F403980

General Info

Members Datasets Scaffolds Average Seq Length
317 188 634 130

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10060111|rootH1_100601113
Length 157
Sequence LYTSSPLLNPCQNFIFEEIRQEENTMSNNEKSDKLRIDKYLWSIRLFKTRSLAATACDSGKVKQEGNAVKAAKQVHVGDEYDVRTEGRLWRIKVTGLLHNRVQYSEAIKYYTDITPAEELERLQFQRQASSFHTGKRLSKVGRPTKKERRDLDEFMD

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
125 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
126 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
127 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
128 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
164 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
168 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
169 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
170 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
171 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
172 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
173 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
174 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
175 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
176 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
177 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
182 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
183 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
184 2738541278 Niastella sp. CF465 Isolate Unclassified
185 2818991444 Filimonas endophytica 3197 Isolate Unclassified
186 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
187 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
188 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.2
Nodule 0
Rhizoplane 3.15
Rhizosphere 82.97
Stem 0
Stem Tuber 0
Unclassified 21.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10060111 3300003323 Bacteria 3913
2 JGI24739J22299_10024844 3300001989 Bacteria 2110
3 JGI25153J46596_10022576 3300003215 Bacteria 2314
4 rootL2_10003615 3300003322 Bacteria 2913
5 rootH1_10015677 3300003323 Bacteria 8000
6 rootH1_10043167 3300003323 Bacteria 3532
7 Ga0065712_10250696 3300005290 Bacteria 961
8 Ga0065712_10757403 3300005290 Unclassified 503
9 Ga0070658_10000176 3300005327 Bacteria 56043
10 Ga0070658_10682994 3300005327 Unclassified 891
11 Ga0070676_10000034 3300005328 Bacteria 41415
12 Ga0070683_100058160 3300005329 Bacteria 3592
13 Ga0070683_100720225 3300005329 Bacteria 956
14 Ga0070683_101025540 3300005329 Bacteria 792
15 Ga0070690_100777234 3300005330 Bacteria 741
16 Ga0070670_100104648 3300005331 Bacteria 2438
17 Ga0070670_100707710 3300005331 Unclassified 906
18 Ga0070670_101106236 3300005331 Bacteria 723
19 Ga0068869_100101426 3300005334 Bacteria 2177
20 Ga0070666_10000437 3300005335 Bacteria 25520
21 Ga0070666_10279645 3300005335 Bacteria 1186
22 Ga0070666_10437742 3300005335 Unclassified 943
23 Ga0070680_100136022 3300005336 Bacteria 2059
24 Ga0070682_100000005 3300005337 Bacteria 386439
25 Ga0070682_100281097 3300005337 Bacteria 1213
26 Ga0068868_100001305 3300005338 Bacteria 17174
27 Ga0068868_100892605 3300005338 Unclassified 807
28 Ga0068868_100898591 3300005338 Bacteria 805
29 Ga0070660_100129406 3300005339 Bacteria 2019
30 Ga0070689_100458848 3300005340 Unclassified 1085
