F404786

General Info

Members Datasets Scaffolds Average Seq Length
318 194 318 194

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0198724|Ga0496109_0198724_471_1160
Length 229
Sequence LGQRRKTFRGPPAPLAIRLVETADRSSVANKVSTMDPRLWISSSGEAPRSVALGGERTVVGRSPEADVVLEDEAVSWNHLEIEWRGEILMATDLDSRNGTVLNGEPLDRPRRLRDGDTLILGGFRLEMKTGAGTPVGATIASSEPSVALSEEERATAAALVAPYRNEGAFAGRPATRAEIAAELHVSERTAQRRLDALAAKLDVSGEAGRDRPRQIAARVIELGLDRPR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
194 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 14.47
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10031430 3300001979 Bacteria 1712
2 Ga0070677_10000007 3300005333 Bacteria 74721
3 Ga0070666_10026471 3300005335 Bacteria 3790
4 Ga0070682_100000038 3300005337 Bacteria 145670
5 Ga0070682_100296811 3300005337 Bacteria 1184
6 Ga0070660_100626838 3300005339 Bacteria 900
7 Ga0070691_10000839 3300005341 Bacteria 12399
8 Ga0070691_10008978 3300005341 Bacteria 4573
9 Ga0070661_100002486 3300005344 Bacteria 12633
10 Ga0070668_100125384 3300005347 Bacteria 2056
11 Ga0070675_100000008 3300005354 Bacteria 250004
12 Ga0070674_100000001 3300005356 Bacteria 277173
13 Ga0070674_100000026 3300005356 Bacteria 77168
14 Ga0070673_100031221 3300005364 Bacteria 3996
15 Ga0070688_100000364 3300005365 Bacteria 22986
16 Ga0070688_100461259 3300005365 Bacteria 952
17 Ga0070659_100297631 3300005366 Bacteria 1345
18 Ga0070667_100001965 3300005367 Bacteria 18253
19 Ga0070709_10411066 3300005434 Bacteria 1012
20 Ga0070713_100000061 3300005436 Bacteria 68662
21 Ga0070713_100010682 3300005436 Bacteria 6648
22 Ga0070711_100001471 3300005439 Bacteria 12945
23 Ga0070711_100031957 3300005439 Bacteria 3497
24 Ga0070694_100618030 3300005444 Unclassified 874
25 Ga0070678_100021943 3300005456 Bacteria 4220
26 Ga0070685_10006756 3300005466 Bacteria 5852
27 Ga0070684_100016415 3300005535 Bacteria 6053
28 Ga0070684_100084289 3300005535 Bacteria 2817
29 Ga0070686_100066762 3300005544 Bacteria 2341
30 Ga0070695_100161064 3300005545 Bacteria 1575
31 Ga0070665_100000306 3300005548 Bacteria 76666
32 Ga0070665_100010906 3300005548 Bacteria 9191
33 Ga0070665_100118587 3300005548 Bacteria 2648
34 Ga0070665_100200959 3300005548 Bacteria 1993
35 Ga0070665_100388709 3300005548 Bacteria 1403
36 Ga0070664_100020110 3300005564 Bacteria 5497
37 Ga0070664_100357325 3300005564 Bacteria 1330
38 Ga0068854_100000044 3300005578 Bacteria 91882
39 Ga0068854_100033059 3300005578 Bacteria 3604
40 Ga0068856_100585567 3300005614 Bacteria 1137
41 Ga0068852_100000050 3300005616 Bacteria 84306
42 Ga0068852_100065559 3300005616 Bacteria 3169
43 Ga0068864_100000201 3300005618 Bacteria 54044
44 Ga0068866_10000006 3300005718 Bacteria 176129
45 Ga0068866_10000055 3300005718 Bacteria 44369
46 Ga0068866_10001565 3300005718 Bacteria 9730
47 Ga0068870_10087812 3300005840 Bacteria 1732
48 Ga0068863_100027154 3300005841 Bacteria 5460
49 Ga0068858_100000178 3300005842 Bacteria 67760
50 Ga0068858_100000454 3300005842 Bacteria 42918
51 Ga0068860_100152131 3300005843 Bacteria 2228
52 Ga0068862_100002610 3300005844 Bacteria 15861
53 Ga0081455_10006555 3300005937 Bacteria 12458
54 Ga0081540_1000044 3300005983 Bacteria 134269
55 Ga0081539_10079134 3300005985 Bacteria 1733
56 Ga0070715_10000003 3300006163 Bacteria 345282
57 Ga0075430_100038742 3300006846 Bacteria 4037
58 Ga0075433_10000032 3300006852 Bacteria 55399
59 Ga0068865_100000019 3300006881 Bacteria 105996
60 Ga0075435_100131203 3300007076 Bacteria 2097
61 Ga0075435_100358140 3300007076 Bacteria 1251
62 Ga0105245_10000012 3300009098 Bacteria 267151
63 Ga0105245_10000049 3300009098 Bacteria 128277
64 Ga0105245_10006484 3300009098 Bacteria 10289
65 Ga0105247_10000109 3300009101 Bacteria 84490
66 Ga0105247_10165372 3300009101 Bacteria 1467
67 Ga0105243_10010968 3300009148 Bacteria 6852
68 Ga0105242_10000403 3300009176 Bacteria 34337
69 Ga0105248_10000126 3300009177 Bacteria 88461
70 Ga0105239_10174388 3300010375 Bacteria 2405
71 Ga0157371_10005438 3300013102 Bacteria 10739
72 Ga0157370_10134257 3300013104 Bacteria 2307
73 Ga0157370_10500434 3300013104 Bacteria 1116
74 Ga0157374_10002637 3300013296 Bacteria 15115
75 Ga0157378_10069359 3300013297 Bacteria 3162
76 Ga0157378_10387780 3300013297 Bacteria 1373
77 Ga0157372_10000128 3300013307 Bacteria 82571
78 Ga0157375_10012890 3300013308 Bacteria 7426
79 Ga0157375_10028209 3300013308 Bacteria 5258
80 Ga0163163_10903922 3300014325 Unclassified 946
81 Ga0163163_11286900 3300014325 Bacteria 793
82 Ga0157380_10000009 3300014326 Bacteria 142155
83 Ga0157379_10006179 3300014968 Bacteria 10314
84 Ga0163161_10000013 3300017792 Bacteria 258747
85 Ga0163161_10044832 3300017792 Bacteria 3187
86 Ga0206353_11105305 3300020082 Bacteria 1308
87 Ga0207656_10000153 3300025321 Bacteria 25555
88 Ga0207682_10000007 3300025893 Bacteria 88967
89 Ga0207642_10000001 3300025899 Bacteria 714030
90 Ga0207642_10000003 3300025899 Bacteria 650651
91 Ga0207642_10000004 3300025899 Bacteria 407822
92 Ga0207642_10001353 3300025899 Bacteria 7604
93 Ga0207642_10027165 3300025899 Bacteria 2340
94 Ga0207710_10000408 3300025900 Bacteria 28571
95 Ga0207680_10031797 3300025903 Bacteria 2993
96 Ga0207685_10000003 3300025905 Bacteria 344527
97 Ga0207645_10341518 3300025907 Bacteria 1001
98 Ga0207707_10017668 3300025912 Bacteria 6220
