F404349

General Info

Members Datasets Scaffolds Average Seq Length
317 214 634 287

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_299707_c1|nmdc:mga0qj67_299707_c1_312_1286
Length 324
Sequence LKFLVRLALRQVFTPKLGGGTGFSGGMFFLGSGFMIIPRRGLARLLAIVLLAAPLGACSSLGLDQFSLSSMNPWAKKDLPADEPAEKLYNEGVYLLNEKREYKEAIKRFEEVDRQHPYSEWARKSLLMAAYSSYQAREYDETVAAAKRYIALHPGTPDAAYAQFLIGSANFDRIPTVQRDQAITEKALAELEEVSRKFPNTEYAASARKKIEVARDQLAGREMEVGRYYMNKRNYTGAINRFKVVVTQYQTTRHVEEALMRLTEAYMSLGITQEAQTAAAVLGHNFPDSPWYKDAYALVKGGGLEPSESQGSWISRAFKKIGLG

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
110 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
132 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.05
Nodule 0
Rhizoplane 7.89
Rhizosphere 84.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_299707_c1 3300050509 Bacteria 1302
2 JGI25153J46596_10019289 3300003215 Bacteria 2618
3 Ga0065714_10128947 3300005288 Bacteria 1268
4 Ga0065712_10019835 3300005290 Bacteria 1747
5 Ga0065715_10213724 3300005293 Bacteria 1302
6 Ga0070676_10049543 3300005328 Bacteria 2459
7 Ga0070676_10099906 3300005328 Bacteria 1791
8 Ga0070690_100278885 3300005330 Bacteria 1191
9 Ga0070677_10002523 3300005333 Bacteria 5855
10 Ga0068869_100043123 3300005334 Bacteria 3239
11 Ga0070680_100287217 3300005336 Bacteria 1394
12 Ga0068868_100039458 3300005338 Bacteria 3669
13 Ga0070689_100001379 3300005340 Bacteria 15450
14 Ga0070689_100016853 3300005340 Bacteria 5355
15 Ga0070689_100029199 3300005340 Bacteria 4171
16 Ga0070689_100119085 3300005340 Bacteria 2108
17 Ga0070689_100437335 3300005340 Bacteria 1111
18 Ga0070669_100040381 3300005353 Bacteria 3392
19 Ga0070669_100122005 3300005353 Bacteria 1989
20 Ga0070675_100067559 3300005354 Bacteria 2958
21 Ga0070675_100251768 3300005354 Bacteria 1546
22 Ga0070671_100075656 3300005355 Bacteria 2813
23 Ga0070671_100255230 3300005355 Bacteria 1490
24 Ga0070674_100032784 3300005356 Bacteria 3452
25 Ga0070673_100253696 3300005364 Bacteria 1534
26 Ga0070688_100031499 3300005365 Bacteria 3191
27 Ga0070688_100074861 3300005365 Bacteria 2175
28 Ga0070688_100176259 3300005365 Bacteria 1479
29 Ga0070714_100145798 3300005435 Bacteria 2129
30 Ga0070710_10063784 3300005437 Bacteria 2106
31 Ga0070700_100171921 3300005441 Bacteria 1501
32 Ga0070663_100078080 3300005455 Bacteria 2426
33 Ga0070678_100018676 3300005456 Bacteria 4499
34 Ga0070681_10117746 3300005458 Bacteria 2593
35 Ga0070679_100076706 3300005530 Bacteria 3331
36 Ga0068853_100307526 3300005539 Bacteria 1467
37 Ga0070672_100057235 3300005543 Bacteria 3059
38 Ga0070686_100105748 3300005544 Bacteria 1909
39 Ga0068857_100301274 3300005577 Bacteria 1478
40 Ga0068859_100046414 3300005617 Bacteria 4362
41 Ga0068859_100311551 3300005617 Bacteria 1667
42 Ga0068859_100549188 3300005617 Bacteria 1250
43 Ga0068864_100065412 3300005618 Bacteria 3154
44 Ga0068866_10085510 3300005718 Bacteria 1705
45 Ga0068866_10177288 3300005718 Bacteria 1256
46 Ga0068861_100202135 3300005719 Bacteria 1668
47 Ga0081455_10320085 3300005937 Bacteria 1105
48 Ga0081538_10014957 3300005981 Bacteria 6041
49 Ga0081539_10005255 3300005985 Bacteria 13360
50 Ga0070717_10058781 3300006028 Bacteria 3180
51 Ga0070717_10096746 3300006028 Bacteria 2501
52 Ga0075363_100115062 3300006048 Bacteria 1497
53 Ga0075364_10015235 3300006051 Bacteria 4764
