F404786
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 318 | 194 | 318 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300048912|Ga0496109_0198724|Ga0496109_0198724_471_1160 |
| Length | 229 |
| Sequence | LGQRRKTFRGPPAPLAIRLVETADRSSVANKVSTMDPRLWISSSGEAPRSVALGGERTVVGRSPEADVVLEDEAVSWNHLEIEWRGEILMATDLDSRNGTVLNGEPLDRPRRLRDGDTLILGGFRLEMKTGAGTPVGATIASSEPSVALSEEERATAAALVAPYRNEGAFAGRPATRAEIAAELHVSERTAQRRLDALAAKLDVSGEAGRDRPRQIAARVIELGLDRPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 31 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 105 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 107 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 110 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 111 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 112 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 113 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 158 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 159 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 160 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 169 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 170 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 171 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 172 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 173 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 174 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 194 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.63 |
| Nodule | 0 |
| Rhizoplane | 14.47 |
| Rhizosphere | 83.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10031430 | 3300001979 | Bacteria | 1712 |
| 2 | Ga0070677_10000007 | 3300005333 | Bacteria | 74721 |
| 3 | Ga0070666_10026471 | 3300005335 | Bacteria | 3790 |
| 4 | Ga0070682_100000038 | 3300005337 | Bacteria | 145670 |
| 5 | Ga0070682_100296811 | 3300005337 | Bacteria | 1184 |
| 6 | Ga0070660_100626838 | 3300005339 | Bacteria | 900 |
| 7 | Ga0070691_10000839 | 3300005341 | Bacteria | 12399 |
| 8 | Ga0070691_10008978 | 3300005341 | Bacteria | 4573 |
| 9 | Ga0070661_100002486 | 3300005344 | Bacteria | 12633 |
| 10 | Ga0070668_100125384 | 3300005347 | Bacteria | 2056 |
| 11 | Ga0070675_100000008 | 3300005354 | Bacteria | 250004 |
| 12 | Ga0070674_100000001 | 3300005356 | Bacteria | 277173 |
| 13 | Ga0070674_100000026 | 3300005356 | Bacteria | 77168 |
| 14 | Ga0070673_100031221 | 3300005364 | Bacteria | 3996 |
| 15 | Ga0070688_100000364 | 3300005365 | Bacteria | 22986 |
| 16 | Ga0070688_100461259 | 3300005365 | Bacteria | 952 |
| 17 | Ga0070659_100297631 | 3300005366 | Bacteria | 1345 |
| 18 | Ga0070667_100001965 | 3300005367 | Bacteria | 18253 |
| 19 | Ga0070709_10411066 | 3300005434 | Bacteria | 1012 |
| 20 | Ga0070713_100000061 | 3300005436 | Bacteria | 68662 |
| 21 | Ga0070713_100010682 | 3300005436 | Bacteria | 6648 |
| 22 | Ga0070711_100001471 | 3300005439 | Bacteria | 12945 |
| 23 | Ga0070711_100031957 | 3300005439 | Bacteria | 3497 |
| 24 | Ga0070694_100618030 | 3300005444 | Unclassified | 874 |
| 25 | Ga0070678_100021943 | 3300005456 | Bacteria | 4220 |
| 26 | Ga0070685_10006756 | 3300005466 | Bacteria | 5852 |
| 27 | Ga0070684_100016415 | 3300005535 | Bacteria | 6053 |
| 28 | Ga0070684_100084289 | 3300005535 | Bacteria | 2817 |
| 29 | Ga0070686_100066762 | 3300005544 | Bacteria | 2341 |
| 30 | Ga0070695_100161064 | 3300005545 | Bacteria | 1575 |
| 31 | Ga0070665_100000306 | 3300005548 | Bacteria | 76666 |
| 32 | Ga0070665_100010906 | 3300005548 | Bacteria | 9191 |
| 33 | Ga0070665_100118587 | 3300005548 | Bacteria | 2648 |
| 34 | Ga0070665_100200959 | 3300005548 | Bacteria | 1993 |
| 35 | Ga0070665_100388709 | 3300005548 | Bacteria | 1403 |
| 36 | Ga0070664_100020110 | 3300005564 | Bacteria | 5497 |
| 37 | Ga0070664_100357325 | 3300005564 | Bacteria | 1330 |
| 38 | Ga0068854_100000044 | 3300005578 | Bacteria | 91882 |
| 39 | Ga0068854_100033059 | 3300005578 | Bacteria | 3604 |
| 40 | Ga0068856_100585567 | 3300005614 | Bacteria | 1137 |
| 41 | Ga0068852_100000050 | 3300005616 | Bacteria | 84306 |
| 42 | Ga0068852_100065559 | 3300005616 | Bacteria | 3169 |
| 43 | Ga0068864_100000201 | 3300005618 | Bacteria | 54044 |
| 44 | Ga0068866_10000006 | 3300005718 | Bacteria | 176129 |
| 45 | Ga0068866_10000055 | 3300005718 | Bacteria | 44369 |
| 46 | Ga0068866_10001565 | 3300005718 | Bacteria | 9730 |
| 47 | Ga0068870_10087812 | 3300005840 | Bacteria | 1732 |
| 48 | Ga0068863_100027154 | 3300005841 | Bacteria | 5460 |
| 49 | Ga0068858_100000178 | 3300005842 | Bacteria | 67760 |
| 50 | Ga0068858_100000454 | 3300005842 | Bacteria | 42918 |
| 51 | Ga0068860_100152131 | 3300005843 | Bacteria | 2228 |
| 52 | Ga0068862_100002610 | 3300005844 | Bacteria | 15861 |
| 53 | Ga0081455_10006555 | 3300005937 | Bacteria | 12458 |
| 54 | Ga0081540_1000044 | 3300005983 | Bacteria | 134269 |
| 55 | Ga0081539_10079134 | 3300005985 | Bacteria | 1733 |
| 56 | Ga0070715_10000003 | 3300006163 | Bacteria | 345282 |
| 57 | Ga0075430_100038742 | 3300006846 | Bacteria | 4037 |
| 58 | Ga0075433_10000032 | 3300006852 | Bacteria | 55399 |
| 59 | Ga0068865_100000019 | 3300006881 | Bacteria | 105996 |
| 60 | Ga0075435_100131203 | 3300007076 | Bacteria | 2097 |
| 61 | Ga0075435_100358140 | 3300007076 | Bacteria | 1251 |
| 62 | Ga0105245_10000012 | 3300009098 | Bacteria | 267151 |
| 63 | Ga0105245_10000049 | 3300009098 | Bacteria | 128277 |
| 64 | Ga0105245_10006484 | 3300009098 | Bacteria | 10289 |
| 65 | Ga0105247_10000109 | 3300009101 | Bacteria | 84490 |
| 66 | Ga0105247_10165372 | 3300009101 | Bacteria | 1467 |
| 67 | Ga0105243_10010968 | 3300009148 | Bacteria | 6852 |
| 68 | Ga0105242_10000403 | 3300009176 | Bacteria | 34337 |
| 69 | Ga0105248_10000126 | 3300009177 | Bacteria | 88461 |
