F404235

General Info

Members Datasets Scaffolds Average Seq Length
317 170 634 380

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0017698|Ga0373944_0017698_262_1506
Length 414
Sequence MTTGLDLSSAHRFPNRFPDSVSFLDQMRTTGPPKGALPPLLKSLNERTVLEAIRDGAPISRAEISRRAGISKPTVSLALKALLEAGLVRESPDEVDGPTYGAVYFEPVPDAALVIGLDVGARFLRSAVCDLRGTIRARQDIELRPPATDAVLDVAPSLLASLLATTGVDSELVDAVIVGVPGVVDARSGTVRVTHLADLEGRAFGRELSERLSLPVTLENDVNLAALGEQWLGVARGVDDFVFLSVGTGLGAGLVLHGKLHRGHHGAAGEVDYALSGLTHDVDPSAGAVSSLASTLAAGDTTSLEPPFDVRGIFAAARGGDSVARAVVDEDARRIALHIAAVAAVADVELVVLGGGLGANGDLLLAPVRSLLAGWLPYPPRVEVSSLGEAAVLTGALAVGRLAALDNVFANRAR

Samples

Sample ID Description Type Environment
1 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
110 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 17.98
Rhizosphere 81.7
Stem 0
Stem Tuber 0
Unclassified 4.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373944_0017698 3300035089 Bacteria 2027
2 Ga0070658_10008431 3300005327 Bacteria 8289
3 Ga0070683_100000185 3300005329 Bacteria 41435
4 Ga0070683_100005441 3300005329 Bacteria 10637
5 Ga0070690_100172658 3300005330 Unclassified 1489
6 Ga0070680_100125367 3300005336 Bacteria 2146
7 Ga0070680_100202161 3300005336 Bacteria 1676
8 Ga0070682_100054442 3300005337 Bacteria 2510
9 Ga0070660_100005453 3300005339 Bacteria 8810
10 Ga0070660_100156962 3300005339 Bacteria 1832
11 Ga0070691_10124140 3300005341 Unclassified 1302
12 Ga0070687_100047009 3300005343 Bacteria 2212
13 Ga0070692_10014008 3300005345 Bacteria 3753
14 Ga0070692_10080727 3300005345 Bacteria 1751
15 Ga0070668_100008922 3300005347 Bacteria 7442
16 Ga0070668_100047002 3300005347 Bacteria 3317
17 Ga0070671_100283568 3300005355 Bacteria 1409
18 Ga0070674_100243720 3300005356 Unclassified 1409
19 Ga0070659_100321700 3300005366 Bacteria 1293
20 Ga0070709_10046563 3300005434 Bacteria 2697
21 Ga0070714_100013952 3300005435 Bacteria 6447
22 Ga0070714_100014527 3300005435 Bacteria 6328
23 Ga0070714_100024858 3300005435 Bacteria 4937
24 Ga0070714_100036610 3300005435 Bacteria 4116
25 Ga0070713_100029605 3300005436 Bacteria 4339
26 Ga0070713_100089803 3300005436 Bacteria 2640
27 Ga0070713_100169215 3300005436 Bacteria 1956
28 Ga0070710_10094798 3300005437 Bacteria 1767
29 Ga0070711_100120402 3300005439 Bacteria 1940
30 Ga0070705_100004640 3300005440 Bacteria 6691
31 Ga0070694_100024753 3300005444 Bacteria 3876
32 Ga0070708_100003130 3300005445 Bacteria 12880
33 Ga0070663_100012424 3300005455 Bacteria 5386
34 Ga0070678_100193134 3300005456 Bacteria 1675
35 Ga0070662_100059718 3300005457 Bacteria 2779
36 Ga0070681_10005372 3300005458 Bacteria 12371
37 Ga0068867_100080314 3300005459 Bacteria 2456
38 Ga0070706_100107451 3300005467 Unclassified 2596
39 Ga0070699_100121303 3300005518 Bacteria 2299
40 Ga0070679_100005891 3300005530 Bacteria 11388
41 Ga0070684_100000925 3300005535 Bacteria 20847
42 Ga0070686_100010694 3300005544 Bacteria 5187
43 Ga0070695_100008132 3300005545 Bacteria 6216
44 Ga0070696_100131012 3300005546 Bacteria 1825
45 Ga0070693_100032499 3300005547 Bacteria 2870
46 Ga0070693_100187236 3300005547 Bacteria 1336
47 Ga0068855_100310239 3300005563 Bacteria 1746
48 Ga0070664_100031113 3300005564 Bacteria 4456
49 Ga0068856_100006839 3300005614 Bacteria 11158
50 Ga0068856_100136275 3300005614 Bacteria 2460
51 Ga0068864_100044796 3300005618 Bacteria 3794