54 Ga0070715_10042414 3300006163 Bacteria 1912
55 Ga0070716_100022021 3300006173 Bacteria 3365
56 Ga0070712_100003019 3300006175 Bacteria 10414
57 Ga0075362_10001877 3300006177 Bacteria 6887
58 Ga0075367_10044236 3300006178 Bacteria 2609
59 Ga0075369_10025733 3300006186 Bacteria 2449
60 Ga0075366_10113315 3300006195 Bacteria 1633
61 Ga0068865_100385086 3300006881 Bacteria 1145
62 Ga0075436_100002142 3300006914 Bacteria 13601
63 Ga0097620_100046414 3300006931 Bacteria 4362
64 Ga0097620_100311548 3300006931 Bacteria 1667
65 Ga0097620_100549170 3300006931 Bacteria 1250
66 Ga0111539_10934222 3300009094 Bacteria 1009
67 Ga0105245_10007249 3300009098 Bacteria 9713
68 Ga0105245_10090868 3300009098 Bacteria 2809
69 Ga0105245_10324385 3300009098 Bacteria 1518
70 Ga0105247_10070496 3300009101 Bacteria 2183
71 Ga0114129_10342589 3300009147 Bacteria 1982
72 Ga0105248_10023849 3300009177 Bacteria 6800
73 Ga0105248_10263615 3300009177 Bacteria 1940
74 Ga0105238_10138306 3300009551 Bacteria 2413
75 Ga0105249_10161996 3300009553 Bacteria 2162
76 Ga0105246_10058990 3300011119 Bacteria 2661
77 Ga0157374_10179570 3300013296 Bacteria 2067
78 Ga0157374_10204544 3300013296 Bacteria 1934
79 Ga0157378_10171376 3300013297 Bacteria 2036
80 Ga0157378_10188210 3300013297 Bacteria 1945
81 Ga0163162_10657260 3300013306 Bacteria 1172
82 Ga0157375_10507159 3300013308 Bacteria 1370
83 Ga0157375_10650985 3300013308 Bacteria 1210
84 Ga0163163_10050505 3300014325 Bacteria 4096
85 Ga0157377_10060683 3300014745 Bacteria 2159
86 Ga0157376_10256295 3300014969 Bacteria 1637
87 Ga0213875_10000093 3300021388 Bacteria 102870
88 Ga0209758_1000186 3300025297 Bacteria 138804
89 Ga0207426_1049696 3300025302 Bacteria 1254
90 Ga0207682_10006456 3300025893 Bacteria 4721
91 Ga0207642_10009921 3300025899 Bacteria 3334
92 Ga0207642_10038692 3300025899 Bacteria 2067
93 Ga0207688_10066096 3300025901 Bacteria 2045
94 Ga0207685_10037710 3300025905 Bacteria 1782
95 Ga0207645_10043374 3300025907 Bacteria 2878
96 Ga0207643_10235165 3300025908 Bacteria 1125
97 Ga0207707_10015576 3300025912 Bacteria 6623
98 Ga0207693_10010489 3300025915 Bacteria 7519
99 Ga0207662_10033227 3300025918 Bacteria 3005
100 Ga0207652_10061734 3300025921 Bacteria 3237
101 Ga0207681_10034669 3300025923 Bacteria 3320
102 Ga0207681_10054041 3300025923 Bacteria 2729
103 Ga0207681_10282296 3300025923 Bacteria 1308
104 Ga0207694_10090603 3300025924 Bacteria 2413
105 Ga0207659_10039356 3300025926 Bacteria 3297
106 Ga0207659_10310702 3300025926 Bacteria 1298
107 Ga0207687_10193799 3300025927 Bacteria 1583
108 Ga0207687_10328559 3300025927 Bacteria 1240
109 Ga0207700_10128166 3300025928 Bacteria 2068
110 Ga0207644_10046001 3300025931 Bacteria 3107
111 Ga0207644_10058547 3300025931 Bacteria 2785
112 Ga0207644_10238590 3300025931 Bacteria 1447
113 Ga0207670_10000760 3300025936 Bacteria 16979
114 Ga0207669_10190327 3300025937 Bacteria 1479
115 Ga0207665_10122751 3300025939 Bacteria 1836
116 Ga0207691_10008900 3300025940 Bacteria 9639
117 Ga0207691_10215104 3300025940 Bacteria 1668
118 Ga0207711_10025365 3300025941 Bacteria 4974
119 Ga0207689_10007596 3300025942 Bacteria 9498
120 Ga0207651_10165597 3300025960 Bacteria 1738
121 Ga0207703_10170438 3300026035 Bacteria 1914
122 Ga0207678_10158702 3300026067 Bacteria 1931