| 70 | Ga0105239_10174388 | 3300010375 | Bacteria | 2405 |
| 71 | Ga0157371_10005438 | 3300013102 | Bacteria | 10739 |
| 72 | Ga0157370_10134257 | 3300013104 | Bacteria | 2307 |
| 73 | Ga0157370_10500434 | 3300013104 | Bacteria | 1116 |
| 74 | Ga0157374_10002637 | 3300013296 | Bacteria | 15115 |
| 75 | Ga0157378_10069359 | 3300013297 | Bacteria | 3162 |
| 76 | Ga0157378_10387780 | 3300013297 | Bacteria | 1373 |
| 77 | Ga0157372_10000128 | 3300013307 | Bacteria | 82571 |
| 78 | Ga0157375_10012890 | 3300013308 | Bacteria | 7426 |
| 79 | Ga0157375_10028209 | 3300013308 | Bacteria | 5258 |
| 80 | Ga0163163_10903922 | 3300014325 | Unclassified | 946 |
| 81 | Ga0163163_11286900 | 3300014325 | Bacteria | 793 |
| 82 | Ga0157380_10000009 | 3300014326 | Bacteria | 142155 |
| 83 | Ga0157379_10006179 | 3300014968 | Bacteria | 10314 |
| 84 | Ga0163161_10000013 | 3300017792 | Bacteria | 258747 |
| 85 | Ga0163161_10044832 | 3300017792 | Bacteria | 3187 |
| 86 | Ga0206353_11105305 | 3300020082 | Bacteria | 1308 |
| 87 | Ga0207656_10000153 | 3300025321 | Bacteria | 25555 |
| 88 | Ga0207682_10000007 | 3300025893 | Bacteria | 88967 |
| 89 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 90 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 91 | Ga0207642_10000004 | 3300025899 | Bacteria | 407822 |
| 92 | Ga0207642_10001353 | 3300025899 | Bacteria | 7604 |
| 93 | Ga0207642_10027165 | 3300025899 | Bacteria | 2340 |
| 94 | Ga0207710_10000408 | 3300025900 | Bacteria | 28571 |
| 95 | Ga0207680_10031797 | 3300025903 | Bacteria | 2993 |
| 96 | Ga0207685_10000003 | 3300025905 | Bacteria | 344527 |
| 97 | Ga0207645_10341518 | 3300025907 | Bacteria | 1001 |
| 98 | Ga0207707_10017668 | 3300025912 | Bacteria | 6220 |
| 99 | Ga0207663_10001276 | 3300025916 | Bacteria | 11682 |
| 100 | Ga0207663_10016849 | 3300025916 | Bacteria | 4062 |
| 101 | Ga0207657_10552562 | 3300025919 | Bacteria | 900 |
| 102 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 103 | Ga0207652_10000138 | 3300025921 | Bacteria | 77564 |
| 104 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 105 | Ga0207659_10000014 | 3300025926 | Bacteria | 168481 |
| 106 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 107 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 108 | Ga0207687_10007446 | 3300025927 | Bacteria | 7206 |
| 109 | Ga0207700_10000016 | 3300025928 | Bacteria | 202434 |
| 110 | Ga0207700_10018327 | 3300025928 | Bacteria | 4701 |
| 111 | Ga0207664_10215027 | 3300025929 | Bacteria | 1665 |
| 112 | Ga0207690_10218534 | 3300025932 | Bacteria | 1457 |
| 113 | Ga0207706_10000302 | 3300025933 | Bacteria | 53541 |
| 114 | Ga0207686_10000029 | 3300025934 | Bacteria | 160239 |
| 115 | Ga0207709_10005552 | 3300025935 | Bacteria | 7145 |
| 116 | Ga0207669_10000002 | 3300025937 | Bacteria | 377651 |
| 117 | Ga0207669_10000041 | 3300025937 | Bacteria | 67085 |
| 118 | Ga0207669_10254308 | 3300025937 | Bacteria | 1310 |
| 119 | Ga0207704_10000009 | 3300025938 | Bacteria | 198266 |
| 120 | Ga0207691_10000121 | 3300025940 | Bacteria | 70558 |
| 121 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 122 | Ga0207689_10121426 | 3300025942 | Bacteria | 2149 |
| 123 | Ga0207661_10000068 | 3300025944 | Bacteria | 70953 |
| 124 | Ga0207661_10205137 | 3300025944 | Bacteria | 1735 |
| 125 | Ga0207679_10302132 | 3300025945 | Bacteria | 1380 |
| 126 | Ga0207679_10408755 | 3300025945 | Bacteria | 1195 |
| 127 | Ga0207651_10016005 | 3300025960 | Bacteria | 4377 |
| 128 | Ga0207668_10236589 | 3300025972 | Bacteria | 1475 |
| 129 | Ga0207640_10000517 | 3300025981 | Bacteria | 23263 |
| 130 | Ga0207640_10013610 | 3300025981 | Bacteria | 4667 |
| 131 | Ga0207658_10000708 | 3300025986 | Bacteria | 28881 |
| 132 | Ga0207658_10076798 | 3300025986 | Bacteria | 2546 |
| 133 | Ga0207677_10003398 | 3300026023 | Bacteria | 8432 |
| 134 | Ga0207703_10000381 | 3300026035 | Bacteria | 47426 |
| 135 | Ga0207703_10000451 | 3300026035 | Bacteria | 43264 |
| 136 | Ga0207702_10468408 | 3300026078 | Bacteria | 1225 |
| 137 | Ga0207641_10000065 | 3300026088 | Bacteria | 156066 |
| 138 | Ga0207641_10001058 | 3300026088 | Bacteria | 27805 |
| 139 | Ga0207676_10000026 | 3300026095 | Bacteria | 248593 |
| 140 | Ga0207675_100296687 | 3300026118 | Unclassified | 1573 |
| 141 | Ga0207683_10031792 | 3300026121 | Bacteria | 4582 |
| 142 | Ga0207698_10000009 | 3300026142 | Bacteria | 281300 |
| 143 | Ga0207698_10044802 | 3300026142 | Bacteria | 3328 |
| 144 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 145 | Ga0268266_10007702 | 3300028379 | Bacteria | 9668 |
| 146 | Ga0268266_10159222 | 3300028379 | Bacteria | 2041 |
| 147 | Ga0268266_10241215 | 3300028379 | Bacteria | 1668 |
| 148 | Ga0268266_10336791 | 3300028379 | Bacteria | 1415 |
| 149 | Ga0268265_10009717 | 3300028380 | Bacteria | 6492 |
| 150 | Ga0268264_10151114 | 3300028381 | Bacteria | 2082 |
| 151 | Ga0265319_1000091 | 3300028563 | Bacteria | 70394 |
| 152 | Ga0265338_10000752 | 3300028800 | Bacteria | 55238 |
| 153 | Ga0307511_10052559 | 3300030521 | Bacteria | 3245 |
| 154 | Ga0265325_10003985 | 3300031241 | Bacteria | 9448 |
| 155 | Ga0395905_0175703 | 3300037471 | Bacteria | 2011 |
| 156 | Ga0451853_2634544 | 3300041512 | Bacteria | 8367 |
| 157 | Ga0466963_0000025 | 3300044694 | Bacteria | 51171 |
| 158 | Ga0466957_0000824 | 3300044842 | Bacteria | 15816 |
| 159 | Ga0466967_0000005 | 3300045976 | Bacteria | 149543 |
| 160 | Ga0466967_0003204 | 3300045976 | Bacteria | 10566 |
| 161 | Ga0466967_0820697 | 3300045976 | Bacteria | 924 |
| 162 | Ga0466967_0865303 | 3300045976 | Unclassified | 898 |
| 163 | Ga0495603_0000054 | 3300046455 | Bacteria | 49027 |
| 164 | Ga0495603_0001846 | 3300046455 | Bacteria | 12499 |
| 165 | Ga0495603_0007298 | 3300046455 | Bacteria | 6644 |