52 Ga0068861_100056240 3300005719 Bacteria 3002
53 Ga0068858_100184257 3300005842 Unclassified 1972
54 Ga0068860_100173609 3300005843 Bacteria 2083
55 Ga0068862_100099355 3300005844 Bacteria 2544
56 Ga0081455_10014592 3300005937 Bacteria 7690
57 Ga0081455_10066654 3300005937 Bacteria 3005
58 Ga0081455_10111364 3300005937 Bacteria 2175
59 Ga0081540_1003985 3300005983 Bacteria 11452
60 Ga0081540_1009927 3300005983 Bacteria 6492
61 Ga0081539_10002263 3300005985 Bacteria 27975
62 Ga0081539_10090871 3300005985 Bacteria 1578
63 Ga0070717_10076697 3300006028 Bacteria 2798
64 Ga0070717_10082869 3300006028 Bacteria 2696
65 Ga0075432_10014602 3300006058 Bacteria 2674
66 Ga0070715_10018904 3300006163 Bacteria 2633
67 Ga0070712_100019443 3300006175 Bacteria 4430
68 Ga0070712_100072535 3300006175 Bacteria 2466
69 Ga0075431_100087668 3300006847 Bacteria 3212
70 Ga0075433_10001182 3300006852 Bacteria 18987
71 Ga0075433_10089897 3300006852 Bacteria 2714
72 Ga0075434_100145956 3300006871 Bacteria 2386
73 Ga0075434_100164510 3300006871 Bacteria 2238
74 Ga0068865_100079237 3300006881 Bacteria 2352
75 Ga0075435_100020574 3300007076 Bacteria 5060
76 Ga0075435_100059265 3300007076 Bacteria 3103
77 Ga0075435_100094995 3300007076 Bacteria 2465
78 Ga0111539_10056626 3300009094 Bacteria 4659
79 Ga0111539_10081918 3300009094 Bacteria 3795
80 Ga0105245_10016386 3300009098 Bacteria 6464
81 Ga0105245_10117393 3300009098 Bacteria 2482
82 Ga0105245_10162468 3300009098 Bacteria 2120
83 Ga0105245_10170729 3300009098 Bacteria 2071
84 Ga0105245_10253714 3300009098 Unclassified 1710
85 Ga0105245_10257261 3300009098 Bacteria 1698
86 Ga0114129_10044991 3300009147 Bacteria 6207
87 Ga0114129_10483023 3300009147 Bacteria 1621
88 Ga0105243_10052302 3300009148 Bacteria 3234
89 Ga0105242_10236400 3300009176 Bacteria 1640
90 Ga0105248_10369179 3300009177 Bacteria 1616
91 Ga0105249_10070103 3300009553 Bacteria 3236
92 Ga0105239_10020559 3300010375 Bacteria 7282
93 Ga0105239_10076049 3300010375 Bacteria 3692
94 Ga0105239_10116087 3300010375 Bacteria 2970
95 Ga0105246_10142203 3300011119 Bacteria 1806
96 Ga0157371_10031936 3300013102 Bacteria 3791
97 Ga0157374_10024133 3300013296 Bacteria 5449
98 Ga0163162_10085071 3300013306 Bacteria 3239
99 Ga0163162_10121256 3300013306 Bacteria 2719
100 Ga0157375_10011694 3300013308 Bacteria 7756
101 Ga0163163_10003049 3300014325 Bacteria 14173
102 Ga0182008_10009762 3300014497 Bacteria 5165
103 Ga0182006_1004346 3300015261 Bacteria 7007
104 Ga0163161_10041215 3300017792 Bacteria 3318
105 Ga0163161_10077839 3300017792 Bacteria 2436
106 Ga0207688_10002768 3300025901 Bacteria 9507
107 Ga0207699_10025137 3300025906 Bacteria 3266
108 Ga0207699_10093674 3300025906 Bacteria 1891
109 Ga0207684_10064836 3300025910 Bacteria 3102
110 Ga0207707_10006468 3300025912 Bacteria 10230
111 Ga0207693_10004215 3300025915 Bacteria 12190
112 Ga0207693_10018626 3300025915 Bacteria 5527
113 Ga0207693_10022025 3300025915 Bacteria 5066
114 Ga0207663_10057994 3300025916 Bacteria 2442
115 Ga0207662_10032742 3300025918 Bacteria 3027
116 Ga0207657_10004529 3300025919 Bacteria 14685
117 Ga0207657_10019514 3300025919 Bacteria 6435
118 Ga0207652_10019692 3300025921 Bacteria 5552
119 Ga0207687_10021414 3300025927 Bacteria 4295
120 Ga0207687_10052954 3300025927 Bacteria 2834
121 Ga0207687_10060905 3300025927 Bacteria 2664