123 Ga0207708_10073820 3300026075 Bacteria 2615
124 Ga0207708_10165475 3300026075 Bacteria 1748
125 Ga0207648_10045686 3300026089 Bacteria 3841
126 Ga0207676_10245601 3300026095 Bacteria 1608
127 Ga0207674_10087519 3300026116 Bacteria 3108
128 Ga0207675_100163307 3300026118 Bacteria 2126
129 Ga0207683_10000639 3300026121 Bacteria 32031
130 Ga0207683_10064160 3300026121 Bacteria 3237
131 Ga0268264_10102458 3300028381 Bacteria 2491
132 Ga0265337_1017832 3300028556 Bacteria 2267
133 Ga0265760_10006497 3300031090 Bacteria 3342
134 Ga0265760_10034600 3300031090 Bacteria 1495
135 Ga0265332_10001080 3300031238 Bacteria 15940
136 Ga0265325_10000855 3300031241 Bacteria 21943
137 Ga0265340_10050858 3300031247 Bacteria 2008
138 Ga0265313_10035235 3300031595 Bacteria 2523
139 Ga0265342_10000085 3300031712 Bacteria 100652
140 Ga0316576_10010466 3300031727 Bacteria 6028
141 Ga0316576_10132684 3300031727 Bacteria 1874
142 Ga0316578_10036730 3300031728 Bacteria 2820
143 Ga0373959_0021923 3300034820 Bacteria 1231
144 Ga0373938_0023641 3300034957 Bacteria 1265
145 Ga0373923_0009001 3300035111 Bacteria 3585
146 Ga0373923_0032378 3300035111 Bacteria 2112
147 Ga0373936_0004492 3300035113 Bacteria 5277
148 Ga0373936_0051488 3300035113 Bacteria 1667
149 Ga0373945_0001879 3300035116 Bacteria 6511
150 Ga0373945_0026080 3300035116 Bacteria 2034
151 Ga0373954_0003807 3300035118 Bacteria 6444
152 Ga0373943_0001648 3300035170 Bacteria 10137
153 Ga0373943_0003740 3300035170 Bacteria 6921
154 Ga0373943_0049563 3300035170 Bacteria 2061
155 Ga0373946_0000911 3300035171 Bacteria 10159
156 Ga0373946_0008770 3300035171 Bacteria 3711
157 Ga0373955_0001476 3300035172 Bacteria 9994
158 Ga0373962_0012755 3300035242 Bacteria 2122
159 Ga0316574_0000248 3300035398 Bacteria 19592
160 Ga0316574_0000773 3300035398 Bacteria 13801
161 Ga0373924_0022703 3300035410 Bacteria 2454
162 Ga0373924_0070601 3300035410 Bacteria 1473
163 Ga0373931_0010601 3300035691 Bacteria 4432
164 Ga0373931_0011892 3300035691 Bacteria 4210
165 Ga0373935_0000185 3300035692 Bacteria 29355
166 Ga0373935_0004269 3300035692 Bacteria 8380
167 Ga0373927_0005659 3300035695 Bacteria 8590
168 Ga0373927_0015251 3300035695 Bacteria 5076
169 Ga0373927_0016738 3300035695 Bacteria 4836
170 Ga0373933_0000672 3300035724 Bacteria 21195
171 Ga0373947_0001402 3300035725 Bacteria 14825
172 Ga0373947_0001808 3300035725 Bacteria 13093
173 Ga0373947_0206703 3300035725 Bacteria 1286
174 Ga0373937_0000068 3300036401 Bacteria 94138
175 Ga0373937_0016794 3300036401 Bacteria 6507
176 Ga0373937_0062760 3300036401 Bacteria 3416
177 Ga0316582_0298301 3300036647 Bacteria 1107
178 Ga0373925_0002364 3300037068 Bacteria 15132
179 Ga0373925_0005101 3300037068 Bacteria 9834
180 Ga0436364_0355376 3300037853 Bacteria 1545
181 Ga0436364_0376292 3300037853 Bacteria 27928
182 Ga0436364_0570386 3300037853 Bacteria 2352
183 Ga0436365_1511149 3300039437 Bacteria 5885
184 Ga0436365_1882645 3300039437 Bacteria 6856
185 Ga0439441_018689 3300042001 Bacteria 1255
186 Ga0439459_0013477 3300042438 Bacteria 1472
187 Ga0466963_0147921 3300044694 Bacteria 1631
188 Ga0466968_0037675 3300044735 Bacteria 2030
189 Ga0466957_0039915 3300044842 Bacteria 2833
190 Ga0466967_0226109 3300045976 Bacteria 1780
191 Ga0495592_0004767 3300046454 Bacteria 9955
192 Ga0495629_0005407 3300046459 Bacteria 9524