| 166 | Ga0495603_0524563 | 3300046455 | Bacteria | 678 |
| 167 | Ga0495629_0003197 | 3300046459 | Bacteria | 12400 |
| 168 | Ga0495629_0052741 | 3300046459 | Bacteria | 2846 |
| 169 | Ga0495629_0064004 | 3300046459 | Bacteria | 2568 |
| 170 | Ga0495638_0012893 | 3300046460 | Bacteria | 5711 |
| 171 | Ga0495641_0000095 | 3300046461 | Bacteria | 60441 |
| 172 | Ga0495641_0020525 | 3300046461 | Bacteria | 3347 |
| 173 | Ga0495653_0102892 | 3300046463 | Bacteria | 2066 |
| 174 | Ga0495662_0006826 | 3300046476 | Bacteria | 5680 |
| 175 | Ga0495594_0000191 | 3300046499 | Bacteria | 29900 |
| 176 | Ga0495608_0000010 | 3300046511 | Bacteria | 258660 |
| 177 | Ga0495608_0008709 | 3300046511 | Bacteria | 7098 |
| 178 | Ga0495618_0000097 | 3300046514 | Bacteria | 63474 |
| 179 | Ga0495620_0000158 | 3300046515 | Bacteria | 54704 |
| 180 | Ga0495628_0000048 | 3300046516 | Bacteria | 96944 |
| 181 | Ga0495628_0003972 | 3300046516 | Bacteria | 13174 |
| 182 | Ga0495628_0010115 | 3300046516 | Bacteria | 8022 |
| 183 | Ga0495628_0020905 | 3300046516 | Bacteria | 5391 |
| 184 | Ga0495630_0000082 | 3300046517 | Bacteria | 75280 |
| 185 | Ga0495630_0001301 | 3300046517 | Bacteria | 17211 |
| 186 | Ga0495652_0028279 | 3300046529 | Bacteria | 4935 |
| 187 | Ga0495640_0052758 | 3300046533 | Bacteria | 2790 |
| 188 | Ga0495586_0000234 | 3300046535 | Bacteria | 36813 |
| 189 | Ga0495587_0012904 | 3300046536 | Bacteria | 5254 |
| 190 | Ga0495587_0333272 | 3300046536 | Bacteria | 847 |
| 191 | Ga0495645_0451629 | 3300046543 | Unclassified | 810 |
| 192 | Ga0495622_0000925 | 3300046557 | Bacteria | 15862 |
| 193 | Ga0495656_0014301 | 3300046615 | Bacteria | 2973 |
| 194 | Ga0495634_0000616 | 3300046642 | Bacteria | 34537 |
| 195 | Ga0495634_0095273 | 3300046642 | Bacteria | 1928 |
| 196 | Ga0495634_0449748 | 3300046642 | Bacteria | 760 |
| 197 | Ga0495634_0459267 | 3300046642 | Bacteria | 750 |
| 198 | Ga0495625_0008361 | 3300046660 | Bacteria | 8835 |
| 199 | Ga0495635_0000006 | 3300046663 | Bacteria | 301820 |
| 200 | Ga0495635_0041536 | 3300046663 | Bacteria | 3176 |
| 201 | Ga0495635_0231815 | 3300046663 | Bacteria | 1247 |
| 202 | Ga0495588_0000218 | 3300046674 | Bacteria | 54328 |
| 203 | Ga0495657_0000005 | 3300046675 | Bacteria | 254860 |
| 204 | Ga0495657_0002455 | 3300046675 | Bacteria | 15608 |
| 205 | Ga0495599_0017432 | 3300046678 | Bacteria | 4465 |
| 206 | Ga0495623_0108932 | 3300046679 | Bacteria | 1681 |
| 207 | Ga0495646_0360654 | 3300046680 | Bacteria | 760 |
| 208 | Ga0495647_0000010 | 3300046681 | Bacteria | 94696 |
| 209 | Ga0495658_0002078 | 3300046683 | Bacteria | 10151 |
| 210 | Ga0495669_0018458 | 3300046684 | Bacteria | 3000 |
| 211 | Ga0495613_0000092 | 3300046689 | Bacteria | 86976 |
| 212 | Ga0495613_0000131 | 3300046689 | Bacteria | 74262 |
| 213 | Ga0495613_0053942 | 3300046689 | Bacteria | 2956 |
| 214 | Ga0495624_0000049 | 3300046690 | Bacteria | 75485 |
| 215 | Ga0495624_0029189 | 3300046690 | Bacteria | 3600 |
| 216 | Ga0495600_0014478 | 3300046809 | Bacteria | 4970 |
| 217 | Ga0495600_0046715 | 3300046809 | Bacteria | 2824 |
| 218 | Ga0495660_0118693 | 3300046810 | Bacteria | 1341 |
| 219 | Ga0495604_0000078 | 3300047317 | Bacteria | 83632 |
| 220 | Ga0495604_0103907 | 3300047317 | Bacteria | 2083 |
| 221 | Ga0495674_0000063 | 3300047319 | Bacteria | 71737 |
| 222 | Ga0495674_0735500 | 3300047319 | Bacteria | 772 |
| 223 | Ga0495672_0025960 | 3300047320 | Bacteria | 3744 |
| 224 | Ga0495676_0003442 | 3300047321 | Bacteria | 14318 |
| 225 | Ga0495676_0005287 | 3300047321 | Bacteria | 11819 |
| 226 | Ga0495680_0000050 | 3300047322 | Bacteria | 95945 |
| 227 | Ga0495680_0000873 | 3300047322 | Bacteria | 33510 |
| 228 | Ga0495680_0043519 | 3300047322 | Bacteria | 3555 |
| 229 | Ga0495680_0178076 | 3300047322 | Bacteria | 1536 |
| 230 | Ga0495675_0000004 | 3300047444 | Bacteria | 211049 |
| 231 | Ga0495684_0356484 | 3300047471 | Bacteria | 1037 |
| 232 | Ga0495602_0000009 | 3300048088 | Bacteria | 258991 |
| 233 | Ga0495602_0002886 | 3300048088 | Bacteria | 17610 |
| 234 | Ga0495602_0237585 | 3300048088 | Bacteria | 1365 |
| 235 | Ga0496100_0000004 | 3300048903 | Bacteria | 321778 |
| 236 | Ga0496100_0000032 | 3300048903 | Bacteria | 99877 |
| 237 | Ga0496101_0000007 | 3300048904 | Bacteria | 321778 |
| 238 | Ga0496101_0000012 | 3300048904 | Bacteria | 268127 |
| 239 | Ga0496102_0000132 | 3300048905 | Bacteria | 103176 |
| 240 | Ga0496103_0000077 | 3300048906 | Bacteria | 112223 |
| 241 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 242 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 243 | Ga0496104_0001440 | 3300048907 | Bacteria | 20567 |
| 244 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 245 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 246 | Ga0496105_0000095 | 3300048908 | Bacteria | 60866 |
| 247 | Ga0496106_0000004 | 3300048909 | Bacteria | 279896 |
| 248 | Ga0496106_0000092 | 3300048909 | Bacteria | 70312 |
| 249 | Ga0496106_0186291 | 3300048909 | Bacteria | 1649 |
| 250 | Ga0496107_0000001 | 3300048910 | Bacteria | 321778 |
| 251 | Ga0496107_0000031 | 3300048910 | Bacteria | 100522 |
| 252 | Ga0496107_0728640 | 3300048910 | Bacteria | 728 |
| 253 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 254 | Ga0496108_0000012 | 3300048911 | Bacteria | 258433 |
| 255 | Ga0496108_0000202 | 3300048911 | Bacteria | 55115 |
| 256 | Ga0496108_0014041 | 3300048911 | Bacteria | 6535 |
| 257 | Ga0496108_0038460 | 3300048911 | Bacteria | 3986 |
| 258 | Ga0496108_0215423 | 3300048911 | Bacteria | 1668 |
| 259 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 260 | Ga0496109_0000076 | 3300048912 | Bacteria | 104273 |
| 261 | Ga0496109_0000106 | 3300048912 | Bacteria | 86550 |
| 262 | Ga0496109_0000131 | 3300048912 | Bacteria | 76860 |
