F404863

General Info

Members Datasets Scaffolds Average Seq Length
318 234 636 319

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221548|2643764495
Length 362
Sequence PTGTTPASQDELLAHFDGLIAAGETVEPRDWMPDGYRRMMIRQVAQHAHSEIIGMQPEGAWLTRAPSLYRKSVLIAKVQDEAGHGMYLYSAAETLGVDRAALLDALHQGQQRASATFNHPALTWADTGAIAWLTDGAAVINQAPLCRTSYGPYARAMRRVCQEEAFHVRQGYDLMRTLCEGTPEQKAMAQDAVDRWWLPAVALMFGPPDTEAGGADARAAALGAAVSRRAMAWGIKRHTNDELRQRFVDSCVPQAERLGLVLPDPAIRWNEERGHHDFTPVDWDLYRAALGEDTHWSRQRLAHRRAAHEDGAWVREASAAYAARFGADGPPPPPAPDPETASKAGAGPAAVEAVRGGAGERA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
100 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
101 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 2643221548 Streptomyces sp. Root55 Isolate Unclassified
208 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
209 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
210 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
211 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
212 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
213 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
214 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
215 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
216 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
217 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
218 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
219 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
220 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
221 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
222 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
223 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
224 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
225 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
226 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
227 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
228 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
229 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
230 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
231 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
232 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
233 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
234 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.88
Metatranscriptomes 0.31
Isolates 8.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 0.63
Rhizoplane 3.77
Rhizosphere 86.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10039049 3300001979 Bacteria 1451
2 JGI24735J21928_10040267 3300002067 Bacteria 1364
3 JGI25404J52841_10000876 3300003659 Bacteria 4874
4 Ga0070676_10222773 3300005328 Bacteria 1247
5 Ga0070690_100147606 3300005330 Bacteria 1602
6 Ga0068869_100044307 3300005334 Bacteria 3199
7 Ga0070666_10117558 3300005335 Bacteria 1842
8 Ga0070692_10052386 3300005345 Bacteria 2126
9 Ga0070668_100000560 3300005347 Bacteria 24850
10 Ga0070675_100133725 3300005354 Bacteria 2115
11 Ga0070674_100174311 3300005356 Bacteria 1642
12 Ga0070673_100075713 3300005364 Bacteria 2716
13 Ga0070688_100057507 3300005365 Bacteria 2445
14 Ga0070659_100129626 3300005366 Bacteria 2047
15 Ga0070667_100027698 3300005367 Bacteria 4715