193 Ga0495629_0018832 3300046459 Bacteria 4935
194 Ga0495651_0038075 3300046462 Bacteria 3745
195 Ga0495653_0005358 3300046463 Bacteria 10437
196 Ga0495653_0035191 3300046463 Bacteria 3954
197 Ga0495662_0002537 3300046476 Bacteria 9212
198 Ga0495662_0004111 3300046476 Bacteria 7328
199 Ga0495662_0124128 3300046476 Bacteria 1268
200 Ga0495664_0000105 3300046477 Bacteria 41914
201 Ga0495664_0001875 3300046477 Bacteria 11171
202 Ga0495594_0184796 3300046499 Bacteria 1187
203 Ga0495608_0000020 3300046511 Bacteria 169036
204 Ga0495618_0001074 3300046514 Bacteria 18661
205 Ga0495618_0001471 3300046514 Bacteria 15799
206 Ga0495618_0168475 3300046514 Bacteria 1394
207 Ga0495628_0000005 3300046516 Bacteria 420969
208 Ga0495628_0087654 3300046516 Bacteria 2413
209 Ga0495630_0001784 3300046517 Bacteria 15054
210 Ga0495630_0004297 3300046517 Bacteria 9992
211 Ga0495630_0015576 3300046517 Bacteria 5554
212 Ga0495666_0042086 3300046526 Bacteria 2210
213 Ga0495652_0000001 3300046529 Bacteria 1045081
214 Ga0495652_0134322 3300046529 Bacteria 1954
215 Ga0495640_0000027 3300046533 Bacteria 90638
216 Ga0495640_0002052 3300046533 Bacteria 16064
217 Ga0495640_0022825 3300046533 Bacteria 4568
218 Ga0495586_0021394 3300046535 Bacteria 3448
219 Ga0495587_0000017 3300046536 Bacteria 172923
220 Ga0495587_0040290 3300046536 Bacteria 2793
221 Ga0495587_0092754 3300046536 Bacteria 1744
222 Ga0495587_0179606 3300046536 Bacteria 1200
223 Ga0495598_0030263 3300046537 Bacteria 1515
224 Ga0495621_0008160 3300046539 Bacteria 3129
225 Ga0495645_0000212 3300046543 Bacteria 41774
226 Ga0495645_0006115 3300046543 Bacteria 8329
227 Ga0495667_0000031 3300046559 Bacteria 147377
228 Ga0495656_0039685 3300046615 Bacteria 1957
229 Ga0495634_0000006 3300046642 Bacteria 172775
230 Ga0495634_0010860 3300046642 Bacteria 6653
231 Ga0495635_0000154 3300046663 Bacteria 41886
232 Ga0495635_0002882 3300046663 Bacteria 11809
233 Ga0495657_0000828 3300046675 Bacteria 27353
234 Ga0495657_0014197 3300046675 Bacteria 5853
235 Ga0495657_0255620 3300046675 Bacteria 1054
236 Ga0495599_0000051 3300046678 Bacteria 81853
237 Ga0495623_0001078 3300046679 Bacteria 18463
238 Ga0495646_0000102 3300046680 Bacteria 41798
239 Ga0495646_0072684 3300046680 Bacteria 2022
240 Ga0495658_0069871 3300046683 Bacteria 2036
241 Ga0495613_0154960 3300046689 Bacteria 1632
242 Ga0495624_0002329 3300046690 Bacteria 14456
243 Ga0495624_0019303 3300046690 Bacteria 4553
244 Ga0495624_0033296 3300046690 Bacteria 3338
245 Ga0495624_0144140 3300046690 Bacteria 1458
246 Ga0495600_0000069 3300046809 Bacteria 58754
247 Ga0495604_0000007 3300047317 Bacteria 412174
248 Ga0495604_0064311 3300047317 Bacteria 2796
249 Ga0495674_0000001 3300047319 Bacteria 778665
250 Ga0495674_0007252 3300047319 Bacteria 10609
251 Ga0495674_0021307 3300047319 Bacteria 5995
252 Ga0495676_0047932 3300047321 Bacteria 3449
253 Ga0495680_0005755 3300047322 Bacteria 11605
254 Ga0495675_0000216 3300047444 Bacteria 41783
255 Ga0495675_0056529 3300047444 Bacteria 2488
256 Ga0495679_085923 3300047446 Bacteria 888
257 Ga0495685_012922 3300047447 Bacteria 2831
258 Ga0495684_0000009 3300047471 Bacteria 199436
259 Ga0495684_0009303 3300047471 Bacteria 7582
260 Ga0495684_0019019 3300047471 Bacteria 5288
261 Ga0495593_0003510 3300047673 Bacteria 9379