| 263 | Ga0496109_0198724 | 3300048912 | Bacteria | 1885 |
| 264 | Ga0496109_0826353 | 3300048912 | Bacteria | 864 |
| 265 | Ga0496110_0000015 | 3300048913 | Bacteria | 85373 |
| 266 | Ga0496110_0022911 | 3300048913 | Bacteria | 5307 |
| 267 | Ga0496110_0062404 | 3300048913 | Bacteria | 3291 |
| 268 | Ga0496111_0000001 | 3300048914 | Bacteria | 194837 |
| 269 | Ga0496111_0056033 | 3300048914 | Bacteria | 2851 |
| 270 | Ga0496111_0275570 | 3300048914 | Bacteria | 1248 |
| 271 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 272 | Ga0496113_0000033 | 3300048916 | Bacteria | 59422 |
| 273 | Ga0496113_0022010 | 3300048916 | Bacteria | 4503 |
| 274 | Ga0496113_0046466 | 3300048916 | Bacteria | 3223 |
| 275 | Ga0496113_0099138 | 3300048916 | Bacteria | 2256 |
| 276 | Ga0496113_0763730 | 3300048916 | Bacteria | 769 |
| 277 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 278 | Ga0496114_0014570 | 3300048917 | Bacteria | 6316 |
| 279 | Ga0496115_0000071 | 3300048918 | Bacteria | 91922 |
| 280 | Ga0496115_0000183 | 3300048918 | Bacteria | 58406 |
| 281 | Ga0496119_0029259 | 3300048922 | Bacteria | 3741 |
| 282 | Ga0496120_0043668 | 3300048923 | Bacteria | 2610 |
| 283 | Ga0496125_0253851 | 3300048928 | Bacteria | 1107 |
| 284 | Ga0501032_0160092 | 3300049569 | Bacteria | 1478 |
| 285 | Ga0501034_1051406 | 3300049571 | Bacteria | 696 |
| 286 | Ga0501039_0379311 | 3300049575 | Bacteria | 1111 |
| 287 | Ga0501042_0494451 | 3300049578 | Bacteria | 888 |
| 288 | Ga0501047_1088773 | 3300049581 | Bacteria | 612 |
| 289 | Ga0501070_0152234 | 3300049586 | Bacteria | 1908 |
| 290 | Ga0501070_0869435 | 3300049586 | Bacteria | 704 |
| 291 | Ga0501071_0059899 | 3300049587 | Bacteria | 2755 |
| 292 | Ga0501074_0040894 | 3300049590 | Bacteria | 3356 |
| 293 | Ga0501075_0416260 | 3300049591 | Bacteria | 1025 |
| 294 | Ga0501079_0048913 | 3300049741 | Bacteria | 3263 |
| 295 | Ga0501079_0567293 | 3300049741 | Bacteria | 893 |
| 296 | Ga0501080_1100264 | 3300049742 | Bacteria | 686 |
| 297 | Ga0501044_0016664 | 3300049823 | Bacteria | 7891 |
| 298 | Ga0501044_1217145 | 3300049823 | Bacteria | 621 |
| 299 | nmdc:mga0rr50_315885_c1 | 3300050513 | Bacteria | 1309 |
| 300 | nmdc:mga0a205_1_c2 | 3300050515 | Bacteria | 266330 |
| 301 | Ga0495601_0000042 | 3300053077 | Bacteria | 77373 |
| 302 | Ga0495601_0000296 | 3300053077 | Bacteria | 26491 |
| 303 | Ga0495601_0011291 | 3300053077 | Bacteria | 5338 |
| 304 | Ga0495601_0057755 | 3300053077 | Bacteria | 2458 |
| 305 | Ga0495612_0008495 | 3300053078 | Bacteria | 4163 |
| 306 | Ga0495612_0014769 | 3300053078 | Bacteria | 3134 |
| 307 | Ga0495655_0000009 | 3300053083 | Bacteria | 150662 |
| 308 | Ga0495655_0000485 | 3300053083 | Bacteria | 6632 |
| 309 | Ga0495595_0000005 | 3300053084 | Bacteria | 258660 |
| 310 | Ga0495595_0000362 | 3300053084 | Bacteria | 17220 |
| 311 | Ga0495619_0000040 | 3300053085 | Bacteria | 118238 |
| 312 | Ga0495619_0000126 | 3300053085 | Bacteria | 56169 |
| 313 | Ga0495619_0000896 | 3300053085 | Bacteria | 19523 |
| 314 | Ga0495619_0002266 | 3300053085 | Bacteria | 12712 |
| 315 | Ga0495619_0007234 | 3300053085 | Bacteria | 7032 |
| 316 | Ga0495619_0206342 | 3300053085 | Bacteria | 1360 |
| 317 | Ga0500614_003173 | 3300053123 | Bacteria | 3567 |
| 318 | Ga0500628_000078 | 3300053129 | Bacteria | 24490 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025934 | Ga0207686_10000029 | Ga0207686_1000002911 | 169 |
| 2 | 3300046679 | Ga0495623_0108932 | Ga0495623_0108932_861_1370 | 169 |
| 3 | 3300047317 | Ga0495604_0103907 | Ga0495604_0103907_1075_1656 | 173 |
| 4 | 3300026078 | Ga0207702_10468408 | Ga0207702_104684082 | 174 |
| 5 | 3300005614 | Ga0068856_100585567 | Ga0068856_1005855672 | 175 |
| 6 | 3300005444 | Ga0070694_100618030 | Ga0070694_1006180301 | 177 |
| 7 | 3300028563 | Ga0265319_1000091 | Ga0265319_100009136 | 177 |
| 8 | 3300028800 | Ga0265338_10000752 | Ga0265338_1000075236 | 177 |
| 9 | 3300031241 | Ga0265325_10003985 | Ga0265325_100039859 | 177 |
| 10 | 3300047322 | Ga0495680_0043519 | Ga0495680_0043519_1038_1571 | 177 |
| 11 | 3300049581 | Ga0501047_1088773 | Ga0501047_1088773_34_573 | 177 |
| 12 | 3300049823 | Ga0501044_1217145 | Ga0501044_1217145_48_587 | 177 |
| 13 | 3300045976 | Ga0466967_0820697 | Ga0466967_0820697_217_807 | 179 |
| 14 | 3300048913 | Ga0496110_0062404 | Ga0496110_0062404_140_727 | 182 |
| 15 | 3300048914 | Ga0496111_0056033 | Ga0496111_0056033_140_727 | 182 |
| 16 | 3300048916 | Ga0496113_0763730 | Ga0496113_0763730_56_643 | 182 |
| 17 | 3300046514 | Ga0495618_0000097 | Ga0495618_0000097_29504_30088 | 183 |
| 18 | 3300046459 | Ga0495629_0003197 | Ga0495629_0003197_47_628 | 184 |
| 19 | 3300005718 | Ga0068866_10001565 | Ga0068866_1000156511 | 185 |
| 20 | 3300005841 | Ga0068863_100027154 | Ga0068863_1000271547 | 185 |
| 21 | 3300009176 | Ga0105242_10000403 | Ga0105242_1000040330 | 185 |
| 22 | 3300025899 | Ga0207642_10027165 | Ga0207642_100271654 | 185 |
| 23 | 3300026088 | Ga0207641_10001058 | Ga0207641_100010588 | 185 |
| 24 | 3300006852 | Ga0075433_10000032 | Ga0075433_1000003231 | 186 |
| 25 | 3300026118 | Ga0207675_100296687 | Ga0207675_1002966872 | 186 |
| 26 | 3300053077 | Ga0495601_0000042 | Ga0495601_0000042_22607_23194 | 186 |
| 27 | 3300005616 | Ga0068852_100065559 | Ga0068852_1000655592 | 187 |
| 28 | 3300026142 | Ga0207698_10044802 | Ga0207698_100448022 | 187 |
| 29 | 3300048905 | Ga0496102_0000132 | Ga0496102_0000132_61080_61694 | 187 |
| 30 | 3300048906 | Ga0496103_0000077 | Ga0496103_0000077_41471_42085 | 187 |
| 31 | 3300053083 | Ga0495655_0000009 | Ga0495655_0000009_18587_19168 | 187 |
| 32 | 3300053129 | Ga0500628_000078 | Ga0500628_000078_19891_20472 | 187 |
| 33 | 3300037471 | Ga0395905_0175703 | Ga0395905_0175703_755_1351 | 188 |