16 Ga0070703_10004640 3300005406 Bacteria 3846
17 Ga0070714_100203349 3300005435 Bacteria 1812
18 Ga0070710_10000522 3300005437 Bacteria 18074
19 Ga0070701_10078398 3300005438 Bacteria 1783
20 Ga0070705_100107478 3300005440 Bacteria 1775
21 Ga0070694_100091880 3300005444 Bacteria 2131
22 Ga0070708_100320194 3300005445 Bacteria 1461
23 Ga0070663_100036662 3300005455 Bacteria 3407
24 Ga0070662_100074359 3300005457 Bacteria 2513
25 Ga0070681_10016761 3300005458 Bacteria 7315
26 Ga0070706_100300316 3300005467 Bacteria 1498
27 Ga0070706_100382091 3300005467 Bacteria 1311
28 Ga0070707_100050764 3300005468 Bacteria 3976
29 Ga0070707_100367988 3300005468 Bacteria 1396
30 Ga0070698_100006706 3300005471 Bacteria 12489
31 Ga0070684_100037720 3300005535 Bacteria 4147
32 Ga0070672_100173392 3300005543 Bacteria 1795
33 Ga0070704_100134984 3300005549 Bacteria 1918
34 Ga0068855_100141147 3300005563 Bacteria 2746
35 Ga0070664_100053257 3300005564 Bacteria 3429
36 Ga0068857_100071710 3300005577 Bacteria 3086
37 Ga0068854_100053108 3300005578 Bacteria 2908
38 Ga0068856_100120619 3300005614 Bacteria 2623
39 Ga0070702_100012699 3300005615 Bacteria 4232
40 Ga0068866_10073924 3300005718 Bacteria 1810
41 Ga0068870_10044017 3300005840 Bacteria 2331
42 Ga0068863_100052911 3300005841 Bacteria 3847
43 Ga0068860_100101190 3300005843 Bacteria 2749
44 Ga0068862_100091294 3300005844 Bacteria 2652
45 Ga0081540_1000004 3300005983 Bacteria 231552
46 Ga0081540_1000912 3300005983 Bacteria 26643
47 Ga0081540_1010901 3300005983 Bacteria 6104
48 Ga0075365_10034907 3300006038 Bacteria 3251
49 Ga0075368_10019491 3300006042 Bacteria 2561
50 Ga0075364_10050894 3300006051 Bacteria 2705
51 Ga0070715_10075256 3300006163 Bacteria 1518
52 Ga0075428_100001062 3300006844 Bacteria 29171
53 Ga0075430_100002892 3300006846 Bacteria 14365
54 Ga0075433_10233561 3300006852 Bacteria 1633
55 Ga0075429_100001461 3300006880 Bacteria 19411
56 Ga0068865_100050833 3300006881 Bacteria 2866
57 Ga0105250_10119186 3300009092 Bacteria 1084
58 Ga0105240_10101022 3300009093 Bacteria 3509
59 Ga0114129_10006100 3300009147 Bacteria 17093
60 Ga0105243_10017054 3300009148 Bacteria 5491
61 Ga0105241_10117646 3300009174 Bacteria 2136
62 Ga0105242_10035207 3300009176 Bacteria 4015
63 Ga0105246_10053112 3300011119 Bacteria 2787
64 Ga0157373_10023713 3300013100 Bacteria 4446
65 Ga0157375_10471321 3300013308 Bacteria 1421
66 Ga0157377_10037888 3300014745 Bacteria 2659
67 Ga0157379_10103308 3300014968 Bacteria 2557
68 Ga0163161_10078921 3300017792 Bacteria 2420
69 Ga0163161_10246344 3300017792 Bacteria 1391
70 Ga0206350_11030354 3300020080 Bacteria 1420
71 Ga0207656_10053206 3300025321 Bacteria 1756
72 Ga0207692_10006186 3300025898 Bacteria 4848
73 Ga0207692_10109465 3300025898 Bacteria 1530
74 Ga0207710_10153940 3300025900 Bacteria 1117
75 Ga0207688_10012363 3300025901 Bacteria 4644
76 Ga0207699_10218448 3300025906 Bacteria 1300
77 Ga0207643_10014971 3300025908 Bacteria 4220
78 Ga0207705_10069072 3300025909 Bacteria 2558
79 Ga0207684_10139886 3300025910 Bacteria 2080
80 Ga0207693_10195864 3300025915 Bacteria 1590
81 Ga0207662_10003406 3300025918 Bacteria 8180
82 Ga0207657_10018628 3300025919 Bacteria 6618
83 Ga0207652_10013322 3300025921 Bacteria 6658