122 Ga0207700_10000004 3300025928 Bacteria 443409
123 Ga0207700_10150945 3300025928 Unclassified 1920
124 Ga0207664_10051000 3300025929 Bacteria 3265
125 Ga0207664_10052417 3300025929 Bacteria 3226
126 Ga0207664_10138831 3300025929 Bacteria 2054
127 Ga0207664_10182082 3300025929 Bacteria 1804
128 Ga0207706_10057100 3300025933 Bacteria 3440
129 Ga0207686_10145201 3300025934 Bacteria 1645
130 Ga0207709_10061504 3300025935 Bacteria 2347
131 Ga0207665_10025504 3300025939 Bacteria 3901
132 Ga0207665_10080961 3300025939 Bacteria 2234
133 Ga0207711_10084732 3300025941 Bacteria 2775
134 Ga0207661_10000836 3300025944 Bacteria 20171
135 Ga0207661_10030532 3300025944 Bacteria 4153
136 Ga0207661_10050834 3300025944 Bacteria 3305
137 Ga0207679_10013802 3300025945 Bacteria 5298
138 Ga0207667_10266431 3300025949 Bacteria 1752
139 Ga0207712_10238500 3300025961 Bacteria 1464
140 Ga0207712_10280914 3300025961 Unclassified 1359
141 Ga0207668_10061374 3300025972 Bacteria 2644
142 Ga0207668_10075924 3300025972 Bacteria 2418
143 Ga0207677_10194689 3300026023 Bacteria 1606
144 Ga0207639_10102277 3300026041 Bacteria 2319
145 Ga0207678_10014914 3300026067 Bacteria 6836
146 Ga0207708_10052660 3300026075 Bacteria 3100
147 Ga0207702_10002978 3300026078 Bacteria 15767
148 Ga0207702_10008207 3300026078 Bacteria 8827
149 Ga0207702_10113061 3300026078 Bacteria 2417
150 Ga0207702_10359673 3300026078 Bacteria 1395
151 Ga0207648_10018603 3300026089 Bacteria 6287
152 Ga0207648_10177772 3300026089 Bacteria 1883
153 Ga0207676_10016052 3300026095 Bacteria 5417
154 Ga0207675_100007801 3300026118 Bacteria 10098
155 Ga0207683_10010002 3300026121 Bacteria 8094
156 Ga0207683_10206831 3300026121 Bacteria 1785
157 Ga0207428_10001543 3300027907 Bacteria 24104
158 Ga0207428_10037430 3300027907 Bacteria 3947
159 Ga0268265_10140155 3300028380 Bacteria 2024
160 Ga0265320_10033361 3300031240 Bacteria 2629
161 Ga0307409_100030364 3300031995 Bacteria 3881
162 Ga0307416_100018526 3300032002 Bacteria 4907
163 Ga0307416_100119850 3300032002 Bacteria 2342
164 Ga0307416_100181843 3300032002 Bacteria 1971
165 Ga0373940_0023525 3300035088 Bacteria 1591
166 Ga0373949_0029981 3300035090 Bacteria 1291
167 Ga0373927_0070984 3300035695 Bacteria 2254
168 Ga0373947_0001648 3300035725 Bacteria 13661
169 Ga0373947_0155466 3300035725 Bacteria 1476
170 Ga0373925_0001380 3300037068 Bacteria 21135
171 Ga0373925_0039216 3300037068 Bacteria 3504
172 Ga0395899_0001266 3300037312 Bacteria 21971
173 Ga0395899_0003558 3300037312 Bacteria 12338
174 Ga0395899_0004681 3300037312 Bacteria 10678
175 Ga0395899_0012594 3300037312 Bacteria 6483
176 Ga0395899_0103478 3300037312 Bacteria 2054
177 Ga0395899_0171159 3300037312 Unclassified 1529
178 Ga0395900_0005507 3300037418 Bacteria 13251
179 Ga0395900_0007933 3300037418 Bacteria 10927
180 Ga0395900_0009887 3300037418 Bacteria 9769
181 Ga0395900_0058433 3300037418 Bacteria 3970
182 Ga0395900_0138460 3300037418 Bacteria 2493
183 Ga0395900_0258166 3300037418 Unclassified 1741
184 Ga0395898_0004029 3300037466 Bacteria 16152
185 Ga0395898_0005273 3300037466 Bacteria 13973
186 Ga0395898_0005903 3300037466 Bacteria 13165
187 Ga0395898_0007310 3300037466 Bacteria 11724
188 Ga0395898_0061839 3300037466 Bacteria 3637
189 Ga0395898_0082627 3300037466 Bacteria 3096
190 Ga0395898_0086903 3300037466 Bacteria 3013
191 Ga0395898_0180020 3300037466 Bacteria 2020