31 Ga0070661_100351708 3300005344 Bacteria 1156
32 Ga0070661_101783565 3300005344 Unclassified 522
33 Ga0070668_100000087 3300005347 Bacteria 57426
34 Ga0070675_100044653 3300005354 Bacteria 3624
35 Ga0070675_100624685 3300005354 Bacteria 978
36 Ga0070671_100141631 3300005355 Bacteria 2029
37 Ga0070671_100207291 3300005355 Bacteria 1663
38 Ga0070673_100000074 3300005364 Bacteria 42660
39 Ga0070673_100122747 3300005364 Bacteria 2170
40 Ga0070659_100422579 3300005366 Viruses 1127
41 Ga0070667_100000031 3300005367 Bacteria 177447
42 Ga0070663_100941236 3300005455 Unclassified 748
43 Ga0070678_100895391 3300005456 Unclassified 811
44 Ga0070662_100043302 3300005457 Bacteria 3220
45 Ga0068867_100006590 3300005459 Bacteria 8208
46 Ga0068867_100518831 3300005459 Bacteria 1027
47 Ga0068867_101157964 3300005459 Bacteria 708
48 Ga0068867_102027806 3300005459 Bacteria 544
49 Ga0070706_101087797 3300005467 Bacteria 736
50 Ga0070684_100034750 3300005535 Bacteria 4311
51 Ga0070684_100062911 3300005535 Bacteria 3252
52 Ga0068853_100012420 3300005539 Bacteria 6927
53 Ga0068853_101938860 3300005539 Unclassified 571
54 Ga0070672_100000002 3300005543 Bacteria 159809
55 Ga0070672_100452560 3300005543 Unclassified 1106
56 Ga0070686_100366059 3300005544 Bacteria 1087
57 Ga0070693_100297473 3300005547 Bacteria 1087
58 Ga0070665_100000222 3300005548 Bacteria 94961
59 Ga0068855_100056937 3300005563 Bacteria 4584
60 Ga0070664_100003850 3300005564 Bacteria 12110
61 Ga0068857_100659467 3300005577 Bacteria 992
62 Ga0068857_101314324 3300005577 Unclassified 702
63 Ga0068854_101063864 3300005578 Unclassified 719
64 Ga0070702_101679965 3300005615 Unclassified 527
65 Ga0068852_100145128 3300005616 Unclassified 2200
66 Ga0068852_101085323 3300005616 Bacteria 820
67 Ga0068864_100008795 3300005618 Bacteria 8326
68 Ga0068864_101480625 3300005618 Unclassified 682
69 Ga0068866_11236162 3300005718 Bacteria 540
70 Ga0068861_100037086 3300005719 Bacteria 3623
71 Ga0068851_10000267 3300005834 Bacteria 24476
72 Ga0068851_10142374 3300005834 Unclassified 1305
73 Ga0068851_10602846 3300005834 Bacteria 668
74 Ga0068858_102233240 3300005842 Unclassified 541
75 Ga0068860_100005968 3300005843 Bacteria 12256
76 Ga0068860_100409759 3300005843 Bacteria 1342
77 Ga0097621_100035981 3300006237 Bacteria 3958
78 Ga0097621_100265837 3300006237 Bacteria 1506
79 Ga0097621_100731402 3300006237 Bacteria 913
80 Ga0097621_100827275 3300006237 Unclassified 859
81 Ga0068871_100004279 3300006358 Bacteria 9904
82 Ga0068871_100005842 3300006358 Bacteria 8651
83 Ga0068871_100848359 3300006358 Bacteria 844
84 Ga0068871_102024833 3300006358 Bacteria 548
85 Ga0068871_102308913 3300006358 Bacteria 513
86 Ga0068865_100003834 3300006881 Bacteria 9016
87 Ga0105240_10424873 3300009093 Unclassified 1492
88 Ga0111539_10773800 3300009094 Bacteria 1117
89 Ga0105245_10246823 3300009098 Bacteria 1733
90 Ga0105243_10187583 3300009148 Unclassified 1803
91 Ga0105241_10471850 3300009174 Bacteria 1114
92 Ga0105242_10009613 3300009176 Bacteria 7414
93 Ga0105242_10130545 3300009176 Bacteria 2168
94 Ga0105248_10064839 3300009177 Bacteria 4101
95 Ga0105237_10266917 3300009545 Bacteria 1714
96 Ga0105237_10439546 3300009545 Unclassified 1310
97 Ga0105238_10164857 3300009551 Unclassified 2191