262 Ga0495602_0000373 3300048088 Bacteria 41729
263 Ga0495615_0006113 3300048090 Bacteria 2209
264 Ga0496100_0019215 3300048903 Bacteria 4071
265 Ga0496100_0077229 3300048903 Bacteria 2238
266 Ga0496101_0154380 3300048904 Bacteria 1757
267 Ga0496102_0055626 3300048905 Bacteria 3608
268 Ga0496102_0369547 3300048905 Bacteria 1350
269 Ga0496103_0169114 3300048906 Bacteria 1403
270 Ga0496104_0034329 3300048907 Bacteria 4729
271 Ga0496104_0047340 3300048907 Bacteria 4053
272 Ga0496104_0278996 3300048907 Bacteria 1584
273 Ga0496105_0040632 3300048908 Bacteria 3835
274 Ga0496105_0043162 3300048908 Bacteria 3718
275 Ga0496107_0088390 3300048910 Bacteria 2262
276 Ga0496108_0090701 3300048911 Bacteria 2598
277 Ga0496109_0064176 3300048912 Bacteria 3360
278 Ga0496109_0422778 3300048912 Bacteria 1259
279 Ga0496110_0196783 3300048913 Bacteria 1831
280 Ga0496111_0047595 3300048914 Bacteria 3088
281 Ga0496111_0286096 3300048914 Bacteria 1223
282 Ga0496112_0077305 3300048915 Bacteria 3291
283 Ga0496112_0195049 3300048915 Bacteria 1986
284 Ga0496112_0424946 3300048915 Bacteria 1267
285 Ga0496113_0216049 3300048916 Bacteria 1527
286 Ga0496114_0169548 3300048917 Bacteria 1902
287 Ga0496115_0040506 3300048918 Bacteria 3704
288 Ga0496115_0450853 3300048918 Bacteria 1039
289 Ga0496126_0025929 3300048929 Bacteria 5629
290 Ga0501032_0079209 3300049569 Bacteria 2187
291 Ga0501033_0022656 3300049570 Bacteria 4737
292 Ga0501036_0373410 3300049572 Bacteria 1190
293 Ga0501038_0012964 3300049574 Bacteria 7604
294 Ga0501047_0029181 3300049581 Bacteria 5320
295 Ga0501047_0080659 3300049581 Bacteria 3127
296 Ga0501083_0124783 3300049744 Bacteria 1688
297 Ga0501044_0000286 3300049823 Bacteria 64389
298 nmdc:mga03n38_68164_c1 3300050490 Bacteria 1640
299 nmdc:mga00v17_22216_c1 3300050491 Bacteria 3658
300 nmdc:mga0yw44_52250_c1 3300050492 Bacteria 2477
301 nmdc:mga0k408_14178_c1 3300050493 Bacteria 4387
302 nmdc:mga05p37_395728_c1 3300050507 Bacteria 1614
303 nmdc:mga06r32_666178_c1 3300050510 Bacteria 1008
304 Ga0495601_0000020 3300053077 Bacteria 160011
305 Ga0495601_0003525 3300053077 Bacteria 8997
306 Ga0495601_0003562 3300053077 Bacteria 8954
307 Ga0495612_0000030 3300053078 Bacteria 81917
308 Ga0495612_0001208 3300053078 Bacteria 10642
309 Ga0495595_0000125 3300053084 Bacteria 33101
310 Ga0495619_0000216 3300053085 Bacteria 41892
311 Ga0495619_0004231 3300053085 Bacteria 9147
312 Ga0495619_0009736 3300053085 Bacteria 6058
313 Ga0495619_0167379 3300053085 Bacteria 1519
314 Ga0495619_0211277 3300053085 Bacteria 1344
315 Ga0500644_0000566 3300053088 Bacteria 14509
316 Ga0500651_0002219 3300053093 Bacteria 10174
317 Ga0500616_0000001 3300053153 Bacteria 1986011
318 nmdc:mga0qj67_299707_c1
319 JGI25153J46596_10019289
320 Ga0065714_10128947
321 Ga0065712_10019835
322 Ga0065715_10213724
323 Ga0070676_10049543
324 Ga0070676_10099906
325 Ga0070690_100278885
326 Ga0070677_10002523
327 Ga0068869_100043123
328 Ga0070680_100287217
329 Ga0068868_100039458
330 Ga0070689_100001379
331 Ga0070689_100016853
332 Ga0070689_100029199
333 Ga0070689_100119085
334 Ga0070689_100437335
335 Ga0070669_100040381
336 Ga0070669_100122005
337 Ga0070675_100067559
338 Ga0070675_100251768
339 Ga0070671_100075656
340 Ga0070671_100255230
341 Ga0070674_100032784
342 Ga0070673_100253696
343 Ga0070688_100031499
344 Ga0070688_100074861