192 Ga0395898_0222661 3300037466 Bacteria 1799
193 Ga0395905_0008308 3300037471 Bacteria 10242
194 Ga0395905_0033587 3300037471 Bacteria 4818
195 Ga0395905_0120388 3300037471 Bacteria 2467
196 Ga0395905_0120572 3300037471 Bacteria 2465
197 Ga0395905_0259968 3300037471 Bacteria 1621
198 Ga0395901_0002714 3300038443 Bacteria 17827
199 Ga0395901_0003540 3300038443 Bacteria 15740
200 Ga0395901_0020511 3300038443 Bacteria 6763
201 Ga0395901_0023204 3300038443 Bacteria 6360
202 Ga0395901_0032949 3300038443 Bacteria 5345
203 Ga0395901_0056652 3300038443 Bacteria 4077
204 Ga0395901_0090847 3300038443 Bacteria 3196
205 Ga0395901_0115261 3300038443 Bacteria 2822
206 Ga0395901_0161095 3300038443 Bacteria 2356
207 Ga0395901_0361417 3300038443 Bacteria 1497
208 Ga0439446_0003076 3300042156 Bacteria 4094
209 Ga0466963_0000595 3300044694 Bacteria 17248
210 Ga0466964_0012288 3300044706 Bacteria 3240
211 Ga0451576_0008435 3300045051 Bacteria 12098
212 Ga0466967_0021678 3300045976 Bacteria 5226
213 Ga0466967_0115897 3300045976 Bacteria 2468
214 Ga0466967_0118360 3300045976 Bacteria 2443
215 Ga0466967_0137497 3300045976 Bacteria 2273
216 Ga0466967_0170112 3300045976 Bacteria 2049
217 Ga0466967_0308913 3300045976 Bacteria 1523
218 Ga0495592_0118049 3300046454 Unclassified 1869
219 Ga0495603_0000833 3300046455 Bacteria 17713
220 Ga0495603_0047933 3300046455 Bacteria 2544
221 Ga0495629_0024931 3300046459 Bacteria 4254
222 Ga0495641_0001074 3300046461 Bacteria 23533
223 Ga0495641_0016918 3300046461 Bacteria 3821
224 Ga0495582_0087837 3300046473 Bacteria 1731
225 Ga0495605_0091480 3300046474 Bacteria 1409
226 Ga0495594_0000790 3300046499 Bacteria 16333
227 Ga0495596_0044130 3300046500 Bacteria 1756
228 Ga0495608_0098151 3300046511 Bacteria 1890
229 Ga0495586_0012060 3300046535 Bacteria 4591
230 Ga0495667_0077086 3300046559 Bacteria 2168
231 Ga0495588_0000390 3300046674 Bacteria 24919
232 Ga0495657_0056920 3300046675 Bacteria 2601
233 Ga0495624_0035519 3300046690 Bacteria 3218
234 Ga0495589_0108788 3300046794 Unclassified 1339
235 Ga0495600_0057983 3300046809 Bacteria 2529
236 Ga0495581_0004507 3300047315 Bacteria 8050
237 Ga0495674_0083354 3300047319 Bacteria 2741
238 Ga0495676_0000419 3300047321 Bacteria 34533
239 Ga0495676_0064422 3300047321 Bacteria 2850
240 Ga0495680_0044702 3300047322 Bacteria 3501
241 Ga0495680_0045518 3300047322 Bacteria 3464
242 Ga0495675_0021001 3300047444 Bacteria 4157
243 Ga0496100_0035935 3300048903 Bacteria 3120
244 Ga0496101_0178882 3300048904 Bacteria 1633
245 Ga0496101_0383356 3300048904 Bacteria 1106
246 Ga0496102_0002190 3300048905 Bacteria 16767
247 Ga0496102_0029378 3300048905 Bacteria 4920
248 Ga0496102_0055711 3300048905 Bacteria 3605
249 Ga0496102_0061067 3300048905 Bacteria 3448
250 Ga0496102_0152929 3300048905 Bacteria 2169
251 Ga0496102_0286903 3300048905 Bacteria 1551
252 Ga0496103_0008382 3300048906 Bacteria 6141
253 Ga0496103_0136597 3300048906 Unclassified 1567
254 Ga0496104_0000941 3300048907 Bacteria 25013
255 Ga0496104_0005450 3300048907 Bacteria 11138
256 Ga0496104_0051241 3300048907 Bacteria 3895
257 Ga0496104_0071140 3300048907 Bacteria 3307
258 Ga0496104_0202346 3300048907 Bacteria 1898
259 Ga0496105_0000337 3300048908 Bacteria 30737
260 Ga0496105_0026695 3300048908 Bacteria 4713
261 Ga0496105_0066637 3300048908 Bacteria 2973