98 Ga0105249_10004261 3300009553 Bacteria 12362
99 Ga0105239_10118502 3300010375 Bacteria 2938
100 Ga0105239_10421218 3300010375 Bacteria 1513
101 Ga0105246_10045180 3300011119 Bacteria 2998
102 Ga0157371_10016990 3300013102 Bacteria 5416
103 Ga0157371_10080119 3300013102 Bacteria 2313
104 Ga0157371_10119400 3300013102 Bacteria 1874
105 Ga0157371_10184508 3300013102 Bacteria 1493
106 Ga0157371_10692529 3300013102 Bacteria 762
107 Ga0157370_10097252 3300013104 Bacteria 2761
108 Ga0157370_11972322 3300013104 Unclassified 523
109 Ga0157369_10055525 3300013105 Bacteria 4275
110 Ga0157369_10162825 3300013105 Bacteria 2354
111 Ga0157374_10001136 3300013296 Bacteria 22799
112 Ga0157374_10013137 3300013296 Bacteria 7223
113 Ga0157374_10165412 3300013296 Bacteria 2155
114 Ga0157374_10237224 3300013296 Bacteria 1793
115 Ga0157374_11260577 3300013296 Bacteria 761
116 Ga0157374_11313566 3300013296 Bacteria 745
117 Ga0157374_11487658 3300013296 Bacteria 700
118 Ga0157378_10053645 3300013297 Bacteria 3590
119 Ga0157378_10070588 3300013297 Bacteria 3137
120 Ga0157378_11185870 3300013297 Bacteria 803
121 Ga0157378_12375910 3300013297 Unclassified 582
122 Ga0163162_10000029 3300013306 Bacteria 168510
123 Ga0163162_10000576 3300013306 Bacteria 33923
124 Ga0163162_10017733 3300013306 Bacteria 6966
125 Ga0163162_10216371 3300013306 Bacteria 2046
126 Ga0163162_10241517 3300013306 Bacteria 1937
127 Ga0163162_11160500 3300013306 Bacteria 876
128 Ga0163162_12184470 3300013306 Unclassified 635
129 Ga0163162_12288327 3300013306 Unclassified 621
130 Ga0157372_10021979 3300013307 Bacteria 6896
131 Ga0157372_10083446 3300013307 Bacteria 3620
132 Ga0157372_10303421 3300013307 Bacteria 1858
133 Ga0157372_10586440 3300013307 Unclassified 1299
134 Ga0157372_11298726 3300013307 Unclassified 840
135 Ga0157375_10000042 3300013308 Bacteria 160008
136 Ga0157375_11366168 3300013308 Bacteria 834
137 Ga0157375_13595896 3300013308 Unclassified 516
138 Ga0163163_10000174 3300014325 Bacteria 67568
139 Ga0163163_10409851 3300014325 Bacteria 1414
140 Ga0163163_10945000 3300014325 Unclassified 925
141 Ga0157380_10911333 3300014326 Bacteria 906
142 Ga0157380_11176193 3300014326 Bacteria 809
143 Ga0157380_11751942 3300014326 Unclassified 680
144 Ga0157377_10017457 3300014745 Bacteria 3712
145 Ga0157379_10000080 3300014968 Bacteria 63139
146 Ga0157379_10206184 3300014968 Bacteria 1778
147 Ga0157379_11139079 3300014968 Bacteria 748
148 Ga0157379_11420173 3300014968 Bacteria 673
149 Ga0157379_12299281 3300014968 Unclassified 537
150 Ga0157376_10000521 3300014969 Bacteria 24829
151 Ga0157376_10019036 3300014969 Bacteria 5281
152 Ga0157376_10032269 3300014969 Bacteria 4203
153 Ga0157376_10327634 3300014969 Unclassified 1458
154 Ga0157376_10633508 3300014969 Bacteria 1068
155 Ga0157376_10979623 3300014969 Bacteria 867
156 Ga0157376_12551005 3300014969 Bacteria 551
157 Ga0157376_12772449 3300014969 Bacteria 530
158 Ga0163161_10077471 3300017792 Bacteria 2442
159 Ga0163161_10723749 3300017792 Unclassified 830
160 Ga0163161_11167625 3300017792 Bacteria 664
161 Ga0163161_11558878 3300017792 Bacteria 581
162 Ga0213876_10083498 3300021384 Bacteria 1690
163 Ga0213876_10376151 3300021384 Bacteria 755
164 Ga0209758_1030531 3300025297 Bacteria 2230