| 34 | 3300045976 | Ga0466967_0865303 | Ga0466967_0865303_32_613 | 191 |
| 35 | 3300005341 | Ga0070691_10008978 | Ga0070691_100089783 | 192 |
| 36 | 3300005439 | Ga0070711_100031957 | Ga0070711_1000319574 | 192 |
| 37 | 3300005544 | Ga0070686_100066762 | Ga0070686_1000667622 | 192 |
| 38 | 3300005618 | Ga0068864_100000201 | Ga0068864_10000020132 | 192 |
| 39 | 3300005842 | Ga0068858_100000178 | Ga0068858_10000017833 | 192 |
| 40 | 3300013104 | Ga0157370_10500434 | Ga0157370_105004341 | 192 |
| 41 | 3300025916 | Ga0207663_10016849 | Ga0207663_100168492 | 192 |
| 42 | 3300025942 | Ga0207689_10121426 | Ga0207689_101214263 | 192 |
| 43 | 3300026035 | Ga0207703_10000381 | Ga0207703_1000038132 | 192 |
| 44 | 3300026095 | Ga0207676_10000026 | Ga0207676_10000026210 | 192 |
| 45 | 3300030521 | Ga0307511_10052559 | Ga0307511_100525592 | 192 |
| 46 | 3300046455 | Ga0495603_0000054 | Ga0495603_0000054_6764_7348 | 192 |
| 47 | 3300046455 | Ga0495603_0001846 | Ga0495603_0001846_9195_9779 | 192 |
| 48 | 3300046511 | Ga0495608_0008709 | Ga0495608_0008709_6498_7076 | 192 |
| 49 | 3300046516 | Ga0495628_0020905 | Ga0495628_0020905_1606_2184 | 192 |
| 50 | 3300046615 | Ga0495656_0014301 | Ga0495656_0014301_326_910 | 192 |
| 51 | 3300046689 | Ga0495613_0053942 | Ga0495613_0053942_21_605 | 192 |
| 52 | 3300048911 | Ga0496108_0000202 | Ga0496108_0000202_28793_29389 | 192 |
| 53 | 3300048912 | Ga0496109_0000131 | Ga0496109_0000131_57013_57609 | 192 |
| 54 | 3300050515 | nmdc:mga0a205_1_c2 | nmdc:mga0a205_1_c2_82461_83045 | 192 |
| 55 | 3300001979 | JGI24740J21852_10031430 | JGI24740J21852_100314302 | 193 |
| 56 | 3300005333 | Ga0070677_10000007 | Ga0070677_1000000733 | 193 |
| 57 | 3300005335 | Ga0070666_10026471 | Ga0070666_100264711 | 193 |
| 58 | 3300005337 | Ga0070682_100000038 | Ga0070682_100000038120 | 193 |
| 59 | 3300005337 | Ga0070682_100296811 | Ga0070682_1002968112 | 193 |
| 60 | 3300005339 | Ga0070660_100626838 | Ga0070660_1006268381 | 193 |
| 61 | 3300005341 | Ga0070691_10000839 | Ga0070691_100008398 | 193 |
| 62 | 3300005344 | Ga0070661_100002486 | Ga0070661_1000024864 | 193 |
| 63 | 3300005347 | Ga0070668_100125384 | Ga0070668_1001253841 | 193 |
| 64 | 3300005354 | Ga0070675_100000008 | Ga0070675_100000008155 | 193 |
| 65 | 3300005356 | Ga0070674_100000001 | Ga0070674_10000000174 | 193 |
| 66 | 3300005356 | Ga0070674_100000026 | Ga0070674_10000002677 | 193 |
| 67 | 3300005364 | Ga0070673_100031221 | Ga0070673_1000312215 | 193 |
| 68 | 3300005365 | Ga0070688_100000364 | Ga0070688_1000003644 | 193 |
| 69 | 3300005365 | Ga0070688_100461259 | Ga0070688_1004612591 | 193 |
| 70 | 3300005366 | Ga0070659_100297631 | Ga0070659_1002976311 | 193 |
| 71 | 3300005367 | Ga0070667_100001965 | Ga0070667_10000196510 | 193 |
| 72 | 3300005434 | Ga0070709_10411066 | Ga0070709_104110662 | 193 |
| 73 | 3300005436 | Ga0070713_100000061 | Ga0070713_10000006126 | 193 |
| 74 | 3300005436 | Ga0070713_100010682 | Ga0070713_1000106826 | 193 |
| 75 | 3300005439 | Ga0070711_100001471 | Ga0070711_1000014719 | 193 |
| 76 | 3300005456 | Ga0070678_100021943 | Ga0070678_1000219432 | 193 |
| 77 | 3300005466 | Ga0070685_10006756 | Ga0070685_100067564 | 193 |
| 78 | 3300005535 | Ga0070684_100016415 | Ga0070684_1000164156 | 193 |
| 79 | 3300005535 | Ga0070684_100084289 | Ga0070684_1000842892 | 193 |
| 80 | 3300005545 | Ga0070695_100161064 | Ga0070695_1001610642 | 193 |
| 81 | 3300005548 | Ga0070665_100000306 | Ga0070665_10000030647 | 193 |
| 82 | 3300005548 | Ga0070665_100010906 | Ga0070665_1000109067 | 193 |
| 83 | 3300005548 | Ga0070665_100118587 | Ga0070665_1001185872 | 193 |
| 84 | 3300005548 | Ga0070665_100200959 | Ga0070665_1002009592 | 193 |
| 85 | 3300005548 | Ga0070665_100388709 | Ga0070665_1003887091 | 193 |
| 86 | 3300005564 | Ga0070664_100020110 | Ga0070664_1000201104 | 193 |
| 87 | 3300005564 | Ga0070664_100357325 | Ga0070664_1003573252 | 193 |
| 88 | 3300005578 | Ga0068854_100000044 | Ga0068854_10000004430 | 193 |
| 89 | 3300005578 | Ga0068854_100033059 | Ga0068854_1000330592 | 193 |
| 90 | 3300005616 | Ga0068852_100000050 | Ga0068852_10000005073 | 193 |
| 91 | 3300005718 | Ga0068866_10000006 | Ga0068866_10000006130 | 193 |
| 92 | 3300005718 | Ga0068866_10000055 | Ga0068866_100000554 | 193 |
| 93 | 3300005840 | Ga0068870_10087812 | Ga0068870_100878122 | 193 |
| 94 | 3300005842 | Ga0068858_100000454 | Ga0068858_1000004547 | 193 |
| 95 | 3300005843 | Ga0068860_100152131 | Ga0068860_1001521312 | 193 |
| 96 | 3300005844 | Ga0068862_100002610 | Ga0068862_10000261012 | 193 |
| 97 | 3300005937 | Ga0081455_10006555 | Ga0081455_100065552 | 193 |
| 98 | 3300005983 | Ga0081540_1000044 | Ga0081540_1000044107 | 193 |
| 99 | 3300005985 | Ga0081539_10079134 | Ga0081539_100791342 | 193 |
| 100 | 3300006163 | Ga0070715_10000003 | Ga0070715_10000003186 | 193 |
| 101 | 3300006846 | Ga0075430_100038742 | Ga0075430_1000387422 | 193 |
| 102 | 3300006881 | Ga0068865_100000019 | Ga0068865_10000001911 | 193 |
| 103 | 3300007076 | Ga0075435_100131203 | Ga0075435_1001312031 | 193 |
| 104 | 3300007076 | Ga0075435_100358140 | Ga0075435_1003581402 | 193 |
| 105 | 3300009098 | Ga0105245_10000012 | Ga0105245_10000012103 | 193 |
| 106 | 3300009098 | Ga0105245_10000049 | Ga0105245_10000049122 | 193 |
| 107 | 3300009098 | Ga0105245_10006484 | Ga0105245_100064842 | 193 |
| 108 | 3300009101 | Ga0105247_10000109 | Ga0105247_1000010914 | 193 |
| 109 | 3300009101 | Ga0105247_10165372 | Ga0105247_101653722 | 193 |
| 110 | 3300009148 | Ga0105243_10010968 | Ga0105243_100109686 | 193 |
| 111 | 3300009177 | Ga0105248_10000126 | Ga0105248_100001263 | 193 |
| 112 | 3300010375 | Ga0105239_10174388 | Ga0105239_101743884 | 193 |
| 113 | 3300013102 | Ga0157371_10005438 | Ga0157371_100054389 | 193 |
| 114 | 3300013104 | Ga0157370_10134257 | Ga0157370_101342572 | 193 |