99 Ga0207663_10001276 3300025916 Bacteria 11682
100 Ga0207663_10016849 3300025916 Bacteria 4062
101 Ga0207657_10552562 3300025919 Bacteria 900
102 Ga0207649_10000005 3300025920 Bacteria 356179
103 Ga0207652_10000138 3300025921 Bacteria 77564
104 Ga0207694_10000008 3300025924 Bacteria 484902
105 Ga0207659_10000014 3300025926 Bacteria 168481
106 Ga0207687_10000011 3300025927 Bacteria 388349
107 Ga0207687_10000012 3300025927 Bacteria 370729
108 Ga0207687_10007446 3300025927 Bacteria 7206
109 Ga0207700_10000016 3300025928 Bacteria 202434
110 Ga0207700_10018327 3300025928 Bacteria 4701
111 Ga0207664_10215027 3300025929 Bacteria 1665
112 Ga0207690_10218534 3300025932 Bacteria 1457
113 Ga0207706_10000302 3300025933 Bacteria 53541
114 Ga0207686_10000029 3300025934 Bacteria 160239
115 Ga0207709_10005552 3300025935 Bacteria 7145
116 Ga0207669_10000002 3300025937 Bacteria 377651
117 Ga0207669_10000041 3300025937 Bacteria 67085
118 Ga0207669_10254308 3300025937 Bacteria 1310
119 Ga0207704_10000009 3300025938 Bacteria 198266
120 Ga0207691_10000121 3300025940 Bacteria 70558
121 Ga0207711_10000024 3300025941 Bacteria 293596
122 Ga0207689_10121426 3300025942 Bacteria 2149
123 Ga0207661_10000068 3300025944 Bacteria 70953
124 Ga0207661_10205137 3300025944 Bacteria 1735
125 Ga0207679_10302132 3300025945 Bacteria 1380
126 Ga0207679_10408755 3300025945 Bacteria 1195
127 Ga0207651_10016005 3300025960 Bacteria 4377
128 Ga0207668_10236589 3300025972 Bacteria 1475
129 Ga0207640_10000517 3300025981 Bacteria 23263
130 Ga0207640_10013610 3300025981 Bacteria 4667
131 Ga0207658_10000708 3300025986 Bacteria 28881
132 Ga0207658_10076798 3300025986 Bacteria 2546
133 Ga0207677_10003398 3300026023 Bacteria 8432
134 Ga0207703_10000381 3300026035 Bacteria 47426
135 Ga0207703_10000451 3300026035 Bacteria 43264
136 Ga0207702_10468408 3300026078 Bacteria 1225
137 Ga0207641_10000065 3300026088 Bacteria 156066
138 Ga0207641_10001058 3300026088 Bacteria 27805
139 Ga0207676_10000026 3300026095 Bacteria 248593
140 Ga0207675_100296687 3300026118 Unclassified 1573
141 Ga0207683_10031792 3300026121 Bacteria 4582
142 Ga0207698_10000009 3300026142 Bacteria 281300
143 Ga0207698_10044802 3300026142 Bacteria 3328
144 Ga0268266_10000023 3300028379 Bacteria 501899
145 Ga0268266_10007702 3300028379 Bacteria 9668
146 Ga0268266_10159222 3300028379 Bacteria 2041
147 Ga0268266_10241215 3300028379 Bacteria 1668
148 Ga0268266_10336791 3300028379 Bacteria 1415
149 Ga0268265_10009717 3300028380 Bacteria 6492
150 Ga0268264_10151114 3300028381 Bacteria 2082
151 Ga0265319_1000091 3300028563 Bacteria 70394
152 Ga0265338_10000752 3300028800 Bacteria 55238
153 Ga0307511_10052559 3300030521 Bacteria 3245
154 Ga0265325_10003985 3300031241 Bacteria 9448
155 Ga0395905_0175703 3300037471 Bacteria 2011
156 Ga0451853_2634544 3300041512 Bacteria 8367
157 Ga0466963_0000025 3300044694 Bacteria 51171
158 Ga0466957_0000824 3300044842 Bacteria 15816
159 Ga0466967_0000005 3300045976 Bacteria 149543
160 Ga0466967_0003204 3300045976 Bacteria 10566
161 Ga0466967_0820697 3300045976 Bacteria 924
162 Ga0466967_0865303 3300045976 Unclassified 898
163 Ga0495603_0000054 3300046455 Bacteria 49027
164 Ga0495603_0001846 3300046455 Bacteria 12499
165 Ga0495603_0007298 3300046455 Bacteria 6644
166 Ga0495603_0524563 3300046455 Bacteria 678
167 Ga0495629_0003197 3300046459 Bacteria 12400
168 Ga0495629_0052741 3300046459 Bacteria 2846
169 Ga0495629_0064004 3300046459 Bacteria 2568
170 Ga0495638_0012893 3300046460 Bacteria 5711
171 Ga0495641_0000095 3300046461 Bacteria 60441
172 Ga0495641_0020525 3300046461 Bacteria 3347
173 Ga0495653_0102892 3300046463 Bacteria 2066
174 Ga0495662_0006826 3300046476 Bacteria 5680
175 Ga0495594_0000191 3300046499 Bacteria 29900
176 Ga0495608_0000010 3300046511 Bacteria 258660
177 Ga0495608_0008709 3300046511 Bacteria 7098
178 Ga0495618_0000097 3300046514 Bacteria 63474
179 Ga0495620_0000158 3300046515 Bacteria 54704
180 Ga0495628_0000048 3300046516 Bacteria 96944
181 Ga0495628_0003972 3300046516 Bacteria 13174
182 Ga0495628_0010115 3300046516 Bacteria 8022
183 Ga0495628_0020905 3300046516 Bacteria 5391
184 Ga0495630_0000082 3300046517 Bacteria 75280
185 Ga0495630_0001301 3300046517 Bacteria 17211
186 Ga0495652_0028279 3300046529 Bacteria 4935
187 Ga0495640_0052758 3300046533 Bacteria 2790
188 Ga0495586_0000234 3300046535 Bacteria 36813
189 Ga0495587_0012904 3300046536 Bacteria 5254
190 Ga0495587_0333272 3300046536 Bacteria 847
191 Ga0495645_0451629 3300046543 Unclassified 810
192 Ga0495622_0000925 3300046557 Bacteria 15862
193 Ga0495656_0014301 3300046615 Bacteria 2973
194 Ga0495634_0000616 3300046642 Bacteria 34537
195 Ga0495634_0095273 3300046642 Bacteria 1928
196 Ga0495634_0449748 3300046642 Bacteria 760
197 Ga0495634_0459267 3300046642 Bacteria 750
198 Ga0495625_0008361 3300046660 Bacteria 8835
199 Ga0495635_0000006 3300046663 Bacteria 301820
200 Ga0495635_0041536 3300046663 Bacteria 3176
201 Ga0495635_0231815 3300046663 Bacteria 1247
202 Ga0495588_0000218 3300046674 Bacteria 54328
203 Ga0495657_0000005 3300046675 Bacteria 254860
204 Ga0495657_0002455 3300046675 Bacteria 15608
205 Ga0495599_0017432 3300046678 Bacteria 4465
206 Ga0495623_0108932 3300046679 Bacteria 1681
207 Ga0495646_0360654 3300046680 Bacteria 760