345 Ga0070688_100176259
346 Ga0070714_100145798
347 Ga0070710_10063784
348 Ga0070700_100171921
349 Ga0070663_100078080
350 Ga0070678_100018676
351 Ga0070681_10117746
352 Ga0070679_100076706
353 Ga0068853_100307526
354 Ga0070672_100057235
355 Ga0070686_100105748
356 Ga0068857_100301274
357 Ga0068859_100046414
358 Ga0068859_100311551
359 Ga0068859_100549188
360 Ga0068864_100065412
361 Ga0068866_10085510
362 Ga0068866_10177288
363 Ga0068861_100202135
364 Ga0081455_10320085
365 Ga0081538_10014957
366 Ga0081539_10005255
367 Ga0070717_10058781
368 Ga0070717_10096746
369 Ga0075363_100115062
370 Ga0075364_10015235
371 Ga0070715_10042414
372 Ga0070716_100022021
373 Ga0070712_100003019
374 Ga0075362_10001877
375 Ga0075367_10044236
376 Ga0075369_10025733
377 Ga0075366_10113315
378 Ga0068865_100385086
379 Ga0075436_100002142
380 Ga0097620_100046414
381 Ga0097620_100311548
382 Ga0097620_100549170
383 Ga0111539_10934222
384 Ga0105245_10007249
385 Ga0105245_10090868
386 Ga0105245_10324385
387 Ga0105247_10070496
388 Ga0114129_10342589
389 Ga0105248_10023849
390 Ga0105248_10263615
391 Ga0105238_10138306
392 Ga0105249_10161996
393 Ga0105246_10058990
394 Ga0157374_10179570
395 Ga0157374_10204544
396 Ga0157378_10171376
397 Ga0157378_10188210
398 Ga0163162_10657260
399 Ga0157375_10507159
400 Ga0157375_10650985
401 Ga0163163_10050505
402 Ga0157377_10060683
403 Ga0157376_10256295
404 Ga0213875_10000093
405 Ga0209758_1000186
406 Ga0207426_1049696
407 Ga0207682_10006456
408 Ga0207642_10009921
409 Ga0207642_10038692
410 Ga0207688_10066096
411 Ga0207685_10037710
412 Ga0207645_10043374
413 Ga0207643_10235165
414 Ga0207707_10015576
415 Ga0207693_10010489
416 Ga0207662_10033227
417 Ga0207652_10061734
418 Ga0207681_10034669
419 Ga0207681_10054041
420 Ga0207681_10282296
421 Ga0207694_10090603
422 Ga0207659_10039356
423 Ga0207659_10310702
424 Ga0207687_10193799
425 Ga0207687_10328559
426 Ga0207700_10128166
427 Ga0207644_10046001
428 Ga0207644_10058547
429 Ga0207644_10238590
430 Ga0207670_10000760
431 Ga0207669_10190327
432 Ga0207665_10122751
433 Ga0207691_10008900
434 Ga0207691_10215104
435 Ga0207711_10025365
436 Ga0207689_10007596
437 Ga0207651_10165597
438 Ga0207703_10170438
439 Ga0207678_10158702
440 Ga0207708_10073820
441 Ga0207708_10165475
442 Ga0207648_10045686
443 Ga0207676_10245601
444 Ga0207674_10087519
445 Ga0207675_100163307
446 Ga0207683_10000639
447 Ga0207683_10064160
448 Ga0268264_10102458
449 Ga0265337_1017832
450 Ga0265760_10006497
451 Ga0265760_10034600
452 Ga0265332_10001080
453 Ga0265325_10000855
454 Ga0265340_10050858
455 Ga0265313_10035235
456 Ga0265342_10000085
457 Ga0316576_10010466
458 Ga0316576_10132684
459 Ga0316578_10036730
460 Ga0373959_0021923
461 Ga0373938_0023641
462 Ga0373923_0009001
463 Ga0373923_0032378
464 Ga0373936_0004492
465 Ga0373936_0051488
466 Ga0373945_0001879
467 Ga0373945_0026080
468 Ga0373954_0003807
469 Ga0373943_0001648
470 Ga0373943_0003740
471 Ga0373943_0049563
472 Ga0373946_0000911
473 Ga0373946_0008770
474 Ga0373955_0001476
475 Ga0373962_0012755
476 Ga0316574_0000248
477 Ga0316574_0000773
478 Ga0373924_0022703
479 Ga0373924_0070601
480 Ga0373931_0010601
481 Ga0373931_0011892
482 Ga0373935_0000185
483 Ga0373935_0004269
484 Ga0373927_0005659
485 Ga0373927_0015251
486 Ga0373927_0016738
487 Ga0373933_0000672
488 Ga0373947_0001402