84 Ga0207646_10099085 3300025922 Bacteria 2612
85 Ga0207646_10120796 3300025922 Bacteria 2354
86 Ga0207681_10103573 3300025923 Bacteria 2057
87 Ga0207687_10207675 3300025927 Bacteria 1535
88 Ga0207700_10004476 3300025928 Bacteria 8244
89 Ga0207664_10017824 3300025929 Bacteria 5217
90 Ga0207664_10086837 3300025929 Bacteria 2556
91 Ga0207706_10014708 3300025933 Bacteria 7089
92 Ga0207704_10072044 3300025938 Bacteria 2195
93 Ga0207665_10025571 3300025939 Bacteria 3895
94 Ga0207665_10034114 3300025939 Bacteria 3377
95 Ga0207691_10018961 3300025940 Bacteria 6518
96 Ga0207689_10009985 3300025942 Bacteria 8184
97 Ga0207661_10282392 3300025944 Bacteria 1484
98 Ga0207668_10000481 3300025972 Bacteria 24975
99 Ga0207677_10179239 3300026023 Bacteria 1665
100 Ga0207703_10155100 3300026035 Bacteria 2000
101 Ga0207678_10012911 3300026067 Bacteria 7331
102 Ga0207641_10077734 3300026088 Bacteria 2872
103 Ga0207674_10002180 3300026116 Bacteria 24768
104 Ga0207675_100015437 3300026118 Bacteria 7124
105 Ga0207683_10022327 3300026121 Bacteria 5431
106 Ga0268265_10036705 3300028380 Bacteria 3591
107 Ga0307515_10292516 3300028794 Bacteria 1323
108 Ga0316583_10053149 3300032133 Bacteria 1425
109 Ga0307507_10034954 3300033179 Bacteria 5175
110 Ga0373958_0006091 3300034819 Bacteria 1864
111 Ga0373926_0000996 3300035083 Bacteria 8259
112 Ga0373934_0009610 3300035086 Bacteria 3625
113 Ga0373944_0003608 3300035089 Bacteria 4002
114 Ga0373936_0002556 3300035113 Bacteria 6828
115 Ga0373953_0007708 3300035117 Bacteria 3619
116 Ga0373954_0010656 3300035118 Bacteria 4061
117 Ga0373954_0164368 3300035118 Bacteria 1086
118 Ga0373943_0002375 3300035170 Bacteria 8534
119 Ga0373943_0010447 3300035170 Bacteria 4159
120 Ga0373946_0001795 3300035171 Bacteria 7482
121 Ga0373955_0035825 3300035172 Bacteria 2631
122 Ga0373955_0102820 3300035172 Bacteria 1642
123 Ga0373924_0004576 3300035410 Bacteria 4837
124 Ga0373935_0010976 3300035692 Bacteria 5441
125 Ga0373927_0008896 3300035695 Bacteria 6742
126 Ga0373927_0034338 3300035695 Bacteria 3300
127 Ga0373933_0014109 3300035724 Bacteria 4437
128 Ga0373933_0031194 3300035724 Bacteria 3091
129 Ga0373933_0034163 3300035724 Bacteria 2962
130 Ga0373947_0198479 3300035725 Bacteria 1312
131 Ga0373937_0001740 3300036401 Bacteria 18317
132 Ga0373937_0022667 3300036401 Bacteria 5648
133 Ga0373937_0068309 3300036401 Bacteria 3276
134 Ga0373937_0239624 3300036401 Bacteria 1709
135 Ga0373925_0009414 3300037068 Bacteria 7112
136 Ga0373925_0017608 3300037068 Bacteria 5183
137 Ga0373925_0031118 3300037068 Bacteria 3919
138 Ga0395898_0029666 3300037466 Bacteria 5475
139 Ga0436364_0091251 3300037853 Bacteria 10088
140 Ga0436364_0449000 3300037853 Bacteria 1878
141 Ga0436364_0703109 3300037853 Bacteria 1644
142 Ga0436364_1349894 3300037853 Bacteria 5412
143 Ga0436364_1565185 3300037853 Bacteria 6222
144 Ga0436365_1766708 3300039437 Bacteria 2186
145 Ga0439455_0008916 3300042012 Bacteria 2164
146 Ga0466966_0029837 3300044684 Bacteria 3546
147 Ga0466966_0053092 3300044684 Bacteria 2572
148 Ga0466961_0006156 3300044693 Bacteria 7616
149 Ga0466961_0019666 3300044693 Bacteria 4345
150 Ga0466963_0009799 3300044694 Bacteria 5781
151 Ga0466963_0092596 3300044694 Bacteria 2059