165 Ga0207426_1000293 3300025302 Bacteria 98805
166 Ga0207426_1041502 3300025302 Bacteria 1426
167 Ga0207697_10120126 3300025315 Unclassified 1130
168 Ga0207697_10449857 3300025315 Bacteria 571
169 Ga0207656_10289006 3300025321 Unclassified 810
170 Ga0207656_10402409 3300025321 Unclassified 688
171 Ga0207680_10000657 3300025903 Bacteria 16337
172 Ga0207680_10253626 3300025903 Bacteria 1216
173 Ga0207645_10000337 3300025907 Bacteria 39173
174 Ga0207705_10001116 3300025909 Bacteria 21828
175 Ga0207654_10326361 3300025911 Unclassified 1050
176 Ga0207695_10664053 3300025913 Unclassified 923
177 Ga0207671_10532969 3300025914 Unclassified 936
178 Ga0207657_10160387 3300025919 Bacteria 1827
179 Ga0207649_10092336 3300025920 Bacteria 1985
180 Ga0207649_11280874 3300025920 Unclassified 580
181 Ga0207652_10772445 3300025921 Bacteria 854
182 Ga0207694_10199644 3300025924 Unclassified 1627
183 Ga0207650_10051066 3300025925 Bacteria 3059
184 Ga0207650_10705877 3300025925 Bacteria 852
185 Ga0207659_10863631 3300025926 Bacteria 778
186 Ga0207659_11075990 3300025926 Unclassified 692
187 Ga0207687_10261596 3300025927 Bacteria 1379
188 Ga0207644_10101514 3300025931 Bacteria 2162
189 Ga0207644_10422644 3300025931 Unclassified 1092
190 Ga0207644_11582647 3300025931 Bacteria 550
191 Ga0207706_10004551 3300025933 Bacteria 13017
192 Ga0207686_10015430 3300025934 Bacteria 4271
193 Ga0207709_10126114 3300025935 Unclassified 1736
194 Ga0207691_10000004 3300025940 Bacteria 168729
195 Ga0207691_10260930 3300025940 Bacteria 1494
196 Ga0207691_10392613 3300025940 Bacteria 1184
197 Ga0207691_10567685 3300025940 Bacteria 962
198 Ga0207711_10170645 3300025941 Unclassified 1974
199 Ga0207661_10492712 3300025944 Bacteria 1119
200 Ga0207679_10004909 3300025945 Bacteria 8337
201 Ga0207679_10166218 3300025945 Unclassified 1812
202 Ga0207651_10005923 3300025960 Bacteria 6328
203 Ga0207651_10181831 3300025960 Bacteria 1669
204 Ga0207712_10125704 3300025961 Bacteria 1946
205 Ga0207668_10000551 3300025972 Bacteria 23563
206 Ga0207640_10326359 3300025981 Bacteria 1224
207 Ga0207658_10000059 3300025986 Bacteria 121530
208 Ga0207677_10002598 3300026023 Bacteria 9495
209 Ga0207677_10738117 3300026023 Bacteria 877
210 Ga0207677_10881335 3300026023 Bacteria 806
211 Ga0207703_10039213 3300026035 Bacteria 3784
212 Ga0207703_11267247 3300026035 Bacteria 709
213 Ga0207703_12369799 3300026035 Unclassified 506
214 Ga0207639_10099855 3300026041 Bacteria 2343
215 Ga0207639_11807713 3300026041 Unclassified 572
216 Ga0207678_10300920 3300026067 Bacteria 1378
217 Ga0207648_10016208 3300026089 Bacteria 6819
218 Ga0207648_10196127 3300026089 Bacteria 1790
219 Ga0207648_11468715 3300026089 Bacteria 641
220 Ga0207676_10008891 3300026095 Bacteria 7147
221 Ga0207674_10351663 3300026116 Unclassified 1425
222 Ga0207674_10479494 3300026116 Bacteria 1202
223 Ga0207674_10522812 3300026116 Bacteria 1146
224 Ga0207674_11015252 3300026116 Bacteria 799
225 Ga0207675_100019866 3300026118 Bacteria 6269
226 Ga0207683_10828791 3300026121 Bacteria 859
227 Ga0207698_10948503 3300026142 Bacteria 869
228 Ga0268266_10006251 3300028379 Bacteria 10932
229 Ga0268264_10003852 3300028381 Bacteria 12873
230 Ga0268264_10379247 3300028381 Bacteria 1354
231 Ga0307509_10055018 3300031507 Bacteria 4232