489 Ga0373947_0001808
490 Ga0373947_0206703
491 Ga0373937_0000068
492 Ga0373937_0016794
493 Ga0373937_0062760
494 Ga0316582_0298301
495 Ga0373925_0002364
496 Ga0373925_0005101
497 Ga0436364_0355376
498 Ga0436364_0376292
499 Ga0436364_0570386
500 Ga0436365_1511149
501 Ga0436365_1882645
502 Ga0439441_018689
503 Ga0439459_0013477
504 Ga0466963_0147921
505 Ga0466968_0037675
506 Ga0466957_0039915
507 Ga0466967_0226109
508 Ga0495592_0004767
509 Ga0495629_0005407
510 Ga0495629_0018832
511 Ga0495651_0038075
512 Ga0495653_0005358
513 Ga0495653_0035191
514 Ga0495662_0002537
515 Ga0495662_0004111
516 Ga0495662_0124128
517 Ga0495664_0000105
518 Ga0495664_0001875
519 Ga0495594_0184796
520 Ga0495608_0000020
521 Ga0495618_0001074
522 Ga0495618_0001471
523 Ga0495618_0168475
524 Ga0495628_0000005
525 Ga0495628_0087654
526 Ga0495630_0001784
527 Ga0495630_0004297
528 Ga0495630_0015576
529 Ga0495666_0042086
530 Ga0495652_0000001
531 Ga0495652_0134322
532 Ga0495640_0000027
533 Ga0495640_0002052
534 Ga0495640_0022825
535 Ga0495586_0021394
536 Ga0495587_0000017
537 Ga0495587_0040290
538 Ga0495587_0092754
539 Ga0495587_0179606
540 Ga0495598_0030263
541 Ga0495621_0008160
542 Ga0495645_0000212
543 Ga0495645_0006115
544 Ga0495667_0000031
545 Ga0495656_0039685
546 Ga0495634_0000006
547 Ga0495634_0010860
548 Ga0495635_0000154
549 Ga0495635_0002882
550 Ga0495657_0000828
551 Ga0495657_0014197
552 Ga0495657_0255620
553 Ga0495599_0000051
554 Ga0495623_0001078
555 Ga0495646_0000102
556 Ga0495646_0072684
557 Ga0495658_0069871
558 Ga0495613_0154960
559 Ga0495624_0002329
560 Ga0495624_0019303
561 Ga0495624_0033296
562 Ga0495624_0144140
563 Ga0495600_0000069
564 Ga0495604_0000007
565 Ga0495604_0064311
566 Ga0495674_0000001
567 Ga0495674_0007252
568 Ga0495674_0021307
569 Ga0495676_0047932
570 Ga0495680_0005755
571 Ga0495675_0000216
572 Ga0495675_0056529
573 Ga0495679_085923
574 Ga0495685_012922
575 Ga0495684_0000009
576 Ga0495684_0009303
577 Ga0495684_0019019
578 Ga0495593_0003510
579 Ga0495602_0000373
580 Ga0495615_0006113
581 Ga0496100_0019215
582 Ga0496100_0077229
583 Ga0496101_0154380
584 Ga0496102_0055626
585 Ga0496102_0369547
586 Ga0496103_0169114
587 Ga0496104_0034329
588 Ga0496104_0047340
589 Ga0496104_0278996
590 Ga0496105_0040632
591 Ga0496105_0043162
592 Ga0496107_0088390
593 Ga0496108_0090701
594 Ga0496109_0064176
595 Ga0496109_0422778
596 Ga0496110_0196783
597 Ga0496111_0047595
598 Ga0496111_0286096
599 Ga0496112_0077305
600 Ga0496112_0195049
601 Ga0496112_0424946
602 Ga0496113_0216049
603 Ga0496114_0169548
604 Ga0496115_0040506
605 Ga0496115_0450853
606 Ga0496126_0025929
607 Ga0501032_0079209
608 Ga0501033_0022656
609 Ga0501036_0373410
610 Ga0501038_0012964
611 Ga0501047_0029181
612 Ga0501047_0080659
613 Ga0501083_0124783
614 Ga0501044_0000286
615 nmdc:mga03n38_68164_c1
616 nmdc:mga00v17_22216_c1
617 nmdc:mga0yw44_52250_c1
618 nmdc:mga0k408_14178_c1
619 nmdc:mga05p37_395728_c1
620 nmdc:mga06r32_666178_c1
621 Ga0495601_0000020
622 Ga0495601_0003525
623 Ga0495601_0003562
624 Ga0495612_0000030
625 Ga0495612_0001208
626 Ga0495595_0000125
627 Ga0495619_0000216
628 Ga0495619_0004231
629 Ga0495619_0009736
630 Ga0495619_0167379
631 Ga0495619_0211277
632 Ga0500644_0000566
633 Ga0500651_0002219
634 Ga0500616_0000001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13174