152 Ga0466963_0218855 3300044694 Bacteria 1333
153 Ga0466970_0014952 3300044765 Bacteria 3990
154 Ga0466970_0018075 3300044765 Bacteria 3649
155 Ga0466970_0036829 3300044765 Bacteria 2592
156 Ga0466957_0055754 3300044842 Bacteria 2415
157 Ga0466957_0174924 3300044842 Bacteria 1400
158 Ga0466959_0009181 3300045049 Bacteria 7022
159 Ga0466958_0067268 3300045836 Bacteria 2188
160 Ga0466958_0153117 3300045836 Bacteria 1455
161 Ga0466967_0099248 3300045976 Bacteria 2659
162 Ga0495592_0092821 3300046454 Bacteria 2162
163 Ga0495603_0009639 3300046455 Bacteria 5838
164 Ga0495629_0075405 3300046459 Bacteria 2355
165 Ga0495641_0005954 3300046461 Bacteria 8034
166 Ga0495651_0013856 3300046462 Bacteria 6236
167 Ga0495653_0011960 3300046463 Bacteria 7088
168 Ga0495653_0015269 3300046463 Bacteria 6258
169 Ga0495653_0052388 3300046463 Bacteria 3127
170 Ga0495653_0105874 3300046463 Bacteria 2029
171 Ga0495580_0047943 3300046472 Bacteria 3027
172 Ga0495582_0000660 3300046473 Bacteria 19005
173 Ga0495639_0014725 3300046475 Bacteria 3388
174 Ga0495662_0003504 3300046476 Bacteria 7935
175 Ga0495664_0046054 3300046477 Bacteria 2587
176 Ga0495664_0090724 3300046477 Bacteria 1837
177 Ga0495594_0004620 3300046499 Bacteria 7093
178 Ga0495608_0001258 3300046511 Bacteria 18015
179 Ga0495608_0045069 3300046511 Bacteria 2941
180 Ga0495608_0131030 3300046511 Bacteria 1604
181 Ga0495618_0011179 3300046514 Bacteria 5441
182 Ga0495628_0049314 3300046516 Bacteria 3334
183 Ga0495628_0049699 3300046516 Bacteria 3319
184 Ga0495630_0066011 3300046517 Bacteria 2719
185 Ga0495666_0003171 3300046526 Bacteria 8272
186 Ga0495652_0001238 3300046529 Bacteria 28551
187 Ga0495652_0098700 3300046529 Bacteria 2373
188 Ga0495652_0211299 3300046529 Bacteria 1464
189 Ga0495665_0012080 3300046531 Bacteria 4675
190 Ga0495665_0022324 3300046531 Bacteria 3401
191 Ga0495640_0012528 3300046533 Bacteria 6474
192 Ga0495640_0017940 3300046533 Bacteria 5262
193 Ga0495640_0045966 3300046533 Bacteria 3027
194 Ga0495586_0002621 3300046535 Bacteria 9728
195 Ga0495587_0029947 3300046536 Bacteria 3302
196 Ga0495587_0040068 3300046536 Bacteria 2801
197 Ga0495587_0057957 3300046536 Bacteria 2276
198 Ga0495645_0072336 3300046543 Bacteria 2484
199 Ga0495667_0001543 3300046559 Bacteria 15256
200 Ga0495667_0002665 3300046559 Bacteria 11926
201 Ga0495667_0040900 3300046559 Bacteria 3075
202 Ga0495668_0000360 3300046616 Bacteria 60235
203 Ga0495634_0050092 3300046642 Bacteria 2806
204 Ga0495634_0132182 3300046642 Bacteria 1590
205 Ga0495635_0003522 3300046663 Bacteria 10831
206 Ga0495635_0017696 3300046663 Bacteria 4977
207 Ga0495635_0026362 3300046663 Bacteria 4045
208 Ga0495635_0114808 3300046663 Bacteria 1838
209 Ga0495588_0028165 3300046674 Bacteria 2811
210 Ga0495588_0044659 3300046674 Bacteria 2270
211 Ga0495657_0001713 3300046675 Bacteria 18808
212 Ga0495657_0008021 3300046675 Bacteria 8096
213 Ga0495657_0010729 3300046675 Bacteria 6887
214 Ga0495657_0025298 3300046675 Bacteria 4218
215 Ga0495599_0005277 3300046678 Bacteria 7710
216 Ga0495623_0163115 3300046679 Bacteria 1308
217 Ga0495646_0017553 3300046680 Bacteria 4537
218 Ga0495646_0021324 3300046680 Bacteria 4095
219 Ga0495646_0052612 3300046680 Bacteria 2459
220 Ga0495658_0003425 3300046683 Bacteria 7850