232 Ga0265313_10027008 3300031595 Bacteria 3012
233 Ga0373937_0093811 3300036401 Bacteria 2783
234 Ga0373937_0667608 3300036401 Bacteria 985
235 Ga0436365_0517469 3300039437 Bacteria 501
236 Ga0436365_1668150 3300039437 Bacteria 7466
237 Ga0439436_0010275 3300041404 Bacteria 2858
238 Ga0439436_0204196 3300041404 Unclassified 566
239 Ga0439439_0008940 3300041406 Unclassified 2372
240 Ga0451791_1884426 3300041451 Bacteria 735
241 Ga0451795_0190990 3300041456 Bacteria 703
242 Ga0451802_1266609 3300041460 Bacteria 757
243 Ga0451807_2560468 3300041486 Unclassified 587
244 Ga0451851_1150644 3300041507 Bacteria 814
245 Ga0451853_2454815 3300041512 Bacteria 768
246 Ga0451853_4001071 3300041512 Bacteria 2897
247 Ga0439449_0375087 3300042007 Bacteria 539
248 Ga0439457_001223 3300042014 Bacteria 7733
249 Ga0439457_052525 3300042014 Bacteria 916
250 Ga0439462_0006893 3300042015 Bacteria 2834
251 Ga0451577_0028329 3300042876 Bacteria 5066
252 Ga0451577_0050227 3300042876 Bacteria 3724
253 Ga0451577_0569456 3300042876 Bacteria 1028
254 Ga0453684_0274601 3300044712 Bacteria 1924
255 Ga0453684_0445439 3300044712 Bacteria 1442
256 Ga0495638_0136053 3300046460 Bacteria 1439
257 Ga0495638_0410248 3300046460 Bacteria 701
258 Ga0495580_0318580 3300046472 Bacteria 1057
259 Ga0495582_0607100 3300046473 Bacteria 633
260 Ga0495630_0969701 3300046517 Bacteria 646
261 Ga0495632_0248940 3300046519 Unclassified 797
262 Ga0495586_0059936 3300046535 Bacteria 2069
263 Ga0495633_0061032 3300046558 Bacteria 1766
264 Ga0495668_0000268 3300046616 Bacteria 73486
265 Ga0495635_0086507 3300046663 Bacteria 2145
266 Ga0495657_0374222 3300046675 Bacteria 841
267 Ga0495670_0080613 3300046691 Bacteria 1658
268 Ga0495674_0194426 3300047319 Bacteria 1685
269 Ga0495672_0134542 3300047320 Unclassified 1297
270 Ga0495680_0820040 3300047322 Unclassified 606
271 Ga0495684_0180038 3300047471 Bacteria 1567
272 Ga0496104_0792541 3300048907 Unclassified 854
273 Ga0496104_1301726 3300048907 Bacteria 630
274 Ga0496108_1234251 3300048911 Bacteria 631
275 Ga0496114_1044841 3300048917 Unclassified 701
276 Ga0496115_0040474 3300048918 Unclassified 3705
277 Ga0496115_0140613 3300048918 Bacteria 1992
278 Ga0496124_0151514 3300048927 Bacteria 1818
279 Ga0501032_0956589 3300049569 Unclassified 538
280 Ga0501034_0659380 3300049571 Unclassified 947
281 Ga0501034_0997549 3300049571 Unclassified 721
282 Ga0501038_0328229 3300049574 Unclassified 1196
283 Ga0501043_0024134 3300049579 Bacteria 4772
284 Ga0501073_0822620 3300049589 Unclassified 640
285 Ga0501080_0353646 3300049742 Bacteria 1326
286 Ga0501080_0454779 3300049742 Bacteria 1148
287 Ga0501241_013675 3300049758 Bacteria 1475
288 Ga0501270_128793 3300049767 Bacteria 558
289 Ga0501044_0323744 3300049823 Bacteria 1465
290 nmdc:mga0k408_836615_c1 3300050493 Bacteria 535
291 Ga0495595_0447067 3300053084 Bacteria 657
292 Ga0500644_0031312 3300053088 Bacteria 1690
293 Ga0500644_0384133 3300053088 Bacteria 611
294 Ga0500646_0017307 3300053090 Bacteria 1889
295 Ga0500646_0051039 3300053090 Bacteria 1194
296 Ga0500583_0000037 3300053092 Bacteria 92466
297 Ga0500583_0007626 3300053092 Bacteria 3823
298 Ga0500650_0044999 3300053098 Bacteria 2044
299 Ga0500556_0012715 3300053104 Bacteria 2524
