT pTM Quality
82.61 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map