221 Ga0495613_0018882 3300046689 Bacteria 5136
222 Ga0495624_0052679 3300046690 Bacteria 2570
223 Ga0495600_0003327 3300046809 Bacteria 9441
224 Ga0495600_0043922 3300046809 Bacteria 2915
225 Ga0495600_0054659 3300046809 Bacteria 2608
226 Ga0495581_0000315 3300047315 Bacteria 23787
227 Ga0495604_0001693 3300047317 Bacteria 18130
228 Ga0495604_0065096 3300047317 Bacteria 2776
229 Ga0495604_0081387 3300047317 Bacteria 2424
230 Ga0495604_0124468 3300047317 Bacteria 1861
231 Ga0495674_0011053 3300047319 Bacteria 8524
232 Ga0495674_0132023 3300047319 Bacteria 2103
233 Ga0495676_0008314 3300047321 Bacteria 9515
234 Ga0495680_0005479 3300047322 Bacteria 11929
235 Ga0495680_0041087 3300047322 Bacteria 3678
236 Ga0495680_0046251 3300047322 Bacteria 3432
237 Ga0495680_0106163 3300047322 Bacteria 2087
238 Ga0495675_0011765 3300047444 Bacteria 5498
239 Ga0495675_0020935 3300047444 Bacteria 4163
240 Ga0495684_0020493 3300047471 Bacteria 5096
241 Ga0495684_0021501 3300047471 Bacteria 4966
242 Ga0495684_0025699 3300047471 Bacteria 4524
243 Ga0495684_0040293 3300047471 Bacteria 3581
244 Ga0495593_0029972 3300047673 Bacteria 2979
245 Ga0495593_0063195 3300047673 Bacteria 1934
246 Ga0495602_0012146 3300048088 Bacteria 8868
247 Ga0495602_0037931 3300048088 Bacteria 4462
248 Ga0495602_0081544 3300048088 Bacteria 2719
249 Ga0495602_0321552 3300048088 Bacteria 1125
250 Ga0495614_0019126 3300048089 Bacteria 2964
251 Ga0496102_0058970 3300048905 Bacteria 3508
252 Ga0496102_0120230 3300048905 Bacteria 2453
253 Ga0496103_0069063 3300048906 Bacteria 2208
254 Ga0496104_0054793 3300048907 Bacteria 3769
255 Ga0496104_0104591 3300048907 Bacteria 2713
256 Ga0496105_0028417 3300048908 Bacteria 4572
257 Ga0496105_0191324 3300048908 Bacteria 1673
258 Ga0496106_0025472 3300048909 Bacteria 4402
259 Ga0496107_0020427 3300048910 Bacteria 4678
260 Ga0496109_0305663 3300048912 Bacteria 1500
261 Ga0496110_0028087 3300048913 Bacteria 4828
262 Ga0496113_0155665 3300048916 Bacteria 1804
263 Ga0496120_0004618 3300048923 Bacteria 11415
264 Ga0501031_0019697 3300049568 Bacteria 4396
265 Ga0501031_0032528 3300049568 Bacteria 3401
266 Ga0501031_0048192 3300049568 Bacteria 2778
267 Ga0501034_0292101 3300049571 Bacteria 1568
268 Ga0501041_0090233 3300049577 Bacteria 1892
269 Ga0501047_0104022 3300049581 Bacteria 2720
270 Ga0501071_0154518 3300049587 Bacteria 1713
271 Ga0501072_0356267 3300049588 Bacteria 1161
272 Ga0501076_0078864 3300049592 Bacteria 2643
273 nmdc:mga03683_24353_c1 3300050489 Bacteria 2367
274 nmdc:mga03n38_20255_c1 3300050490 Bacteria 2658
275 nmdc:mga00v17_55167_c1 3300050491 Bacteria 2426
276 nmdc:mga00v17_87173_c1 3300050491 Bacteria 1957
277 nmdc:mga05p37_4732_c1 3300050507 Bacteria 15901
278 nmdc:mga0qj67_2268_c1 3300050509 Bacteria 13669
279 nmdc:mga06r32_30004_c1 3300050510 Bacteria 5101
280 Ga0495601_0064724 3300053077 Bacteria 2325
281 Ga0495601_0096405 3300053077 Bacteria 1908
282 Ga0495595_0018175 3300053084 Bacteria 3035
283 Ga0495595_0021228 3300053084 Bacteria 2835
284 Ga0495595_0069077 3300053084 Bacteria 1667
285 Ga0495619_0070126 3300053085 Bacteria 2343
286 Ga0500643_001028 3300053087 Bacteria 16963
287 Ga0500641_0002265 3300053096 Bacteria 6821
288 Ga0500568_0002978 3300053139 Bacteria 9694