300 Ga0500562_052946 3300053108 Bacteria 1087
301 Ga0500594_0028819 3300053118 Bacteria 1447
302 Ga0500642_0195244 3300053130 Bacteria 943
303 Ga0500652_002036 3300053131 Bacteria 6087
304 Ga0500652_006031 3300053131 Bacteria 3867
305 Ga0500658_0162447 3300053134 Unclassified 1012
306 Ga0500568_0063386 3300053139 Bacteria 1426
307 Ga0500616_0177502 3300053153 Bacteria 962
308 Ga0500622_0001619 3300053156 Bacteria 17667
309 Ga0500622_0214046 3300053156 Bacteria 868
310 Ga0500636_0336472 3300053177 Bacteria 727
311 Ga0500645_040092 3300053730 Bacteria 1386
312 Ga0500661_026992 3300055283 Unclassified 1015
313 2738726065 2738541278 Bacteria 9755573
314 2819589838 2818991444 Bacteria 6968812
315 2929160078 2929154850 Bacteria 6753285
316 2929922566 2929921140 Bacteria 8649150
317 8003156006 8003151029 Bacteria 8187759
318 rootH1_10060111
319 JGI24739J22299_10024844
320 JGI25153J46596_10022576
321 rootL2_10003615
322 rootH1_10015677
323 rootH1_10043167
324 Ga0065712_10250696
325 Ga0065712_10757403
326 Ga0070658_10000176
327 Ga0070658_10682994
328 Ga0070676_10000034
329 Ga0070683_100058160
330 Ga0070683_100720225
331 Ga0070683_101025540
332 Ga0070690_100777234
333 Ga0070670_100104648
334 Ga0070670_100707710
335 Ga0070670_101106236
336 Ga0068869_100101426
337 Ga0070666_10000437
338 Ga0070666_10279645
339 Ga0070666_10437742
340 Ga0070680_100136022
341 Ga0070682_100000005
342 Ga0070682_100281097
343 Ga0068868_100001305
344 Ga0068868_100892605
345 Ga0068868_100898591
346 Ga0070660_100129406
347 Ga0070689_100458848
348 Ga0070661_100351708
349 Ga0070661_101783565
350 Ga0070668_100000087
351 Ga0070675_100044653
352 Ga0070675_100624685
353 Ga0070671_100141631
354 Ga0070671_100207291
355 Ga0070673_100000074
356 Ga0070673_100122747
357 Ga0070659_100422579
358 Ga0070667_100000031
359 Ga0070663_100941236
360 Ga0070678_100895391
361 Ga0070662_100043302
362 Ga0068867_100006590
363 Ga0068867_100518831
364 Ga0068867_101157964
365 Ga0068867_102027806
366 Ga0070706_101087797
367 Ga0070684_100034750
368 Ga0070684_100062911
369 Ga0068853_100012420
370 Ga0068853_101938860
371 Ga0070672_100000002
372 Ga0070672_100452560
373 Ga0070686_100366059
374 Ga0070693_100297473
375 Ga0070665_100000222
376 Ga0068855_100056937
377 Ga0070664_100003850
378 Ga0068857_100659467
379 Ga0068857_101314324
380 Ga0068854_101063864
381 Ga0070702_101679965
382 Ga0068852_100145128
383 Ga0068852_101085323
384 Ga0068864_100008795
385 Ga0068864_101480625
386 Ga0068866_11236162
387 Ga0068861_100037086
388 Ga0068851_10000267
389 Ga0068851_10142374
390 Ga0068851_10602846
391 Ga0068858_102233240
392 Ga0068860_100005968
393 Ga0068860_100409759
394 Ga0097621_100035981
395 Ga0097621_100265837
396 Ga0097621_100731402
397 Ga0097621_100827275
398 Ga0068871_100004279
399 Ga0068871_100005842
400 Ga0068871_100848359
401 Ga0068871_102024833
402 Ga0068871_102308913
403 Ga0068865_100003834
404 Ga0105240_10424873
405 Ga0111539_10773800
406 Ga0105245_10246823
407 Ga0105243_10187583
408 Ga0105241_10471850
409 Ga0105242_10009613
410 Ga0105242_10130545
411 Ga0105248_10064839
412 Ga0105237_10266917
413 Ga0105237_10439546
414 Ga0105238_10164857
415 Ga0105249_10004261
416 Ga0105239_10118502
417 Ga0105239_10421218
418 Ga0105246_10045180
419 Ga0157371_10016990