262 Ga0496105_0193357 3300048908 Bacteria 1663
263 Ga0496106_0008769 3300048909 Bacteria 7473
264 Ga0496106_0011814 3300048909 Bacteria 6446
265 Ga0496107_0065604 3300048910 Bacteria 2632
266 Ga0496108_0001637 3300048911 Bacteria 17747
267 Ga0496108_0040206 3300048911 Bacteria 3897
268 Ga0496109_0004131 3300048912 Bacteria 12127
269 Ga0496109_0014522 3300048912 Bacteria 6850
270 Ga0496109_0027916 3300048912 Bacteria 5045
271 Ga0496109_0045664 3300048912 Bacteria 3976
272 Ga0496109_0065899 3300048912 Bacteria 3316
273 Ga0496110_0003131 3300048913 Bacteria 12568
274 Ga0496110_0015387 3300048913 Bacteria 6364
275 Ga0496110_0032368 3300048913 Bacteria 4515
276 Ga0496110_0040872 3300048913 Bacteria 4044
277 Ga0496110_0052585 3300048913 Bacteria 3579
278 Ga0496110_0087856 3300048913 Bacteria 2776
279 Ga0496110_0300617 3300048913 Bacteria 1462
280 Ga0496111_0000636 3300048914 Bacteria 18491
281 Ga0496111_0001586 3300048914 Bacteria 13130
282 Ga0496111_0012700 3300048914 Bacteria 5709
283 Ga0496111_0039381 3300048914 Bacteria 3388
284 Ga0496111_0051437 3300048914 Bacteria 2974
285 Ga0496111_0099454 3300048914 Bacteria 2136
286 Ga0496111_0110701 3300048914 Bacteria 2022
287 Ga0496111_0122331 3300048914 Bacteria 1922
288 Ga0496112_0010093 3300048915 Bacteria 8551
289 Ga0496112_0042072 3300048915 Bacteria 4470
290 Ga0496112_0053148 3300048915 Bacteria 3977
291 Ga0496112_0059348 3300048915 Bacteria 3769
292 Ga0496112_0119533 3300048915 Bacteria 2605
293 Ga0496112_0173017 3300048915 Bacteria 2125
294 Ga0496113_0003539 3300048916 Bacteria 9367
295 Ga0496113_0037368 3300048916 Bacteria 3563
296 Ga0496113_0053864 3300048916 Bacteria 3009
297 Ga0496113_0195110 3300048916 Bacteria 1608
298 Ga0496114_0000488 3300048917 Bacteria 29107
299 Ga0496114_0102043 3300048917 Unclassified 2450
300 nmdc:mga0yw44_194542_c1 3300050492 Bacteria 1338
301 nmdc:mga05p37_48671_c1 3300050507 Bacteria 5213
302 nmdc:mga05p37_59251_c1 3300050507 Bacteria 4715
303 nmdc:mga06r32_131822_c1 3300050510 Bacteria 2472
304 nmdc:mga08y16_47263_c1 3300050511 Bacteria 4505
305 nmdc:mga08y16_95488_c1 3300050511 Bacteria 3097
306 nmdc:mga0n895_109329_c1 3300050512 Bacteria 2780
307 nmdc:mga0n895_34070_c1 3300050512 Bacteria 4900
308 nmdc:mga0n895_78642_c1 3300050512 Bacteria 3283
309 nmdc:mga0rr50_36103_c1 3300050513 Bacteria 3556
310 nmdc:mga0rr50_5908_c1 3300050513 Bacteria 7365
311 nmdc:mga0rr50_79773_c1 3300050513 Bacteria 2522
312 nmdc:mga08x19_14136_c1 3300050514 Bacteria 4837
313 nmdc:mga0a205_26423_c1 3300050515 Bacteria 5536
314 nmdc:mga0a205_44886_c1 3300050515 Bacteria 4262
315 Ga0495601_0046772 3300053077 Bacteria 2724
316 Ga0495595_0013963 3300053084 Bacteria 3401
317 Ga0530510_0145357 3300061734 Bacteria 1749
318 Ga0373944_0017698
319 Ga0070658_10008431
320 Ga0070683_100000185
321 Ga0070683_100005441
322 Ga0070690_100172658
323 Ga0070680_100125367
324 Ga0070680_100202161
325 Ga0070682_100054442
326 Ga0070660_100005453
327 Ga0070660_100156962
328 Ga0070691_10124140
329 Ga0070687_100047009
330 Ga0070692_10014008
331 Ga0070692_10080727
332 Ga0070668_100008922
333 Ga0070668_100047002
334 Ga0070671_100283568
335 Ga0070674_100243720
336 Ga0070659_100321700
337 Ga0070709_10046563
338 Ga0070714_100013952
339 Ga0070714_100014527
340 Ga0070714_100024858
341 Ga0070714_100036610
342 Ga0070713_100029605
343 Ga0070713_100089803
344 Ga0070713_100169215