289 Ga0500596_011513 3300053735 Bacteria 1353
290 Ga0466962_0005565 3300061719 Bacteria 6046
291 2643764495 2643221548 Bacteria 8053412
292 2547410671 2547132111 Bacteria 8013147
293 2585310298 2582581313 Bacteria 10042643
294 2644441646 2643221678 Bacteria 9540101
295 2644458446 2643221682 Bacteria 6743283
296 2645725356 2643221962 Bacteria 3874254
297 2739362810 2738543034 Bacteria 6084756
298 2804843126 2802429296 Bacteria 7227771
299 2808848969 2808606359 Bacteria 9866990
300 2812483331 2811994917 Bacteria 7761064
301 2855390262 2855386786 Bacteria 4752232
302 2862392759 2862382967 Bacteria 10317375
303 2873317716 2873314349 Bacteria 8512634
304 2904768216 2904765812 Bacteria 5369154
305 2904775460 2904770941 Bacteria 5580202
306 2908815516 2908811453 Bacteria 5478616
307 2919423363 2919420072 Bacteria 5390363
308 2919435971 2919432681 Bacteria 5390474
309 2919469270 2919468124 Bacteria 9133025
310 2954712005 2954711539 Bacteria 10867210
311 2954721946 2954721474 Bacteria 10456478
312 2954739905 2954731030 Bacteria 10243860
313 2954740838 2954740390 Bacteria 10229294
314 2954758728 2954749733 Bacteria 10366972
315 2954759849 2954759201 Bacteria 9358192
316 2997608594 2997600082 Bacteria 9896405
317 8008565151 8008558824 Bacteria 10610750
318 8025415618 8025413630 Bacteria 7014048
319 JGI24740J21852_10039049
320 JGI24735J21928_10040267
321 JGI25404J52841_10000876
322 Ga0070676_10222773
323 Ga0070690_100147606
324 Ga0068869_100044307
325 Ga0070666_10117558
326 Ga0070692_10052386
327 Ga0070668_100000560
328 Ga0070675_100133725
329 Ga0070674_100174311
330 Ga0070673_100075713
331 Ga0070688_100057507
332 Ga0070659_100129626
333 Ga0070667_100027698
334 Ga0070703_10004640
335 Ga0070714_100203349
336 Ga0070710_10000522
337 Ga0070701_10078398
338 Ga0070705_100107478
339 Ga0070694_100091880
340 Ga0070708_100320194
341 Ga0070663_100036662
342 Ga0070662_100074359
343 Ga0070681_10016761
344 Ga0070706_100300316
345 Ga0070706_100382091
346 Ga0070707_100050764
347 Ga0070707_100367988
348 Ga0070698_100006706
349 Ga0070684_100037720
350 Ga0070672_100173392
351 Ga0070704_100134984
352 Ga0068855_100141147
353 Ga0070664_100053257
354 Ga0068857_100071710
355 Ga0068854_100053108
356 Ga0068856_100120619
357 Ga0070702_100012699
358 Ga0068866_10073924
359 Ga0068870_10044017
360 Ga0068863_100052911
361 Ga0068860_100101190
362 Ga0068862_100091294
363 Ga0081540_1000004
364 Ga0081540_1000912
365 Ga0081540_1010901
366 Ga0075365_10034907
367 Ga0075368_10019491
368 Ga0075364_10050894
369 Ga0070715_10075256
370 Ga0075428_100001062
371 Ga0075430_100002892
372 Ga0075433_10233561
373 Ga0075429_100001461
374 Ga0068865_100050833
375 Ga0105250_10119186
376 Ga0105240_10101022
377 Ga0114129_10006100
378 Ga0105243_10017054
379 Ga0105241_10117646
380 Ga0105242_10035207
381 Ga0105246_10053112
382 Ga0157373_10023713
383 Ga0157375_10471321
384 Ga0157377_10037888
385 Ga0157379_10103308
386 Ga0163161_10078921
387 Ga0163161_10246344
388 Ga0206350_11030354
389 Ga0207656_10053206
390 Ga0207692_10006186
391 Ga0207692_10109465
392 Ga0207710_10153940
393 Ga0207688_10012363
394 Ga0207699_10218448
395 Ga0207643_10014971
396 Ga0207705_10069072
397 Ga0207684_10139886
398 Ga0207693_10195864
399 Ga0207662_10003406