420 Ga0157371_10080119
421 Ga0157371_10119400
422 Ga0157371_10184508
423 Ga0157371_10692529
424 Ga0157370_10097252
425 Ga0157370_11972322
426 Ga0157369_10055525
427 Ga0157369_10162825
428 Ga0157374_10001136
429 Ga0157374_10013137
430 Ga0157374_10165412
431 Ga0157374_10237224
432 Ga0157374_11260577
433 Ga0157374_11313566
434 Ga0157374_11487658
435 Ga0157378_10053645
436 Ga0157378_10070588
437 Ga0157378_11185870
438 Ga0157378_12375910
439 Ga0163162_10000029
440 Ga0163162_10000576
441 Ga0163162_10017733
442 Ga0163162_10216371
443 Ga0163162_10241517
444 Ga0163162_11160500
445 Ga0163162_12184470
446 Ga0163162_12288327
447 Ga0157372_10021979
448 Ga0157372_10083446
449 Ga0157372_10303421
450 Ga0157372_10586440
451 Ga0157372_11298726
452 Ga0157375_10000042
453 Ga0157375_11366168
454 Ga0157375_13595896
455 Ga0163163_10000174
456 Ga0163163_10409851
457 Ga0163163_10945000
458 Ga0157380_10911333
459 Ga0157380_11176193
460 Ga0157380_11751942
461 Ga0157377_10017457
462 Ga0157379_10000080
463 Ga0157379_10206184
464 Ga0157379_11139079
465 Ga0157379_11420173
466 Ga0157379_12299281
467 Ga0157376_10000521
468 Ga0157376_10019036
469 Ga0157376_10032269
470 Ga0157376_10327634
471 Ga0157376_10633508
472 Ga0157376_10979623
473 Ga0157376_12551005
474 Ga0157376_12772449
475 Ga0163161_10077471
476 Ga0163161_10723749
477 Ga0163161_11167625
478 Ga0163161_11558878
479 Ga0213876_10083498
480 Ga0213876_10376151
481 Ga0209758_1030531
482 Ga0207426_1000293
483 Ga0207426_1041502
484 Ga0207697_10120126
485 Ga0207697_10449857
486 Ga0207656_10289006
487 Ga0207656_10402409
488 Ga0207680_10000657
489 Ga0207680_10253626
490 Ga0207645_10000337
491 Ga0207705_10001116
492 Ga0207654_10326361
493 Ga0207695_10664053
494 Ga0207671_10532969
495 Ga0207657_10160387
496 Ga0207649_10092336
497 Ga0207649_11280874
498 Ga0207652_10772445
499 Ga0207694_10199644
500 Ga0207650_10051066
501 Ga0207650_10705877
502 Ga0207659_10863631
503 Ga0207659_11075990
504 Ga0207687_10261596
505 Ga0207644_10101514
506 Ga0207644_10422644
507 Ga0207644_11582647
508 Ga0207706_10004551
509 Ga0207686_10015430
510 Ga0207709_10126114
511 Ga0207691_10000004
512 Ga0207691_10260930
513 Ga0207691_10392613
514 Ga0207691_10567685
515 Ga0207711_10170645
516 Ga0207661_10492712
517 Ga0207679_10004909
518 Ga0207679_10166218
519 Ga0207651_10005923
520 Ga0207651_10181831
521 Ga0207712_10125704
522 Ga0207668_10000551
523 Ga0207640_10326359
524 Ga0207658_10000059
525 Ga0207677_10002598
526 Ga0207677_10738117
527 Ga0207677_10881335
528 Ga0207703_10039213
529 Ga0207703_11267247
530 Ga0207703_12369799
531 Ga0207639_10099855
532 Ga0207639_11807713
533 Ga0207678_10300920
534 Ga0207648_10016208
535 Ga0207648_10196127
536 Ga0207648_11468715
537 Ga0207676_10008891
538 Ga0207674_10351663
539 Ga0207674_10479494
540 Ga0207674_10522812
541 Ga0207674_11015252
542 Ga0207675_100019866
543 Ga0207683_10828791
544 Ga0207698_10948503
545 Ga0268266_10006251
546 Ga0268264_10003852
547 Ga0268264_10379247
548 Ga0307509_10055018
549 Ga0265313_10027008
550 Ga0373937_0093811
551 Ga0373937_0667608
552 Ga0436365_0517469
553 Ga0436365_1668150
554 Ga0439436_0010275
555 Ga0439436_0204196
556 Ga0439439_0008940
557 Ga0451791_1884426
558 Ga0451795_0190990
559 Ga0451802_1266609
560 Ga0451807_2560468
561 Ga0451851_1150644