208 Ga0495647_0000010 3300046681 Bacteria 94696
209 Ga0495658_0002078 3300046683 Bacteria 10151
210 Ga0495669_0018458 3300046684 Bacteria 3000
211 Ga0495613_0000092 3300046689 Bacteria 86976
212 Ga0495613_0000131 3300046689 Bacteria 74262
213 Ga0495613_0053942 3300046689 Bacteria 2956
214 Ga0495624_0000049 3300046690 Bacteria 75485
215 Ga0495624_0029189 3300046690 Bacteria 3600
216 Ga0495600_0014478 3300046809 Bacteria 4970
217 Ga0495600_0046715 3300046809 Bacteria 2824
218 Ga0495660_0118693 3300046810 Bacteria 1341
219 Ga0495604_0000078 3300047317 Bacteria 83632
220 Ga0495604_0103907 3300047317 Bacteria 2083
221 Ga0495674_0000063 3300047319 Bacteria 71737
222 Ga0495674_0735500 3300047319 Bacteria 772
223 Ga0495672_0025960 3300047320 Bacteria 3744
224 Ga0495676_0003442 3300047321 Bacteria 14318
225 Ga0495676_0005287 3300047321 Bacteria 11819
226 Ga0495680_0000050 3300047322 Bacteria 95945
227 Ga0495680_0000873 3300047322 Bacteria 33510
228 Ga0495680_0043519 3300047322 Bacteria 3555
229 Ga0495680_0178076 3300047322 Bacteria 1536
230 Ga0495675_0000004 3300047444 Bacteria 211049
231 Ga0495684_0356484 3300047471 Bacteria 1037
232 Ga0495602_0000009 3300048088 Bacteria 258991
233 Ga0495602_0002886 3300048088 Bacteria 17610
234 Ga0495602_0237585 3300048088 Bacteria 1365
235 Ga0496100_0000004 3300048903 Bacteria 321778
236 Ga0496100_0000032 3300048903 Bacteria 99877
237 Ga0496101_0000007 3300048904 Bacteria 321778
238 Ga0496101_0000012 3300048904 Bacteria 268127
239 Ga0496102_0000132 3300048905 Bacteria 103176
240 Ga0496103_0000077 3300048906 Bacteria 112223
241 Ga0496104_0000002 3300048907 Bacteria 686017
242 Ga0496104_0000003 3300048907 Bacteria 669219
243 Ga0496104_0001440 3300048907 Bacteria 20567
244 Ga0496105_0000001 3300048908 Bacteria 1328178
245 Ga0496105_0000003 3300048908 Bacteria 713251
246 Ga0496105_0000095 3300048908 Bacteria 60866
247 Ga0496106_0000004 3300048909 Bacteria 279896
248 Ga0496106_0000092 3300048909 Bacteria 70312
249 Ga0496106_0186291 3300048909 Bacteria 1649
250 Ga0496107_0000001 3300048910 Bacteria 321778
251 Ga0496107_0000031 3300048910 Bacteria 100522
252 Ga0496107_0728640 3300048910 Bacteria 728
253 Ga0496108_0000002 3300048911 Bacteria 700890
254 Ga0496108_0000012 3300048911 Bacteria 258433
255 Ga0496108_0000202 3300048911 Bacteria 55115
256 Ga0496108_0014041 3300048911 Bacteria 6535
257 Ga0496108_0038460 3300048911 Bacteria 3986
258 Ga0496108_0215423 3300048911 Bacteria 1668
259 Ga0496109_0000001 3300048912 Bacteria 700852
260 Ga0496109_0000076 3300048912 Bacteria 104273
261 Ga0496109_0000106 3300048912 Bacteria 86550
262 Ga0496109_0000131 3300048912 Bacteria 76860
263 Ga0496109_0198724 3300048912 Bacteria 1885
264 Ga0496109_0826353 3300048912 Bacteria 864
265 Ga0496110_0000015 3300048913 Bacteria 85373
266 Ga0496110_0022911 3300048913 Bacteria 5307
267 Ga0496110_0062404 3300048913 Bacteria 3291
268 Ga0496111_0000001 3300048914 Bacteria 194837
269 Ga0496111_0056033 3300048914 Bacteria 2851
270 Ga0496111_0275570 3300048914 Bacteria 1248
271 Ga0496112_0000002 3300048915 Bacteria 782039
272 Ga0496113_0000033 3300048916 Bacteria 59422
273 Ga0496113_0022010 3300048916 Bacteria 4503
274 Ga0496113_0046466 3300048916 Bacteria 3223
275 Ga0496113_0099138 3300048916 Bacteria 2256
276 Ga0496113_0763730 3300048916 Bacteria 769
277 Ga0496114_0000003 3300048917 Bacteria 630981
278 Ga0496114_0014570 3300048917 Bacteria 6316
279 Ga0496115_0000071 3300048918 Bacteria 91922
280 Ga0496115_0000183 3300048918 Bacteria 58406
281 Ga0496119_0029259 3300048922 Bacteria 3741
282 Ga0496120_0043668 3300048923 Bacteria 2610
283 Ga0496125_0253851 3300048928 Bacteria 1107
284 Ga0501032_0160092 3300049569 Bacteria 1478
285 Ga0501034_1051406 3300049571 Bacteria 696
286 Ga0501039_0379311 3300049575 Bacteria 1111
287 Ga0501042_0494451 3300049578 Bacteria 888
288 Ga0501047_1088773 3300049581 Bacteria 612
289 Ga0501070_0152234 3300049586 Bacteria 1908
290 Ga0501070_0869435 3300049586 Bacteria 704
291 Ga0501071_0059899 3300049587 Bacteria 2755
292 Ga0501074_0040894 3300049590 Bacteria 3356
293 Ga0501075_0416260 3300049591 Bacteria 1025
294 Ga0501079_0048913 3300049741 Bacteria 3263
295 Ga0501079_0567293 3300049741 Bacteria 893
296 Ga0501080_1100264 3300049742 Bacteria 686
297 Ga0501044_0016664 3300049823 Bacteria 7891
298 Ga0501044_1217145 3300049823 Bacteria 621
299 nmdc:mga0rr50_315885_c1 3300050513 Bacteria 1309
300 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
301 Ga0495601_0000042 3300053077 Bacteria 77373
302 Ga0495601_0000296 3300053077 Bacteria 26491
303 Ga0495601_0011291 3300053077 Bacteria 5338
304 Ga0495601_0057755 3300053077 Bacteria 2458
305 Ga0495612_0008495 3300053078 Bacteria 4163
306 Ga0495612_0014769 3300053078 Bacteria 3134
307 Ga0495655_0000009 3300053083 Bacteria 150662
308 Ga0495655_0000485 3300053083 Bacteria 6632
309 Ga0495595_0000005 3300053084 Bacteria 258660
310 Ga0495595_0000362 3300053084 Bacteria 17220
311 Ga0495619_0000040 3300053085 Bacteria 118238
312 Ga0495619_0000126 3300053085 Bacteria 56169
313 Ga0495619_0000896 3300053085 Bacteria 19523
314 Ga0495619_0002266 3300053085 Bacteria 12712
315 Ga0495619_0007234 3300053085 Bacteria 7032
316 Ga0495619_0206342 3300053085 Bacteria 1360
317 Ga0500614_003173 3300053123 Bacteria 3567
318 Ga0500628_000078 3300053129 Bacteria 24490