400 Ga0207657_10018628
401 Ga0207652_10013322
402 Ga0207646_10099085
403 Ga0207646_10120796
404 Ga0207681_10103573
405 Ga0207687_10207675
406 Ga0207700_10004476
407 Ga0207664_10017824
408 Ga0207664_10086837
409 Ga0207706_10014708
410 Ga0207704_10072044
411 Ga0207665_10025571
412 Ga0207665_10034114
413 Ga0207691_10018961
414 Ga0207689_10009985
415 Ga0207661_10282392
416 Ga0207668_10000481
417 Ga0207677_10179239
418 Ga0207703_10155100
419 Ga0207678_10012911
420 Ga0207641_10077734
421 Ga0207674_10002180
422 Ga0207675_100015437
423 Ga0207683_10022327
424 Ga0268265_10036705
425 Ga0307515_10292516
426 Ga0316583_10053149
427 Ga0307507_10034954
428 Ga0373958_0006091
429 Ga0373926_0000996
430 Ga0373934_0009610
431 Ga0373944_0003608
432 Ga0373936_0002556
433 Ga0373953_0007708
434 Ga0373954_0010656
435 Ga0373954_0164368
436 Ga0373943_0002375
437 Ga0373943_0010447
438 Ga0373946_0001795
439 Ga0373955_0035825
440 Ga0373955_0102820
441 Ga0373924_0004576
442 Ga0373935_0010976
443 Ga0373927_0008896
444 Ga0373927_0034338
445 Ga0373933_0014109
446 Ga0373933_0031194
447 Ga0373933_0034163
448 Ga0373947_0198479
449 Ga0373937_0001740
450 Ga0373937_0022667
451 Ga0373937_0068309
452 Ga0373937_0239624
453 Ga0373925_0009414
454 Ga0373925_0017608
455 Ga0373925_0031118
456 Ga0395898_0029666
457 Ga0436364_0091251
458 Ga0436364_0449000
459 Ga0436364_0703109
460 Ga0436364_1349894
461 Ga0436364_1565185
462 Ga0436365_1766708
463 Ga0439455_0008916
464 Ga0466966_0029837
465 Ga0466966_0053092
466 Ga0466961_0006156
467 Ga0466961_0019666
468 Ga0466963_0009799
469 Ga0466963_0092596
470 Ga0466963_0218855
471 Ga0466970_0014952
472 Ga0466970_0018075
473 Ga0466970_0036829
474 Ga0466957_0055754
475 Ga0466957_0174924
476 Ga0466959_0009181
477 Ga0466958_0067268
478 Ga0466958_0153117
479 Ga0466967_0099248
480 Ga0495592_0092821
481 Ga0495603_0009639
482 Ga0495629_0075405
483 Ga0495641_0005954
484 Ga0495651_0013856
485 Ga0495653_0011960
486 Ga0495653_0015269
487 Ga0495653_0052388
488 Ga0495653_0105874
489 Ga0495580_0047943
490 Ga0495582_0000660
491 Ga0495639_0014725
492 Ga0495662_0003504
493 Ga0495664_0046054
494 Ga0495664_0090724
495 Ga0495594_0004620
496 Ga0495608_0001258
497 Ga0495608_0045069
498 Ga0495608_0131030
499 Ga0495618_0011179
500 Ga0495628_0049314
501 Ga0495628_0049699
502 Ga0495630_0066011
503 Ga0495666_0003171
504 Ga0495652_0001238
505 Ga0495652_0098700
506 Ga0495652_0211299
507 Ga0495665_0012080
508 Ga0495665_0022324
509 Ga0495640_0012528
510 Ga0495640_0017940
511 Ga0495640_0045966
512 Ga0495586_0002621
513 Ga0495587_0029947
514 Ga0495587_0040068
515 Ga0495587_0057957
516 Ga0495645_0072336
517 Ga0495667_0001543
518 Ga0495667_0002665
519 Ga0495667_0040900
520 Ga0495668_0000360
521 Ga0495634_0050092
522 Ga0495634_0132182
523 Ga0495635_0003522
524 Ga0495635_0017696
525 Ga0495635_0026362
526 Ga0495635_0114808
527 Ga0495588_0028165
528 Ga0495588_0044659
529 Ga0495657_0001713
530 Ga0495657_0008021
531 Ga0495657_0010729
532 Ga0495657_0025298
533 Ga0495599_0005277
534 Ga0495623_0163115
535 Ga0495646_0017553
536 Ga0495646_0021324
537 Ga0495646_0052612
538 Ga0495658_0003425
539 Ga0495613_0018882
540 Ga0495624_0052679
541 Ga0495600_0003327
542 Ga0495600_0043922
543 Ga0495600_0054659
544 Ga0495581_0000315