| 115 | 3300013296 | Ga0157374_10002637 | Ga0157374_100026377 | 193 |
| 116 | 3300013297 | Ga0157378_10069359 | Ga0157378_100693592 | 193 |
| 117 | 3300013297 | Ga0157378_10387780 | Ga0157378_103877802 | 193 |
| 118 | 3300013307 | Ga0157372_10000128 | Ga0157372_100001283 | 193 |
| 119 | 3300013308 | Ga0157375_10012890 | Ga0157375_100128901 | 193 |
| 120 | 3300013308 | Ga0157375_10028209 | Ga0157375_100282093 | 193 |
| 121 | 3300014325 | Ga0163163_10903922 | Ga0163163_109039221 | 193 |
| 122 | 3300014325 | Ga0163163_11286900 | Ga0163163_112869001 | 193 |
| 123 | 3300014326 | Ga0157380_10000009 | Ga0157380_1000000987 | 193 |
| 124 | 3300014968 | Ga0157379_10006179 | Ga0157379_100061792 | 193 |
| 125 | 3300017792 | Ga0163161_10000013 | Ga0163161_10000013250 | 193 |
| 126 | 3300017792 | Ga0163161_10044832 | Ga0163161_100448323 | 193 |
| 127 | 3300020082 | Ga0206353_11105305 | Ga0206353_111053052 | 193 |
| 128 | 3300025321 | Ga0207656_10000153 | Ga0207656_1000015316 | 193 |
| 129 | 3300025893 | Ga0207682_10000007 | Ga0207682_1000000741 | 193 |
| 130 | 3300025899 | Ga0207642_10000001 | Ga0207642_1000000179 | 193 |
| 131 | 3300025899 | Ga0207642_10000003 | Ga0207642_1000000379 | 193 |
| 132 | 3300025899 | Ga0207642_10000004 | Ga0207642_1000000479 | 193 |
| 133 | 3300025899 | Ga0207642_10001353 | Ga0207642_100013534 | 193 |
| 134 | 3300025900 | Ga0207710_10000408 | Ga0207710_100004087 | 193 |
| 135 | 3300025903 | Ga0207680_10031797 | Ga0207680_100317971 | 193 |
| 136 | 3300025905 | Ga0207685_10000003 | Ga0207685_10000003184 | 193 |
| 137 | 3300025907 | Ga0207645_10341518 | Ga0207645_103415182 | 193 |
| 138 | 3300025912 | Ga0207707_10017668 | Ga0207707_100176682 | 193 |
| 139 | 3300025916 | Ga0207663_10001276 | Ga0207663_100012765 | 193 |
| 140 | 3300025919 | Ga0207657_10552562 | Ga0207657_105525621 | 193 |
| 141 | 3300025920 | Ga0207649_10000005 | Ga0207649_1000000572 | 193 |
| 142 | 3300025921 | Ga0207652_10000138 | Ga0207652_1000013840 | 193 |
| 143 | 3300025924 | Ga0207694_10000008 | Ga0207694_10000008119 | 193 |
| 144 | 3300025926 | Ga0207659_10000014 | Ga0207659_10000014160 | 193 |
| 145 | 3300025927 | Ga0207687_10000011 | Ga0207687_10000011156 | 193 |
| 146 | 3300025927 | Ga0207687_10000012 | Ga0207687_10000012370 | 193 |
| 147 | 3300025927 | Ga0207687_10007446 | Ga0207687_100074468 | 193 |
| 148 | 3300025928 | Ga0207700_10000016 | Ga0207700_10000016102 | 193 |
| 149 | 3300025928 | Ga0207700_10018327 | Ga0207700_100183272 | 193 |
| 150 | 3300025929 | Ga0207664_10215027 | Ga0207664_102150272 | 193 |
| 151 | 3300025932 | Ga0207690_10218534 | Ga0207690_102185342 | 193 |
| 152 | 3300025933 | Ga0207706_10000302 | Ga0207706_1000030234 | 193 |
| 153 | 3300025935 | Ga0207709_10005552 | Ga0207709_100055523 | 193 |
| 154 | 3300025937 | Ga0207669_10000002 | Ga0207669_10000002275 | 193 |
| 155 | 3300025937 | Ga0207669_10000041 | Ga0207669_100000418 | 193 |
| 156 | 3300025937 | Ga0207669_10254308 | Ga0207669_102543082 | 193 |
| 157 | 3300025938 | Ga0207704_10000009 | Ga0207704_1000000978 | 193 |
| 158 | 3300025940 | Ga0207691_10000121 | Ga0207691_1000012143 | 193 |
| 159 | 3300025941 | Ga0207711_10000024 | Ga0207711_10000024115 | 193 |
| 160 | 3300025944 | Ga0207661_10000068 | Ga0207661_1000006852 | 193 |
| 161 | 3300025944 | Ga0207661_10205137 | Ga0207661_102051372 | 193 |
| 162 | 3300025945 | Ga0207679_10302132 | Ga0207679_103021322 | 193 |
| 163 | 3300025945 | Ga0207679_10408755 | Ga0207679_104087551 | 193 |
| 164 | 3300025960 | Ga0207651_10016005 | Ga0207651_100160056 | 193 |
| 165 | 3300025972 | Ga0207668_10236589 | Ga0207668_102365891 | 193 |
| 166 | 3300025981 | Ga0207640_10000517 | Ga0207640_1000051710 | 193 |
| 167 | 3300025981 | Ga0207640_10013610 | Ga0207640_100136104 | 193 |
| 168 | 3300025986 | Ga0207658_10000708 | Ga0207658_1000070826 | 193 |
| 169 | 3300025986 | Ga0207658_10076798 | Ga0207658_100767981 | 193 |
| 170 | 3300026023 | Ga0207677_10003398 | Ga0207677_100033982 | 193 |
| 171 | 3300026035 | Ga0207703_10000451 | Ga0207703_100004517 | 193 |
| 172 | 3300026088 | Ga0207641_10000065 | Ga0207641_1000006523 | 193 |
| 173 | 3300026121 | Ga0207683_10031792 | Ga0207683_100317922 | 193 |
| 174 | 3300026142 | Ga0207698_10000009 | Ga0207698_1000000954 | 193 |
| 175 | 3300028379 | Ga0268266_10000023 | Ga0268266_1000002328 | 193 |
| 176 | 3300028379 | Ga0268266_10007702 | Ga0268266_100077027 | 193 |
| 177 | 3300028379 | Ga0268266_10159222 | Ga0268266_101592222 | 193 |
| 178 | 3300028379 | Ga0268266_10241215 | Ga0268266_102412152 | 193 |
| 179 | 3300028379 | Ga0268266_10336791 | Ga0268266_103367912 | 193 |
| 180 | 3300028380 | Ga0268265_10009717 | Ga0268265_100097174 | 193 |
| 181 | 3300028381 | Ga0268264_10151114 | Ga0268264_101511142 | 193 |
| 182 | 3300041512 | Ga0451853_2634544 | Ga0451853_2634544_5548_6132 | 193 |
| 183 | 3300044694 | Ga0466963_0000025 | Ga0466963_0000025_10277_10861 | 193 |
| 184 | 3300044842 | Ga0466957_0000824 | Ga0466957_0000824_4002_4589 | 193 |
| 185 | 3300045976 | Ga0466967_0000005 | Ga0466967_0000005_139962_140552 | 193 |
| 186 | 3300045976 | Ga0466967_0003204 | Ga0466967_0003204_2845_3432 | 193 |
| 187 | 3300046455 | Ga0495603_0007298 | Ga0495603_0007298_6027_6611 | 193 |
| 188 | 3300046455 | Ga0495603_0524563 | Ga0495603_0524563_76_660 | 193 |
| 189 | 3300046459 | Ga0495629_0052741 | Ga0495629_0052741_95_688 | 193 |
| 190 | 3300046459 | Ga0495629_0064004 | Ga0495629_0064004_1163_1750 | 193 |
| 191 | 3300046460 | Ga0495638_0012893 | Ga0495638_0012893_3255_3842 | 193 |
| 192 | 3300046461 | Ga0495641_0000095 | Ga0495641_0000095_39814_40410 | 193 |
| 193 | 3300046461 | Ga0495641_0020525 | Ga0495641_0020525_2158_2757 | 193 |
| 194 | 3300046463 | Ga0495653_0102892 | Ga0495653_0102892_1401_1985 | 193 |