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025934 Ga0207686_10000029 Ga0207686_1000002911 169
2 3300046679 Ga0495623_0108932 Ga0495623_0108932_861_1370 169
3 3300047317 Ga0495604_0103907 Ga0495604_0103907_1075_1656 173
4 3300026078 Ga0207702_10468408 Ga0207702_104684082 174
5 3300005614 Ga0068856_100585567 Ga0068856_1005855672 175
6 3300005444 Ga0070694_100618030 Ga0070694_1006180301 177
7 3300028563 Ga0265319_1000091 Ga0265319_100009136 177
8 3300028800 Ga0265338_10000752 Ga0265338_1000075236 177
9 3300031241 Ga0265325_10003985 Ga0265325_100039859 177
10 3300047322 Ga0495680_0043519 Ga0495680_0043519_1038_1571 177
11 3300049581 Ga0501047_1088773 Ga0501047_1088773_34_573 177
12 3300049823 Ga0501044_1217145 Ga0501044_1217145_48_587 177
13 3300045976 Ga0466967_0820697 Ga0466967_0820697_217_807 179
14 3300048913 Ga0496110_0062404 Ga0496110_0062404_140_727 182
15 3300048914 Ga0496111_0056033 Ga0496111_0056033_140_727 182
16 3300048916 Ga0496113_0763730 Ga0496113_0763730_56_643 182
17 3300046514 Ga0495618_0000097 Ga0495618_0000097_29504_30088 183
18 3300046459 Ga0495629_0003197 Ga0495629_0003197_47_628 184
19 3300005718 Ga0068866_10001565 Ga0068866_1000156511 185
20 3300005841 Ga0068863_100027154 Ga0068863_1000271547 185
21 3300009176 Ga0105242_10000403 Ga0105242_1000040330 185
22 3300025899 Ga0207642_10027165 Ga0207642_100271654 185
23 3300026088 Ga0207641_10001058 Ga0207641_100010588 185
24 3300006852 Ga0075433_10000032 Ga0075433_1000003231 186
25 3300026118 Ga0207675_100296687 Ga0207675_1002966872 186
26 3300053077 Ga0495601_0000042 Ga0495601_0000042_22607_23194 186
27 3300005616 Ga0068852_100065559 Ga0068852_1000655592 187
28 3300026142 Ga0207698_10044802 Ga0207698_100448022 187
29 3300048905 Ga0496102_0000132 Ga0496102_0000132_61080_61694 187
30 3300048906 Ga0496103_0000077 Ga0496103_0000077_41471_42085 187
31 3300053083 Ga0495655_0000009 Ga0495655_0000009_18587_19168 187
32 3300053129 Ga0500628_000078 Ga0500628_000078_19891_20472 187
33 3300037471 Ga0395905_0175703 Ga0395905_0175703_755_1351 188
34 3300045976 Ga0466967_0865303 Ga0466967_0865303_32_613 191
35 3300005341 Ga0070691_10008978 Ga0070691_100089783 192
36 3300005439 Ga0070711_100031957 Ga0070711_1000319574 192
37 3300005544 Ga0070686_100066762 Ga0070686_1000667622 192
38 3300005618 Ga0068864_100000201 Ga0068864_10000020132 192
39 3300005842 Ga0068858_100000178 Ga0068858_10000017833 192
40 3300013104 Ga0157370_10500434 Ga0157370_105004341 192
41 3300025916 Ga0207663_10016849 Ga0207663_100168492 192
42 3300025942 Ga0207689_10121426 Ga0207689_101214263 192
43 3300026035 Ga0207703_10000381 Ga0207703_1000038132 192
44 3300026095 Ga0207676_10000026 Ga0207676_10000026210 192
45 3300030521 Ga0307511_10052559 Ga0307511_100525592 192
46 3300046455 Ga0495603_0000054 Ga0495603_0000054_6764_7348 192
47 3300046455 Ga0495603_0001846 Ga0495603_0001846_9195_9779 192
48 3300046511 Ga0495608_0008709 Ga0495608_0008709_6498_7076 192
49 3300046516 Ga0495628_0020905 Ga0495628_0020905_1606_2184 192
50 3300046615 Ga0495656_0014301 Ga0495656_0014301_326_910 192
51 3300046689 Ga0495613_0053942 Ga0495613_0053942_21_605 192
52 3300048911 Ga0496108_0000202 Ga0496108_0000202_28793_29389 192
53 3300048912 Ga0496109_0000131 Ga0496109_0000131_57013_57609 192
54 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_82461_83045 192
55 3300001979 JGI24740J21852_10031430 JGI24740J21852_100314302 193
56 3300005333 Ga0070677_10000007 Ga0070677_1000000733 193
57 3300005335 Ga0070666_10026471 Ga0070666_100264711 193
58 3300005337 Ga0070682_100000038 Ga0070682_100000038120 193
59 3300005337 Ga0070682_100296811 Ga0070682_1002968112 193
60 3300005339 Ga0070660_100626838 Ga0070660_1006268381 193
61 3300005341 Ga0070691_10000839 Ga0070691_100008398 193
62 3300005344 Ga0070661_100002486 Ga0070661_1000024864 193
63 3300005347 Ga0070668_100125384 Ga0070668_1001253841 193
64 3300005354 Ga0070675_100000008 Ga0070675_100000008155 193
65 3300005356 Ga0070674_100000001 Ga0070674_10000000174 193
66 3300005356 Ga0070674_100000026 Ga0070674_10000002677 193
67 3300005364 Ga0070673_100031221 Ga0070673_1000312215 193
68 3300005365 Ga0070688_100000364 Ga0070688_1000003644 193
69 3300005365 Ga0070688_100461259 Ga0070688_1004612591 193
70 3300005366 Ga0070659_100297631 Ga0070659_1002976311 193
71 3300005367 Ga0070667_100001965 Ga0070667_10000196510 193
72 3300005434 Ga0070709_10411066 Ga0070709_104110662 193
73 3300005436 Ga0070713_100000061 Ga0070713_10000006126 193
74 3300005436 Ga0070713_100010682 Ga0070713_1000106826 193
75 3300005439 Ga0070711_100001471 Ga0070711_1000014719 193
76 3300005456 Ga0070678_100021943 Ga0070678_1000219432 193
77 3300005466 Ga0070685_10006756 Ga0070685_100067564 193
78 3300005535 Ga0070684_100016415 Ga0070684_1000164156 193
79 3300005535 Ga0070684_100084289 Ga0070684_1000842892 193
80 3300005545 Ga0070695_100161064 Ga0070695_1001610642 193
81 3300005548 Ga0070665_100000306 Ga0070665_10000030647 193