345 Ga0070710_10094798
346 Ga0070711_100120402
347 Ga0070705_100004640
348 Ga0070694_100024753
349 Ga0070708_100003130
350 Ga0070663_100012424
351 Ga0070678_100193134
352 Ga0070662_100059718
353 Ga0070681_10005372
354 Ga0068867_100080314
355 Ga0070706_100107451
356 Ga0070699_100121303
357 Ga0070679_100005891
358 Ga0070684_100000925
359 Ga0070686_100010694
360 Ga0070695_100008132
361 Ga0070696_100131012
362 Ga0070693_100032499
363 Ga0070693_100187236
364 Ga0068855_100310239
365 Ga0070664_100031113
366 Ga0068856_100006839
367 Ga0068856_100136275
368 Ga0068864_100044796
369 Ga0068861_100056240
370 Ga0068858_100184257
371 Ga0068860_100173609
372 Ga0068862_100099355
373 Ga0081455_10014592
374 Ga0081455_10066654
375 Ga0081455_10111364
376 Ga0081540_1003985
377 Ga0081540_1009927
378 Ga0081539_10002263
379 Ga0081539_10090871
380 Ga0070717_10076697
381 Ga0070717_10082869
382 Ga0075432_10014602
383 Ga0070715_10018904
384 Ga0070712_100019443
385 Ga0070712_100072535
386 Ga0075431_100087668
387 Ga0075433_10001182
388 Ga0075433_10089897
389 Ga0075434_100145956
390 Ga0075434_100164510
391 Ga0068865_100079237
392 Ga0075435_100020574
393 Ga0075435_100059265
394 Ga0075435_100094995
395 Ga0111539_10056626
396 Ga0111539_10081918
397 Ga0105245_10016386
398 Ga0105245_10117393
399 Ga0105245_10162468
400 Ga0105245_10170729
401 Ga0105245_10253714
402 Ga0105245_10257261
403 Ga0114129_10044991
404 Ga0114129_10483023
405 Ga0105243_10052302
406 Ga0105242_10236400
407 Ga0105248_10369179
408 Ga0105249_10070103
409 Ga0105239_10020559
410 Ga0105239_10076049
411 Ga0105239_10116087
412 Ga0105246_10142203
413 Ga0157371_10031936
414 Ga0157374_10024133
415 Ga0163162_10085071
416 Ga0163162_10121256
417 Ga0157375_10011694
418 Ga0163163_10003049
419 Ga0182008_10009762
420 Ga0182006_1004346
421 Ga0163161_10041215
422 Ga0163161_10077839
423 Ga0207688_10002768
424 Ga0207699_10025137
425 Ga0207699_10093674
426 Ga0207684_10064836
427 Ga0207707_10006468
428 Ga0207693_10004215
429 Ga0207693_10018626
430 Ga0207693_10022025
431 Ga0207663_10057994
432 Ga0207662_10032742
433 Ga0207657_10004529
434 Ga0207657_10019514
435 Ga0207652_10019692
436 Ga0207687_10021414
437 Ga0207687_10052954
438 Ga0207687_10060905
439 Ga0207700_10000004
440 Ga0207700_10150945
441 Ga0207664_10051000
442 Ga0207664_10052417
443 Ga0207664_10138831
444 Ga0207664_10182082
445 Ga0207706_10057100
446 Ga0207686_10145201
447 Ga0207709_10061504
448 Ga0207665_10025504
449 Ga0207665_10080961
450 Ga0207711_10084732
451 Ga0207661_10000836
452 Ga0207661_10030532
453 Ga0207661_10050834
454 Ga0207679_10013802
455 Ga0207667_10266431
456 Ga0207712_10238500
457 Ga0207712_10280914
458 Ga0207668_10061374
459 Ga0207668_10075924
460 Ga0207677_10194689
461 Ga0207639_10102277
462 Ga0207678_10014914
463 Ga0207708_10052660
464 Ga0207702_10002978
465 Ga0207702_10008207
466 Ga0207702_10113061
467 Ga0207702_10359673
468 Ga0207648_10018603
469 Ga0207648_10177772
470 Ga0207676_10016052
471 Ga0207675_100007801
472 Ga0207683_10010002
473 Ga0207683_10206831
474 Ga0207428_10001543
475 Ga0207428_10037430
476 Ga0268265_10140155
477 Ga0265320_10033361
478 Ga0307409_100030364
479 Ga0307416_100018526
480 Ga0307416_100119850
481 Ga0307416_100181843
482 Ga0373940_0023525
483 Ga0373949_0029981
484 Ga0373927_0070984
485 Ga0373947_0001648
486 Ga0373947_0155466
487 Ga0373925_0001380
488 Ga0373925_0039216