TPR_6

Tetratricopeptide repeat

257

289

0.98

PF13525

YfiO

Outer membrane lipoprotein

81

282

0.97

PF13512

TPR_18

Tetratricopeptide repeat

76

211

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xev-assembly1.cif.gz_A crystal structure of the tpr domain of xanthomonas campestris ybgf 0.9228 60 186
2xev-assembly1.cif.gz_A crystal structure of the tpr domain of xanthomonas campestris ybgf 0.8942 60 186
5efr-assembly1.cif.gz_A crystal structure of a bama-bamd fusion 0.8904 53 275
7r1w-assembly1.cif.gz_D e. coli bam complex (bamabcde) bound to dynobactin a 0.8871 54 257
6lys-assembly1.cif.gz_D structure of the bam complex 0.886 54 255
ID Description Score Start End Superfamily
2xevB00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9297 60 187 1.25.40.10
2xevA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9228 60 186 1.25.40.10
af_Q8NEE8_59_141_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9058 57 143 1.25.40.10
2xevA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8942 60 186 1.25.40.10
2xevB00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8871 60 187 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A4Q3A7V5-F1-model_v4 Outer membrane protein assembly factor BamD 0.9778 55 278 GO:0009279
AF-A0A530H5R7-F1-model_v4 Outer membrane protein assembly factor BamD 0.9744 55 289 GO:0009279
AF-A0A257JB72-F1-model_v4 Outer membrane protein assembly factor BamD 0.9731 71 250 GO:0009279
AF-A0A3S1H8Z5-F1-model_v4 Outer membrane protein assembly factor BamD 0.9727 61 295 GO:0009279
AF-A0A0F9BBG7-F1-model_v4 Outer membrane lipoprotein BamD-like domain-containing protein 0.9705 128 292 GO:0009279

Map