82 3300005548 Ga0070665_100010906 Ga0070665_1000109067 193
83 3300005548 Ga0070665_100118587 Ga0070665_1001185872 193
84 3300005548 Ga0070665_100200959 Ga0070665_1002009592 193
85 3300005548 Ga0070665_100388709 Ga0070665_1003887091 193
86 3300005564 Ga0070664_100020110 Ga0070664_1000201104 193
87 3300005564 Ga0070664_100357325 Ga0070664_1003573252 193
88 3300005578 Ga0068854_100000044 Ga0068854_10000004430 193
89 3300005578 Ga0068854_100033059 Ga0068854_1000330592 193
90 3300005616 Ga0068852_100000050 Ga0068852_10000005073 193
91 3300005718 Ga0068866_10000006 Ga0068866_10000006130 193
92 3300005718 Ga0068866_10000055 Ga0068866_100000554 193
93 3300005840 Ga0068870_10087812 Ga0068870_100878122 193
94 3300005842 Ga0068858_100000454 Ga0068858_1000004547 193
95 3300005843 Ga0068860_100152131 Ga0068860_1001521312 193
96 3300005844 Ga0068862_100002610 Ga0068862_10000261012 193
97 3300005937 Ga0081455_10006555 Ga0081455_100065552 193
98 3300005983 Ga0081540_1000044 Ga0081540_1000044107 193
99 3300005985 Ga0081539_10079134 Ga0081539_100791342 193
100 3300006163 Ga0070715_10000003 Ga0070715_10000003186 193
101 3300006846 Ga0075430_100038742 Ga0075430_1000387422 193
102 3300006881 Ga0068865_100000019 Ga0068865_10000001911 193
103 3300007076 Ga0075435_100131203 Ga0075435_1001312031 193
104 3300007076 Ga0075435_100358140 Ga0075435_1003581402 193
105 3300009098 Ga0105245_10000012 Ga0105245_10000012103 193
106 3300009098 Ga0105245_10000049 Ga0105245_10000049122 193
107 3300009098 Ga0105245_10006484 Ga0105245_100064842 193
108 3300009101 Ga0105247_10000109 Ga0105247_1000010914 193
109 3300009101 Ga0105247_10165372 Ga0105247_101653722 193
110 3300009148 Ga0105243_10010968 Ga0105243_100109686 193
111 3300009177 Ga0105248_10000126 Ga0105248_100001263 193
112 3300010375 Ga0105239_10174388 Ga0105239_101743884 193
113 3300013102 Ga0157371_10005438 Ga0157371_100054389 193
114 3300013104 Ga0157370_10134257 Ga0157370_101342572 193
115 3300013296 Ga0157374_10002637 Ga0157374_100026377 193
116 3300013297 Ga0157378_10069359 Ga0157378_100693592 193
117 3300013297 Ga0157378_10387780 Ga0157378_103877802 193
118 3300013307 Ga0157372_10000128 Ga0157372_100001283 193
119 3300013308 Ga0157375_10012890 Ga0157375_100128901 193
120 3300013308 Ga0157375_10028209 Ga0157375_100282093 193
121 3300014325 Ga0163163_10903922 Ga0163163_109039221 193
122 3300014325 Ga0163163_11286900 Ga0163163_112869001 193
123 3300014326 Ga0157380_10000009 Ga0157380_1000000987 193
124 3300014968 Ga0157379_10006179 Ga0157379_100061792 193
125 3300017792 Ga0163161_10000013 Ga0163161_10000013250 193
126 3300017792 Ga0163161_10044832 Ga0163161_100448323 193
127 3300020082 Ga0206353_11105305 Ga0206353_111053052 193
128 3300025321 Ga0207656_10000153 Ga0207656_1000015316 193
129 3300025893 Ga0207682_10000007 Ga0207682_1000000741 193
130 3300025899 Ga0207642_10000001 Ga0207642_1000000179 193
131 3300025899 Ga0207642_10000003 Ga0207642_1000000379 193
132 3300025899 Ga0207642_10000004 Ga0207642_1000000479 193
133 3300025899 Ga0207642_10001353 Ga0207642_100013534 193
134 3300025900 Ga0207710_10000408 Ga0207710_100004087 193
135 3300025903 Ga0207680_10031797 Ga0207680_100317971 193
136 3300025905 Ga0207685_10000003 Ga0207685_10000003184 193
137 3300025907 Ga0207645_10341518 Ga0207645_103415182 193
138 3300025912 Ga0207707_10017668 Ga0207707_100176682 193
139 3300025916 Ga0207663_10001276 Ga0207663_100012765 193
140 3300025919 Ga0207657_10552562 Ga0207657_105525621 193
141 3300025920 Ga0207649_10000005 Ga0207649_1000000572 193
142 3300025921 Ga0207652_10000138 Ga0207652_1000013840 193
143 3300025924 Ga0207694_10000008 Ga0207694_10000008119 193
144 3300025926 Ga0207659_10000014 Ga0207659_10000014160 193
145 3300025927 Ga0207687_10000011 Ga0207687_10000011156 193
146 3300025927 Ga0207687_10000012 Ga0207687_10000012370 193
147 3300025927 Ga0207687_10007446 Ga0207687_100074468 193
148 3300025928 Ga0207700_10000016 Ga0207700_10000016102 193
149 3300025928 Ga0207700_10018327 Ga0207700_100183272 193
150 3300025929 Ga0207664_10215027 Ga0207664_102150272 193
151 3300025932 Ga0207690_10218534 Ga0207690_102185342 193
152 3300025933 Ga0207706_10000302 Ga0207706_1000030234 193
153 3300025935 Ga0207709_10005552 Ga0207709_100055523 193
154 3300025937 Ga0207669_10000002 Ga0207669_10000002275 193
155 3300025937 Ga0207669_10000041 Ga0207669_100000418 193
156 3300025937 Ga0207669_10254308 Ga0207669_102543082 193
157 3300025938 Ga0207704_10000009 Ga0207704_1000000978 193
158 3300025940 Ga0207691_10000121 Ga0207691_1000012143 193
159 3300025941 Ga0207711_10000024 Ga0207711_10000024115 193
160 3300025944 Ga0207661_10000068 Ga0207661_1000006852 193
161 3300025944 Ga0207661_10205137 Ga0207661_102051372 193
162 3300025945 Ga0207679_10302132 Ga0207679_103021322 193
163 3300025945 Ga0207679_10408755 Ga0207679_104087551 193
164 3300025960 Ga0207651_10016005 Ga0207651_100160056 193
165 3300025972 Ga0207668_10236589 Ga0207668_102365891 193
166 3300025981 Ga0207640_10000517 Ga0207640_1000051710 193