489 Ga0395899_0001266
490 Ga0395899_0003558
491 Ga0395899_0004681
492 Ga0395899_0012594
493 Ga0395899_0103478
494 Ga0395899_0171159
495 Ga0395900_0005507
496 Ga0395900_0007933
497 Ga0395900_0009887
498 Ga0395900_0058433
499 Ga0395900_0138460
500 Ga0395900_0258166
501 Ga0395898_0004029
502 Ga0395898_0005273
503 Ga0395898_0005903
504 Ga0395898_0007310
505 Ga0395898_0061839
506 Ga0395898_0082627
507 Ga0395898_0086903
508 Ga0395898_0180020
509 Ga0395898_0222661
510 Ga0395905_0008308
511 Ga0395905_0033587
512 Ga0395905_0120388
513 Ga0395905_0120572
514 Ga0395905_0259968
515 Ga0395901_0002714
516 Ga0395901_0003540
517 Ga0395901_0020511
518 Ga0395901_0023204
519 Ga0395901_0032949
520 Ga0395901_0056652
521 Ga0395901_0090847
522 Ga0395901_0115261
523 Ga0395901_0161095
524 Ga0395901_0361417
525 Ga0439446_0003076
526 Ga0466963_0000595
527 Ga0466964_0012288
528 Ga0451576_0008435
529 Ga0466967_0021678
530 Ga0466967_0115897
531 Ga0466967_0118360
532 Ga0466967_0137497
533 Ga0466967_0170112
534 Ga0466967_0308913
535 Ga0495592_0118049
536 Ga0495603_0000833
537 Ga0495603_0047933
538 Ga0495629_0024931
539 Ga0495641_0001074
540 Ga0495641_0016918
541 Ga0495582_0087837
542 Ga0495605_0091480
543 Ga0495594_0000790
544 Ga0495596_0044130
545 Ga0495608_0098151
546 Ga0495586_0012060
547 Ga0495667_0077086
548 Ga0495588_0000390
549 Ga0495657_0056920
550 Ga0495624_0035519
551 Ga0495589_0108788
552 Ga0495600_0057983
553 Ga0495581_0004507
554 Ga0495674_0083354
555 Ga0495676_0000419
556 Ga0495676_0064422
557 Ga0495680_0044702
558 Ga0495680_0045518
559 Ga0495675_0021001
560 Ga0496100_0035935
561 Ga0496101_0178882
562 Ga0496101_0383356
563 Ga0496102_0002190
564 Ga0496102_0029378
565 Ga0496102_0055711
566 Ga0496102_0061067
567 Ga0496102_0152929
568 Ga0496102_0286903
569 Ga0496103_0008382
570 Ga0496103_0136597
571 Ga0496104_0000941
572 Ga0496104_0005450
573 Ga0496104_0051241
574 Ga0496104_0071140
575 Ga0496104_0202346
576 Ga0496105_0000337
577 Ga0496105_0026695
578 Ga0496105_0066637
579 Ga0496105_0193357
580 Ga0496106_0008769
581 Ga0496106_0011814
582 Ga0496107_0065604
583 Ga0496108_0001637
584 Ga0496108_0040206
585 Ga0496109_0004131
586 Ga0496109_0014522
587 Ga0496109_0027916
588 Ga0496109_0045664
589 Ga0496109_0065899
590 Ga0496110_0003131
591 Ga0496110_0015387
592 Ga0496110_0032368
593 Ga0496110_0040872
594 Ga0496110_0052585
595 Ga0496110_0087856
596 Ga0496110_0300617
597 Ga0496111_0000636
598 Ga0496111_0001586
599 Ga0496111_0012700
600 Ga0496111_0039381
601 Ga0496111_0051437
602 Ga0496111_0099454
603 Ga0496111_0110701
604 Ga0496111_0122331
605 Ga0496112_0010093
606 Ga0496112_0042072
607 Ga0496112_0053148
608 Ga0496112_0059348
609 Ga0496112_0119533
610 Ga0496112_0173017
611 Ga0496113_0003539
612 Ga0496113_0037368
613 Ga0496113_0053864
614 Ga0496113_0195110
615 Ga0496114_0000488
616 Ga0496114_0102043
617 nmdc:mga0yw44_194542_c1
618 nmdc:mga05p37_48671_c1
619 nmdc:mga05p37_59251_c1
620 nmdc:mga06r32_131822_c1
621 nmdc:mga08y16_47263_c1
622 nmdc:mga08y16_95488_c1
623 nmdc:mga0n895_109329_c1
624 nmdc:mga0n895_34070_c1
625 nmdc:mga0n895_78642_c1
626 nmdc:mga0rr50_36103_c1
627 nmdc:mga0rr50_5908_c1
628 nmdc:mga0rr50_79773_c1
629 nmdc:mga08x19_14136_c1
630 nmdc:mga0a205_26423_c1
631 nmdc:mga0a205_44886_c1
632 Ga0495601_0046772
633 Ga0495595_0013963
634 Ga0530510_0145357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