562 Ga0451853_2454815
563 Ga0451853_4001071
564 Ga0439449_0375087
565 Ga0439457_001223
566 Ga0439457_052525
567 Ga0439462_0006893
568 Ga0451577_0028329
569 Ga0451577_0050227
570 Ga0451577_0569456
571 Ga0453684_0274601
572 Ga0453684_0445439
573 Ga0495638_0136053
574 Ga0495638_0410248
575 Ga0495580_0318580
576 Ga0495582_0607100
577 Ga0495630_0969701
578 Ga0495632_0248940
579 Ga0495586_0059936
580 Ga0495633_0061032
581 Ga0495668_0000268
582 Ga0495635_0086507
583 Ga0495657_0374222
584 Ga0495670_0080613
585 Ga0495674_0194426
586 Ga0495672_0134542
587 Ga0495680_0820040
588 Ga0495684_0180038
589 Ga0496104_0792541
590 Ga0496104_1301726
591 Ga0496108_1234251
592 Ga0496114_1044841
593 Ga0496115_0040474
594 Ga0496115_0140613
595 Ga0496124_0151514
596 Ga0501032_0956589
597 Ga0501034_0659380
598 Ga0501034_0997549
599 Ga0501038_0328229
600 Ga0501043_0024134
601 Ga0501073_0822620
602 Ga0501080_0353646
603 Ga0501080_0454779
604 Ga0501241_013675
605 Ga0501270_128793
606 Ga0501044_0323744
607 nmdc:mga0k408_836615_c1
608 Ga0495595_0447067
609 Ga0500644_0031312
610 Ga0500644_0384133
611 Ga0500646_0017307
612 Ga0500646_0051039
613 Ga0500583_0000037
614 Ga0500583_0007626
615 Ga0500650_0044999
616 Ga0500556_0012715
617 Ga0500562_052946
618 Ga0500594_0028819
619 Ga0500642_0195244
620 Ga0500652_002036
621 Ga0500652_006031
622 Ga0500658_0162447
623 Ga0500568_0063386
624 Ga0500616_0177502
625 Ga0500622_0001619
626 Ga0500622_0214046
627 Ga0500636_0336472
628 Ga0500645_040092
629 Ga0500661_026992
630 2738726065
631 2819589838
632 2929160078
633 2929922566
634 8003156006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

35

80

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ope-assembly1.cif.gz_1 rqch dr variant bound to 50s-peptidyl-trna-rqcp rqc complex (rigid body refinement) 0.9049 8 86
7asa-assembly1.cif.gz_1 bacillus subtilis ribosome-associated quality control complex state b, multibody refinement focussed on rqch. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.9047 8 86
7aqc-assembly1.cif.gz_Y structure of the bacterial rqc complex (decoding state) 0.8978 8 86
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.8937 9 48
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.8876 9 57
ID Description Score Start End Superfamily
af_Q2G0R5_1_87_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9175 8 87 3.10.290.10
af_Q25804_3_135_1.10.1050.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S4 Delta 41; Chain A, domain 1;Ribosomal protein S4/S9, N-terminal domain 0.9153 8 52 1.10.1050.10
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9123 8 49 3.10.290.10
af_O60063_95_238_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9055 9 57 3.10.290.10
af_P9WHQ3_3_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.8988 7 58 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A2E9MKS1-F1-model_v4 RNA-binding S4 domain-containing protein 0.9683 8 88 GO:0003723
AF-A0A243S3J5-F1-model_v4 RNA-binding S4 domain-containing protein 0.9645 7 89 GO:0003723
AF-D6A9U2-F1-model_v4 RNA-binding S4 domain-containing protein 0.9638 6 86 GO:0003723
AF-A0A1X4HW27-F1-model_v4 Heat-shock protein 0.9578 3 88 GO:0003723
AF-A0A6N7FPV5-F1-model_v4 RNA-binding S4 domain-containing protein 0.9567 6 86 GO:0003723

Map