167 3300025981 Ga0207640_10013610 Ga0207640_100136104 193
168 3300025986 Ga0207658_10000708 Ga0207658_1000070826 193
169 3300025986 Ga0207658_10076798 Ga0207658_100767981 193
170 3300026023 Ga0207677_10003398 Ga0207677_100033982 193
171 3300026035 Ga0207703_10000451 Ga0207703_100004517 193
172 3300026088 Ga0207641_10000065 Ga0207641_1000006523 193
173 3300026121 Ga0207683_10031792 Ga0207683_100317922 193
174 3300026142 Ga0207698_10000009 Ga0207698_1000000954 193
175 3300028379 Ga0268266_10000023 Ga0268266_1000002328 193
176 3300028379 Ga0268266_10007702 Ga0268266_100077027 193
177 3300028379 Ga0268266_10159222 Ga0268266_101592222 193
178 3300028379 Ga0268266_10241215 Ga0268266_102412152 193
179 3300028379 Ga0268266_10336791 Ga0268266_103367912 193
180 3300028380 Ga0268265_10009717 Ga0268265_100097174 193
181 3300028381 Ga0268264_10151114 Ga0268264_101511142 193
182 3300041512 Ga0451853_2634544 Ga0451853_2634544_5548_6132 193
183 3300044694 Ga0466963_0000025 Ga0466963_0000025_10277_10861 193
184 3300044842 Ga0466957_0000824 Ga0466957_0000824_4002_4589 193
185 3300045976 Ga0466967_0000005 Ga0466967_0000005_139962_140552 193
186 3300045976 Ga0466967_0003204 Ga0466967_0003204_2845_3432 193
187 3300046455 Ga0495603_0007298 Ga0495603_0007298_6027_6611 193
188 3300046455 Ga0495603_0524563 Ga0495603_0524563_76_660 193
189 3300046459 Ga0495629_0052741 Ga0495629_0052741_95_688 193
190 3300046459 Ga0495629_0064004 Ga0495629_0064004_1163_1750 193
191 3300046460 Ga0495638_0012893 Ga0495638_0012893_3255_3842 193
192 3300046461 Ga0495641_0000095 Ga0495641_0000095_39814_40410 193
193 3300046461 Ga0495641_0020525 Ga0495641_0020525_2158_2757 193
194 3300046463 Ga0495653_0102892 Ga0495653_0102892_1401_1985 193
195 3300046476 Ga0495662_0006826 Ga0495662_0006826_4206_4793 193
196 3300046499 Ga0495594_0000191 Ga0495594_0000191_15004_15591 193
197 3300046511 Ga0495608_0000010 Ga0495608_0000010_34968_35555 193
198 3300046515 Ga0495620_0000158 Ga0495620_0000158_29849_30430 193
199 3300046516 Ga0495628_0000048 Ga0495628_0000048_74589_75176 193
200 3300046516 Ga0495628_0003972 Ga0495628_0003972_9338_9922 193
201 3300046516 Ga0495628_0010115 Ga0495628_0010115_2855_3436 193
202 3300046517 Ga0495630_0000082 Ga0495630_0000082_54675_55280 193
203 3300046517 Ga0495630_0001301 Ga0495630_0001301_13373_13957 193
204 3300046529 Ga0495652_0028279 Ga0495652_0028279_1155_1748 193
205 3300046533 Ga0495640_0052758 Ga0495640_0052758_2071_2658 193
206 3300046535 Ga0495586_0000234 Ga0495586_0000234_10168_10749 193
207 3300046536 Ga0495587_0012904 Ga0495587_0012904_2497_3081 193
208 3300046536 Ga0495587_0333272 Ga0495587_0333272_116_703 193
209 3300046543 Ga0495645_0451629 Ga0495645_0451629_156_749 193
210 3300046557 Ga0495622_0000925 Ga0495622_0000925_314_901 193
211 3300046642 Ga0495634_0000616 Ga0495634_0000616_18573_19160 193
212 3300046642 Ga0495634_0095273 Ga0495634_0095273_933_1568 193
213 3300046642 Ga0495634_0449748 Ga0495634_0449748_96_683 193
214 3300046642 Ga0495634_0459267 Ga0495634_0459267_71_670 193
215 3300046660 Ga0495625_0008361 Ga0495625_0008361_8115_8702 193
216 3300046663 Ga0495635_0000006 Ga0495635_0000006_129908_130492 193
217 3300046663 Ga0495635_0041536 Ga0495635_0041536_594_1181 193
218 3300046663 Ga0495635_0231815 Ga0495635_0231815_551_1153 193
219 3300046674 Ga0495588_0000218 Ga0495588_0000218_38301_38888 193
220 3300046675 Ga0495657_0000005 Ga0495657_0000005_219306_219893 193
221 3300046675 Ga0495657_0002455 Ga0495657_0002455_7342_7926 193
222 3300046678 Ga0495599_0017432 Ga0495599_0017432_35_619 193
223 3300046680 Ga0495646_0360654 Ga0495646_0360654_124_708 193
224 3300046681 Ga0495647_0000010 Ga0495647_0000010_9794_10387 193
225 3300046683 Ga0495658_0002078 Ga0495658_0002078_1094_1681 193
226 3300046684 Ga0495669_0018458 Ga0495669_0018458_1128_1715 193
227 3300046689 Ga0495613_0000092 Ga0495613_0000092_70889_71473 193
228 3300046689 Ga0495613_0000131 Ga0495613_0000131_19436_20023 193
229 3300046690 Ga0495624_0000049 Ga0495624_0000049_30986_31567 193
230 3300046690 Ga0495624_0029189 Ga0495624_0029189_2994_3578 193
231 3300046809 Ga0495600_0014478 Ga0495600_0014478_3063_3650 193
232 3300046809 Ga0495600_0046715 Ga0495600_0046715_1116_1697 193
233 3300046810 Ga0495660_0118693 Ga0495660_0118693_266_853 193
234 3300047317 Ga0495604_0000078 Ga0495604_0000078_40071_40658 193
235 3300047319 Ga0495674_0000063 Ga0495674_0000063_52227_52814 193
236 3300047319 Ga0495674_0735500 Ga0495674_0735500_113_709 193
237 3300047320 Ga0495672_0025960 Ga0495672_0025960_2711_3295 193
238 3300047321 Ga0495676_0003442 Ga0495676_0003442_9814_10395 193
239 3300047321 Ga0495676_0005287 Ga0495676_0005287_7379_7960 193
240 3300047322 Ga0495680_0000050 Ga0495680_0000050_9640_10224 193
241 3300047322 Ga0495680_0000873 Ga0495680_0000873_29683_30267 193
242 3300047322 Ga0495680_0178076 Ga0495680_0178076_703_1290 193
243 3300047444 Ga0495675_0000004 Ga0495675_0000004_26108_26695 193