46

91

0.95

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

43

89

0.95

PF09339

HTH_IclR

IclR helix-turn-helix domain

48

92

0.93

PF12802

MarR_2

MarR family

43

97

0.93

PF01047

MarR

MarR family

42

97

0.92

PF00480

ROK

ROK family

114

404

0.87

PF01022

HTH_5

Bacterial regulatory protein, arsR family

47

90

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9618 7 49
5hso-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis marr family protein rv2887 complex with dna 0.9519 12 55
5hso-assembly1.cif.gz_D crystal structure of mycobacterium tuberculosis marr family protein rv2887 complex with dna 0.9505 12 55
2fa5-assembly1.cif.gz_B the crystal structure of an unliganded multiple antibiotic-resistance repressor (marr) from xanthomonas campestris 0.9411 11 55
3nrv-assembly1.cif.gz_A crystal structure of marr/emrr family transcriptional regulator from acinetobacter sp. adp1 0.9374 12 55
ID Description Score Start End Superfamily
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9825 11 73 1.10.10.10
5dukB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9618 7 49 1.10.10.10
3bp8A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9578 6 56 1.10.10.10
3vb2B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9496 12 55 1.10.10.10
1z6rD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9459 7 56 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538CBQ9-F1-model_v4 ROK family protein 0.9623 73 376 GO:0003824
AF-A0A1H9T413-F1-model_v4 Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain 0.9301 8 378 GO:0003677
GO:0006355
GO:0016301
AF-A0A2V9JZQ4-F1-model_v4 ROK family protein 0.9239 152 365 GO:0003824
AF-A0A2V9Q447-F1-model_v4 Sugar kinase 0.9232 1 381 GO:0016301
AF-A0A1H9T413-F1-model_v4 Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain 0.9205 8 378 GO:0003677
GO:0006355
GO:0016301

Map