| 195 | 3300046476 | Ga0495662_0006826 | Ga0495662_0006826_4206_4793 | 193 |
| 196 | 3300046499 | Ga0495594_0000191 | Ga0495594_0000191_15004_15591 | 193 |
| 197 | 3300046511 | Ga0495608_0000010 | Ga0495608_0000010_34968_35555 | 193 |
| 198 | 3300046515 | Ga0495620_0000158 | Ga0495620_0000158_29849_30430 | 193 |
| 199 | 3300046516 | Ga0495628_0000048 | Ga0495628_0000048_74589_75176 | 193 |
| 200 | 3300046516 | Ga0495628_0003972 | Ga0495628_0003972_9338_9922 | 193 |
| 201 | 3300046516 | Ga0495628_0010115 | Ga0495628_0010115_2855_3436 | 193 |
| 202 | 3300046517 | Ga0495630_0000082 | Ga0495630_0000082_54675_55280 | 193 |
| 203 | 3300046517 | Ga0495630_0001301 | Ga0495630_0001301_13373_13957 | 193 |
| 204 | 3300046529 | Ga0495652_0028279 | Ga0495652_0028279_1155_1748 | 193 |
| 205 | 3300046533 | Ga0495640_0052758 | Ga0495640_0052758_2071_2658 | 193 |
| 206 | 3300046535 | Ga0495586_0000234 | Ga0495586_0000234_10168_10749 | 193 |
| 207 | 3300046536 | Ga0495587_0012904 | Ga0495587_0012904_2497_3081 | 193 |
| 208 | 3300046536 | Ga0495587_0333272 | Ga0495587_0333272_116_703 | 193 |
| 209 | 3300046543 | Ga0495645_0451629 | Ga0495645_0451629_156_749 | 193 |
| 210 | 3300046557 | Ga0495622_0000925 | Ga0495622_0000925_314_901 | 193 |
| 211 | 3300046642 | Ga0495634_0000616 | Ga0495634_0000616_18573_19160 | 193 |
| 212 | 3300046642 | Ga0495634_0095273 | Ga0495634_0095273_933_1568 | 193 |
| 213 | 3300046642 | Ga0495634_0449748 | Ga0495634_0449748_96_683 | 193 |
| 214 | 3300046642 | Ga0495634_0459267 | Ga0495634_0459267_71_670 | 193 |
| 215 | 3300046660 | Ga0495625_0008361 | Ga0495625_0008361_8115_8702 | 193 |
| 216 | 3300046663 | Ga0495635_0000006 | Ga0495635_0000006_129908_130492 | 193 |
| 217 | 3300046663 | Ga0495635_0041536 | Ga0495635_0041536_594_1181 | 193 |
| 218 | 3300046663 | Ga0495635_0231815 | Ga0495635_0231815_551_1153 | 193 |
| 219 | 3300046674 | Ga0495588_0000218 | Ga0495588_0000218_38301_38888 | 193 |
| 220 | 3300046675 | Ga0495657_0000005 | Ga0495657_0000005_219306_219893 | 193 |
| 221 | 3300046675 | Ga0495657_0002455 | Ga0495657_0002455_7342_7926 | 193 |
| 222 | 3300046678 | Ga0495599_0017432 | Ga0495599_0017432_35_619 | 193 |
| 223 | 3300046680 | Ga0495646_0360654 | Ga0495646_0360654_124_708 | 193 |
| 224 | 3300046681 | Ga0495647_0000010 | Ga0495647_0000010_9794_10387 | 193 |
| 225 | 3300046683 | Ga0495658_0002078 | Ga0495658_0002078_1094_1681 | 193 |
| 226 | 3300046684 | Ga0495669_0018458 | Ga0495669_0018458_1128_1715 | 193 |
| 227 | 3300046689 | Ga0495613_0000092 | Ga0495613_0000092_70889_71473 | 193 |
| 228 | 3300046689 | Ga0495613_0000131 | Ga0495613_0000131_19436_20023 | 193 |
| 229 | 3300046690 | Ga0495624_0000049 | Ga0495624_0000049_30986_31567 | 193 |
| 230 | 3300046690 | Ga0495624_0029189 | Ga0495624_0029189_2994_3578 | 193 |
| 231 | 3300046809 | Ga0495600_0014478 | Ga0495600_0014478_3063_3650 | 193 |
| 232 | 3300046809 | Ga0495600_0046715 | Ga0495600_0046715_1116_1697 | 193 |
| 233 | 3300046810 | Ga0495660_0118693 | Ga0495660_0118693_266_853 | 193 |
| 234 | 3300047317 | Ga0495604_0000078 | Ga0495604_0000078_40071_40658 | 193 |
| 235 | 3300047319 | Ga0495674_0000063 | Ga0495674_0000063_52227_52814 | 193 |
| 236 | 3300047319 | Ga0495674_0735500 | Ga0495674_0735500_113_709 | 193 |
| 237 | 3300047320 | Ga0495672_0025960 | Ga0495672_0025960_2711_3295 | 193 |
| 238 | 3300047321 | Ga0495676_0003442 | Ga0495676_0003442_9814_10395 | 193 |
| 239 | 3300047321 | Ga0495676_0005287 | Ga0495676_0005287_7379_7960 | 193 |
| 240 | 3300047322 | Ga0495680_0000050 | Ga0495680_0000050_9640_10224 | 193 |
| 241 | 3300047322 | Ga0495680_0000873 | Ga0495680_0000873_29683_30267 | 193 |
| 242 | 3300047322 | Ga0495680_0178076 | Ga0495680_0178076_703_1290 | 193 |
| 243 | 3300047444 | Ga0495675_0000004 | Ga0495675_0000004_26108_26695 | 193 |
| 244 | 3300047471 | Ga0495684_0356484 | Ga0495684_0356484_219_821 | 193 |
| 245 | 3300048088 | Ga0495602_0000009 | Ga0495602_0000009_183847_184446 | 193 |
| 246 | 3300048088 | Ga0495602_0002886 | Ga0495602_0002886_12226_12813 | 193 |
| 247 | 3300048088 | Ga0495602_0237585 | Ga0495602_0237585_22_603 | 193 |
| 248 | 3300048903 | Ga0496100_0000004 | Ga0496100_0000004_188190_188774 | 193 |
| 249 | 3300048903 | Ga0496100_0000032 | Ga0496100_0000032_68569_69150 | 193 |
| 250 | 3300048904 | Ga0496101_0000007 | Ga0496101_0000007_188190_188774 | 193 |
| 251 | 3300048904 | Ga0496101_0000012 | Ga0496101_0000012_30891_31472 | 193 |
| 252 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_374153_374734 | 193 |
| 253 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_562476_563063 | 193 |
| 254 | 3300048907 | Ga0496104_0001440 | Ga0496104_0001440_4913_5497 | 193 |
| 255 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_953445_954026 | 193 |
| 256 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_623058_623645 | 193 |
| 257 | 3300048908 | Ga0496105_0000095 | Ga0496105_0000095_59218_59802 | 193 |
| 258 | 3300048909 | Ga0496106_0000004 | Ga0496106_0000004_149604_150188 | 193 |
| 259 | 3300048909 | Ga0496106_0000092 | Ga0496106_0000092_29423_30004 | 193 |
| 260 | 3300048909 | Ga0496106_0186291 | Ga0496106_0186291_980_1564 | 193 |
| 261 | 3300048910 | Ga0496107_0000001 | Ga0496107_0000001_188190_188774 | 193 |
| 262 | 3300048910 | Ga0496107_0000031 | Ga0496107_0000031_69079_69660 | 193 |
| 263 | 3300048910 | Ga0496107_0728640 | Ga0496107_0728640_117_701 | 193 |
| 264 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_638259_638843 | 193 |
| 265 | 3300048911 | Ga0496108_0000012 | Ga0496108_0000012_16959_17546 | 193 |
| 266 | 3300048911 | Ga0496108_0014041 | Ga0496108_0014041_5476_6063 | 193 |
| 267 | 3300048911 | Ga0496108_0038460 | Ga0496108_0038460_2106_2687 | 193 |
| 268 | 3300048911 | Ga0496108_0215423 | Ga0496108_0215423_707_1294 | 193 |