545 Ga0495604_0001693
546 Ga0495604_0065096
547 Ga0495604_0081387
548 Ga0495604_0124468
549 Ga0495674_0011053
550 Ga0495674_0132023
551 Ga0495676_0008314
552 Ga0495680_0005479
553 Ga0495680_0041087
554 Ga0495680_0046251
555 Ga0495680_0106163
556 Ga0495675_0011765
557 Ga0495675_0020935
558 Ga0495684_0020493
559 Ga0495684_0021501
560 Ga0495684_0025699
561 Ga0495684_0040293
562 Ga0495593_0029972
563 Ga0495593_0063195
564 Ga0495602_0012146
565 Ga0495602_0037931
566 Ga0495602_0081544
567 Ga0495602_0321552
568 Ga0495614_0019126
569 Ga0496102_0058970
570 Ga0496102_0120230
571 Ga0496103_0069063
572 Ga0496104_0054793
573 Ga0496104_0104591
574 Ga0496105_0028417
575 Ga0496105_0191324
576 Ga0496106_0025472
577 Ga0496107_0020427
578 Ga0496109_0305663
579 Ga0496110_0028087
580 Ga0496113_0155665
581 Ga0496120_0004618
582 Ga0501031_0019697
583 Ga0501031_0032528
584 Ga0501031_0048192
585 Ga0501034_0292101
586 Ga0501041_0090233
587 Ga0501047_0104022
588 Ga0501071_0154518
589 Ga0501072_0356267
590 Ga0501076_0078864
591 nmdc:mga03683_24353_c1
592 nmdc:mga03n38_20255_c1
593 nmdc:mga00v17_55167_c1
594 nmdc:mga00v17_87173_c1
595 nmdc:mga05p37_4732_c1
596 nmdc:mga0qj67_2268_c1
597 nmdc:mga06r32_30004_c1
598 Ga0495601_0064724
599 Ga0495601_0096405
600 Ga0495595_0018175
601 Ga0495595_0021228
602 Ga0495595_0069077
603 Ga0495619_0070126
604 Ga0500643_001028
605 Ga0500641_0002265
606 Ga0500568_0002978
607 Ga0500596_011513
608 Ga0466962_0005565
609 2643764495
610 2547410671
611 2585310298
612 2644441646
613 2644458446
614 2645725356
615 2739362810
616 2804843126
617 2808848969
618 2812483331
619 2855390262
620 2862392759
621 2873317716
622 2904768216
623 2904775460
624 2908815516
625 2919423363
626 2919435971
627 2919469270
628 2954712005
629 2954721946
630 2954739905
631 2954740838
632 2954758728
633 2954759849
634 2997608594
635 8008565151
636 8025415618

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

13

313

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iit-assembly1.cif.gz_A-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.963 11 309
3pvr-assembly1.cif.gz_A the phenylacetyl-coa monooxygenase paaac subcomplex with benzoyl-coa 0.963 12 309
4ii4-assembly1.cif.gz_A-2 the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.961 12 309
3pwq-assembly2.cif.gz_H the phenylacetyl-coa monooxygenase paaac subcomplex 0.9559 12 309
3pwq-assembly1.cif.gz_D the phenylacetyl-coa monooxygenase paaac subcomplex 0.9534 11 309
ID Description Score Start End Superfamily
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9559 12 309 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9434 12 309 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7763 24 248 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7569 24 248 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7481 33 293 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A6N9XV05-F1-model_v4 deleted 1 182 272
AF-A0A099DBA0-F1-model_v4 deleted 0.9923 149 281
AF-A0A376ZZ65-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaA 0.9886 152 294 GO:0005829
GO:0010124
AF-A0A3C1HIM8-F1-model_v4 deleted 0.9879 136 298
AF-A0A2J5NEY6-F1-model_v4 1,2-phenylacetyl-CoA epoxidase subunit A 0.9801 87 284 GO:0005829
GO:0010124
GO:0097266

Map