244 3300047471 Ga0495684_0356484 Ga0495684_0356484_219_821 193
245 3300048088 Ga0495602_0000009 Ga0495602_0000009_183847_184446 193
246 3300048088 Ga0495602_0002886 Ga0495602_0002886_12226_12813 193
247 3300048088 Ga0495602_0237585 Ga0495602_0237585_22_603 193
248 3300048903 Ga0496100_0000004 Ga0496100_0000004_188190_188774 193
249 3300048903 Ga0496100_0000032 Ga0496100_0000032_68569_69150 193
250 3300048904 Ga0496101_0000007 Ga0496101_0000007_188190_188774 193
251 3300048904 Ga0496101_0000012 Ga0496101_0000012_30891_31472 193
252 3300048907 Ga0496104_0000002 Ga0496104_0000002_374153_374734 193
253 3300048907 Ga0496104_0000003 Ga0496104_0000003_562476_563063 193
254 3300048907 Ga0496104_0001440 Ga0496104_0001440_4913_5497 193
255 3300048908 Ga0496105_0000001 Ga0496105_0000001_953445_954026 193
256 3300048908 Ga0496105_0000003 Ga0496105_0000003_623058_623645 193
257 3300048908 Ga0496105_0000095 Ga0496105_0000095_59218_59802 193
258 3300048909 Ga0496106_0000004 Ga0496106_0000004_149604_150188 193
259 3300048909 Ga0496106_0000092 Ga0496106_0000092_29423_30004 193
260 3300048909 Ga0496106_0186291 Ga0496106_0186291_980_1564 193
261 3300048910 Ga0496107_0000001 Ga0496107_0000001_188190_188774 193
262 3300048910 Ga0496107_0000031 Ga0496107_0000031_69079_69660 193
263 3300048910 Ga0496107_0728640 Ga0496107_0728640_117_701 193
264 3300048911 Ga0496108_0000002 Ga0496108_0000002_638259_638843 193
265 3300048911 Ga0496108_0000012 Ga0496108_0000012_16959_17546 193
266 3300048911 Ga0496108_0014041 Ga0496108_0014041_5476_6063 193
267 3300048911 Ga0496108_0038460 Ga0496108_0038460_2106_2687 193
268 3300048911 Ga0496108_0215423 Ga0496108_0215423_707_1294 193
269 3300048912 Ga0496109_0000001 Ga0496109_0000001_638221_638805 193
270 3300048912 Ga0496109_0000076 Ga0496109_0000076_37377_37964 193
271 3300048912 Ga0496109_0000106 Ga0496109_0000106_57672_58259 193
272 3300048912 Ga0496109_0198724 Ga0496109_0198724_471_1160 193
273 3300048912 Ga0496109_0826353 Ga0496109_0826353_50_637 193
274 3300048913 Ga0496110_0000015 Ga0496110_0000015_9508_10095 193
275 3300048913 Ga0496110_0022911 Ga0496110_0022911_3254_3853 193
276 3300048914 Ga0496111_0000001 Ga0496111_0000001_164733_165320 193
277 3300048914 Ga0496111_0275570 Ga0496111_0275570_252_839 193
278 3300048915 Ga0496112_0000002 Ga0496112_0000002_288458_289039 193
279 3300048916 Ga0496113_0000033 Ga0496113_0000033_55110_55697 193
280 3300048916 Ga0496113_0022010 Ga0496113_0022010_3078_3665 193
281 3300048916 Ga0496113_0046466 Ga0496113_0046466_1347_1928 193
282 3300048916 Ga0496113_0099138 Ga0496113_0099138_1516_2103 193
283 3300048917 Ga0496114_0000003 Ga0496114_0000003_43425_44006 193
284 3300048917 Ga0496114_0014570 Ga0496114_0014570_3990_4571 193
285 3300048918 Ga0496115_0000071 Ga0496115_0000071_80286_80867 193
286 3300048918 Ga0496115_0000183 Ga0496115_0000183_20685_21266 193
287 3300048922 Ga0496119_0029259 Ga0496119_0029259_2396_2977 193
288 3300048923 Ga0496120_0043668 Ga0496120_0043668_865_1446 193
289 3300048928 Ga0496125_0253851 Ga0496125_0253851_42_626 193
290 3300049569 Ga0501032_0160092 Ga0501032_0160092_426_1025 193
291 3300049571 Ga0501034_1051406 Ga0501034_1051406_35_634 193
292 3300049575 Ga0501039_0379311 Ga0501039_0379311_160_747 193
293 3300049578 Ga0501042_0494451 Ga0501042_0494451_52_639 193
294 3300049586 Ga0501070_0152234 Ga0501070_0152234_1190_1771 193
295 3300049586 Ga0501070_0869435 Ga0501070_0869435_40_627 193
296 3300049587 Ga0501071_0059899 Ga0501071_0059899_17_604 193
297 3300049590 Ga0501074_0040894 Ga0501074_0040894_580_1167 193
298 3300049591 Ga0501075_0416260 Ga0501075_0416260_55_642 193
299 3300049741 Ga0501079_0048913 Ga0501079_0048913_1671_2258 193
300 3300049741 Ga0501079_0567293 Ga0501079_0567293_35_625 193
301 3300049742 Ga0501080_1100264 Ga0501080_1100264_16_603 193
302 3300049823 Ga0501044_0016664 Ga0501044_0016664_42_629 193
303 3300050513 nmdc:mga0rr50_315885_c1 nmdc:mga0rr50_315885_c1_266_850 193
304 3300053077 Ga0495601_0000296 Ga0495601_0000296_17743_18330 193
305 3300053077 Ga0495601_0011291 Ga0495601_0011291_2382_2987 193
306 3300053077 Ga0495601_0057755 Ga0495601_0057755_1505_2089 193
307 3300053078 Ga0495612_0008495 Ga0495612_0008495_3089_3676 193
308 3300053078 Ga0495612_0014769 Ga0495612_0014769_51_635 193
309 3300053083 Ga0495655_0000485 Ga0495655_0000485_5194_5781 193
310 3300053084 Ga0495595_0000005 Ga0495595_0000005_223106_223693 193
311 3300053084 Ga0495595_0000362 Ga0495595_0000362_9606_10247 193
312 3300053085 Ga0495619_0000040 Ga0495619_0000040_27556_28143 193
313 3300053085 Ga0495619_0000126 Ga0495619_0000126_20626_21213 193
314 3300053085 Ga0495619_0000896 Ga0495619_0000896_16661_17248 193
315 3300053085 Ga0495619_0002266 Ga0495619_0002266_11551_12153 193
316 3300053085 Ga0495619_0007234 Ga0495619_0007234_5380_5961 193
317 3300053085 Ga0495619_0206342 Ga0495619_0206342_136_723 193
318 3300053123 Ga0500614_003173 Ga0500614_003173_891_1487 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00498

FHA

FHA domain

58

122

0.98

PF16697

Yop-YscD_cpl

Inner membrane component of T3SS, cytoplasmic domain

44

131

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u2w-assembly1.cif.gz_A crystal structure of the staphylococcus aureus pi258 cadc 0.9731 141 167
6i2r-assembly1.cif.gz_D crystal structure of the suca domain of mycobacterium smegmatis kgd (alpha-ketoglutarate decarboxylase), mutant r802a, in complex with gara 0.9632 5 93
8p5r-assembly1.cif.gz_H crystal structure of full-length, homohexameric 2-oxoglutarate dehydrogenase kgd from mycobacterium smegmatis in complex with gara 0.9558 2 95
8p5x-assembly1.cif.gz_G single particle cryo-em structure of the complex between corynebacterium glutamicum homohexameric 2-oxoglutarate dehydrogenase odha and the fha-protein inhibitor odhi 0.9528 2 97
6hc1-assembly2.cif.gz_B bdellovibrio bacteriovorus dgcb fha in complex with phosphorylated n-terminal peptide 0.9511 1 96
ID Description Score Start End Superfamily
6az6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9851 141 166 1.10.10.10
6i2sB01 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9586 4 93 2.60.200.20
af_P9WJB5_49_154_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9509 4 94 2.60.200.20
af_Q54E53_292_358_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.949 141 167 1.10.10.10
af_Q54ST8_470_584_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9278 2 95 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A658NI66-F1-model_v4 FHA domain-containing protein 0.9777 22 88
AF-A0A2V7WC40-F1-model_v4 FHA domain-containing protein 0.9766 2 95
AF-A0A7C3WVX1-F1-model_v4 FHA domain-containing protein 0.9737 3 97
AF-A0A087CCY9-F1-model_v4 Signal transduction protein GarA 0.9724 3 95
AF-A0A495CTT1-F1-model_v4 deleted 0.9723 3 95

Feature Viewer

pLDDT pTM Quality
84.28 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map