| 269 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_638221_638805 | 193 |
| 270 | 3300048912 | Ga0496109_0000076 | Ga0496109_0000076_37377_37964 | 193 |
| 271 | 3300048912 | Ga0496109_0000106 | Ga0496109_0000106_57672_58259 | 193 |
| 272 | 3300048912 | Ga0496109_0198724 | Ga0496109_0198724_471_1160 | 193 |
| 273 | 3300048912 | Ga0496109_0826353 | Ga0496109_0826353_50_637 | 193 |
| 274 | 3300048913 | Ga0496110_0000015 | Ga0496110_0000015_9508_10095 | 193 |
| 275 | 3300048913 | Ga0496110_0022911 | Ga0496110_0022911_3254_3853 | 193 |
| 276 | 3300048914 | Ga0496111_0000001 | Ga0496111_0000001_164733_165320 | 193 |
| 277 | 3300048914 | Ga0496111_0275570 | Ga0496111_0275570_252_839 | 193 |
| 278 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_288458_289039 | 193 |
| 279 | 3300048916 | Ga0496113_0000033 | Ga0496113_0000033_55110_55697 | 193 |
| 280 | 3300048916 | Ga0496113_0022010 | Ga0496113_0022010_3078_3665 | 193 |
| 281 | 3300048916 | Ga0496113_0046466 | Ga0496113_0046466_1347_1928 | 193 |
| 282 | 3300048916 | Ga0496113_0099138 | Ga0496113_0099138_1516_2103 | 193 |
| 283 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_43425_44006 | 193 |
| 284 | 3300048917 | Ga0496114_0014570 | Ga0496114_0014570_3990_4571 | 193 |
| 285 | 3300048918 | Ga0496115_0000071 | Ga0496115_0000071_80286_80867 | 193 |
| 286 | 3300048918 | Ga0496115_0000183 | Ga0496115_0000183_20685_21266 | 193 |
| 287 | 3300048922 | Ga0496119_0029259 | Ga0496119_0029259_2396_2977 | 193 |
| 288 | 3300048923 | Ga0496120_0043668 | Ga0496120_0043668_865_1446 | 193 |
| 289 | 3300048928 | Ga0496125_0253851 | Ga0496125_0253851_42_626 | 193 |
| 290 | 3300049569 | Ga0501032_0160092 | Ga0501032_0160092_426_1025 | 193 |
| 291 | 3300049571 | Ga0501034_1051406 | Ga0501034_1051406_35_634 | 193 |
| 292 | 3300049575 | Ga0501039_0379311 | Ga0501039_0379311_160_747 | 193 |
| 293 | 3300049578 | Ga0501042_0494451 | Ga0501042_0494451_52_639 | 193 |
| 294 | 3300049586 | Ga0501070_0152234 | Ga0501070_0152234_1190_1771 | 193 |
| 295 | 3300049586 | Ga0501070_0869435 | Ga0501070_0869435_40_627 | 193 |
| 296 | 3300049587 | Ga0501071_0059899 | Ga0501071_0059899_17_604 | 193 |
| 297 | 3300049590 | Ga0501074_0040894 | Ga0501074_0040894_580_1167 | 193 |
| 298 | 3300049591 | Ga0501075_0416260 | Ga0501075_0416260_55_642 | 193 |
| 299 | 3300049741 | Ga0501079_0048913 | Ga0501079_0048913_1671_2258 | 193 |
| 300 | 3300049741 | Ga0501079_0567293 | Ga0501079_0567293_35_625 | 193 |
| 301 | 3300049742 | Ga0501080_1100264 | Ga0501080_1100264_16_603 | 193 |
| 302 | 3300049823 | Ga0501044_0016664 | Ga0501044_0016664_42_629 | 193 |
| 303 | 3300050513 | nmdc:mga0rr50_315885_c1 | nmdc:mga0rr50_315885_c1_266_850 | 193 |
| 304 | 3300053077 | Ga0495601_0000296 | Ga0495601_0000296_17743_18330 | 193 |
| 305 | 3300053077 | Ga0495601_0011291 | Ga0495601_0011291_2382_2987 | 193 |
| 306 | 3300053077 | Ga0495601_0057755 | Ga0495601_0057755_1505_2089 | 193 |
| 307 | 3300053078 | Ga0495612_0008495 | Ga0495612_0008495_3089_3676 | 193 |
| 308 | 3300053078 | Ga0495612_0014769 | Ga0495612_0014769_51_635 | 193 |
| 309 | 3300053083 | Ga0495655_0000485 | Ga0495655_0000485_5194_5781 | 193 |
| 310 | 3300053084 | Ga0495595_0000005 | Ga0495595_0000005_223106_223693 | 193 |
| 311 | 3300053084 | Ga0495595_0000362 | Ga0495595_0000362_9606_10247 | 193 |
| 312 | 3300053085 | Ga0495619_0000040 | Ga0495619_0000040_27556_28143 | 193 |
| 313 | 3300053085 | Ga0495619_0000126 | Ga0495619_0000126_20626_21213 | 193 |
| 314 | 3300053085 | Ga0495619_0000896 | Ga0495619_0000896_16661_17248 | 193 |
| 315 | 3300053085 | Ga0495619_0002266 | Ga0495619_0002266_11551_12153 | 193 |
| 316 | 3300053085 | Ga0495619_0007234 | Ga0495619_0007234_5380_5961 | 193 |
| 317 | 3300053085 | Ga0495619_0206342 | Ga0495619_0206342_136_723 | 193 |
| 318 | 3300053123 | Ga0500614_003173 | Ga0500614_003173_891_1487 | 193 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u2w-assembly1.cif.gz_A | crystal structure of the staphylococcus aureus pi258 cadc | 0.9731 | 141 | 167 |
| 6i2r-assembly1.cif.gz_D | crystal structure of the suca domain of mycobacterium smegmatis kgd (alpha-ketoglutarate decarboxylase), mutant r802a, in complex with gara | 0.9632 | 5 | 93 |
| 8p5r-assembly1.cif.gz_H | crystal structure of full-length, homohexameric 2-oxoglutarate dehydrogenase kgd from mycobacterium smegmatis in complex with gara | 0.9558 | 2 | 95 |
| 8p5x-assembly1.cif.gz_G | single particle cryo-em structure of the complex between corynebacterium glutamicum homohexameric 2-oxoglutarate dehydrogenase odha and the fha-protein inhibitor odhi | 0.9528 | 2 | 97 |
| 6hc1-assembly2.cif.gz_B | bdellovibrio bacteriovorus dgcb fha in complex with phosphorylated n-terminal peptide | 0.9511 | 1 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6az6B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9851 | 141 | 166 | 1.10.10.10 |
| 6i2sB01 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.9586 | 4 | 93 | 2.60.200.20 |
| af_P9WJB5_49_154_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.9509 | 4 | 94 | 2.60.200.20 |
| af_Q54E53_292_358_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.949 | 141 | 167 | 1.10.10.10 |
| af_Q54ST8_470_584_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.9278 | 2 | 95 | 2.60.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A658NI66-F1-model_v4 | FHA domain-containing protein | 0.9777 | 22 | 88 |
|
| AF-A0A2V7WC40-F1-model_v4 | FHA domain-containing protein | 0.9766 | 2 | 95 |
|
| AF-A0A7C3WVX1-F1-model_v4 | FHA domain-containing protein | 0.9737 | 3 | 97 |
|
| AF-A0A087CCY9-F1-model_v4 | Signal transduction protein GarA | 0.9724 | 3 | 95 |
|
| AF-A0A495CTT1-F1-model_v4 | deleted | 0.9723 | 3 | 95 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar