F403923
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 316 | 187 | 292 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300053148|Ga0500590_225293|Ga0500590_225293_155_688 |
| Length | 177 |
| Sequence | MLNFRLSGVSEKRRRIRWKKRDNKRDMKKALFFSVALLAGAVAMAQSSKQVSWNYSAKKLSDKVYEVHMTATVGGDYHIYAQHPGGDGPIPTSFKFTKNPLLLVTGNVKENGKLVKKFESAWGFEVIYYEKAVDFVVVVRLKGNVKTSLAGTVEFMVCNDHECLPPANVDIKVNIGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 2 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 3 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 4 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 5 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 6 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 7 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 8 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 9 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 10 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 11 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 12 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 13 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 14 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 18 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 19 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 123 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 124 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 127 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 129 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 130 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 131 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 132 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 133 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 134 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 135 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 136 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 137 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 138 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 139 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 140 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 141 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 142 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 143 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 144 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 156 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 157 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 158 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 159 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 164 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 165 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 167 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 170 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 171 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 172 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 173 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 174 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 175 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 176 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 177 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 178 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 179 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 180 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 181 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 182 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 183 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 184 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 185 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 186 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 187 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.46 |
| Metatranscriptomes | 2.85 |
| Isolates | 5.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.99 |
| Nodule | 0 |
| Rhizoplane | 0.95 |
| Rhizosphere | 65.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001467 | 3300001979 | Bacteria | 10822 |
| 2 | JGI24739J22299_10039716 | 3300001989 | Bacteria | 1575 |
| 3 | JGI25154J39366_1000020 | 3300002738 | Bacteria | 233181 |
| 4 | JGI25157J39369_1003680 | 3300002741 | Bacteria | 3033 |
| 5 | JGI25159J45721_1039445 | 3300002987 | Bacteria | 698 |
| 6 | JGI25153J46596_10000268 | 3300003215 | Bacteria | 41181 |
| 7 | JGI25153J46596_10014001 | 3300003215 | Bacteria | 3359 |
| 8 | rootH1_10014754 | 3300003316 | Bacteria | 4231 |
| 9 | rootH1_10078318 | 3300003316 | Bacteria | 1408 |
| 10 | rootH2_10001202 | 3300003320 | Bacteria | 51390 |
| 11 | rootH2_10009901 | 3300003320 | Bacteria | 3650 |
| 12 | rootH2_10029245 | 3300003320 | Unclassified | 2340 |
| 13 | rootH2_10081373 | 3300003320 | Bacteria | 1414 |
| 14 | rootH2_10092437 | 3300003320 | Bacteria | 3110 |
| 15 | rootH2_10152349 | 3300003320 | Bacteria | 1188 |
| 16 | rootH2_10234178 | 3300003320 | Bacteria | 3170 |
| 17 | rootL2_10040050 | 3300003322 | Bacteria | 3805 |
| 18 | rootL2_10045218 | 3300003322 | Bacteria | 3930 |
| 19 | rootL2_10049962 | 3300003322 | Bacteria | 6812 |
| 20 | rootL2_10078076 | 3300003322 | Bacteria | 3695 |
| 21 | rootL2_10179769 | 3300003322 | Bacteria | 3381 |
| 22 | rootL2_10190388 | 3300003322 | Bacteria | 1016 |
| 23 | rootH1_10001197 | 3300003323 | Bacteria | 1897 |
| 24 | rootH1_10075127 | 3300003323 | Bacteria | 4985 |
| 25 | rootH1_10096158 | 3300003323 | Bacteria | 1654 |
| 26 | rootH1_10164288 | 3300003323 | Bacteria | 4784 |
| 27 | rootH1_10292604 | 3300003323 | Bacteria | 1072 |
| 28 | JGI25160J50197_1003243 | 3300003354 | Bacteria | 7340 |
| 29 | JGI25160J50197_1004459 | 3300003354 | Bacteria | 6047 |
| 30 | Ga0055542_1021878 | 3300003762 | Bacteria | 916 |
| 31 | Ga0055526_1027493 | 3300003771 | Bacteria | 1756 |
| 32 | Ga0055528_1002450 | 3300003790 | Bacteria | 9926 |
| 33 | Ga0055530_10000584 | 3300003791 | Bacteria | 31522 |
| 34 | Ga0055531_10000819 | 3300003794 | Bacteria | 25805 |
| 35 | Ga0055531_10025662 | 3300003794 | Bacteria | 2131 |
| 36 | Ga0055543_1010741 | 3300004625 | Bacteria | 1907 |
| 37 | Ga0065165_1000914 | 3300005262 | Bacteria | 38063 |
| 38 | Ga0065165_1015985 | 3300005262 | Bacteria | 2833 |
| 39 | Ga0065704_10071111 | 3300005289 | Bacteria | 13098 |
| 40 | Ga0070676_10584474 | 3300005328 | Bacteria | 803 |
| 41 | Ga0070683_100016276 | 3300005329 | Bacteria | 6556 |
| 42 | Ga0068869_100057433 | 3300005334 | Unclassified | 2841 |
| 43 | Ga0070666_10003925 | 3300005335 | Bacteria | 9031 |
| 44 | Ga0068868_100274812 | 3300005338 | Bacteria | 1424 |
| 45 | Ga0070691_10149776 | 3300005341 | Unclassified | 1195 |
| 46 | Ga0070671_100001243 | 3300005355 | Bacteria | 19091 |
| 47 | Ga0070667_100717872 | 3300005367 | Unclassified | 925 |
| 48 | Ga0070684_100013309 | 3300005535 | Bacteria | 6630 |
| 49 | Ga0068853_100209290 | 3300005539 | Bacteria | 1777 |
| 50 | Ga0068855_100013516 | 3300005563 | Bacteria | 9843 |
| 51 | Ga0068855_100021783 | 3300005563 | Bacteria | 7687 |
| 52 | Ga0068855_100078588 | 3300005563 | Bacteria | 3827 |
| 53 | Ga0068855_100943632 | 3300005563 | Unclassified | 909 |
| 54 | Ga0068857_100012019 | 3300005577 | Bacteria | 7529 |
| 55 | Ga0068854_100020799 | 3300005578 | Unclassified | 4446 |
| 56 | Ga0068854_100663253 | 3300005578 | Unclassified | 897 |
| 57 | Ga0068856_100014534 | 3300005614 | Bacteria | 7607 |
| 58 | Ga0068856_100752898 | 3300005614 | Bacteria | 994 |
| 59 | Ga0068856_100979120 | 3300005614 | Bacteria | 864 |
| 60 | Ga0068852_100007573 | 3300005616 | Bacteria | 7934 |
| 61 | Ga0068852_100407244 | 3300005616 | Bacteria | 1339 |
| 62 | Ga0068852_100709441 | 3300005616 | Unclassified | 1016 |
| 63 | Ga0068852_100786104 | 3300005616 | Bacteria | 965 |
| 64 | Ga0068864_100346828 | 3300005618 | Bacteria | 1400 |
| 65 | Ga0068866_10360545 | 3300005718 | Bacteria | 926 |
| 66 | Ga0068851_10400324 | 3300005834 | Bacteria | 808 |
| 67 | Ga0068858_100257479 | 3300005842 | Unclassified | 1658 |
| 68 | Ga0068860_100128366 | 3300005843 | Bacteria | 2431 |
| 69 | Ga0070715_10510252 | 3300006163 | Bacteria | 690 |
| 70 | Ga0075366_10025407 | 3300006195 | Bacteria | 3460 |
| 71 | Ga0075366_10163402 | 3300006195 | Unclassified | 1350 |
| 72 | Ga0097621_100082229 | 3300006237 | Bacteria | 2681 |
| 73 | Ga0097621_100793322 | 3300006237 | Unclassified | 877 |
| 74 | Ga0068871_100001412 | 3300006358 | Bacteria | 16072 |
| 75 | Ga0068871_100024833 | 3300006358 | Bacteria | 4653 |
| 76 | Ga0068865_100060082 | 3300006881 | Unclassified | 2660 |
| 77 | Ga0068865_100902492 | 3300006881 | Bacteria | 769 |
| 78 | Ga0105240_10000431 | 3300009093 | Bacteria | 77497 |
| 79 | Ga0105240_10003449 | 3300009093 | Bacteria | 24537 |
| 80 | Ga0105240_10006516 | 3300009093 | Bacteria | 17139 |
| 81 | Ga0105240_10007181 | 3300009093 | Bacteria | 16222 |
| 82 | Ga0105240_10008725 | 3300009093 | Bacteria | 14451 |
| 83 | Ga0105240_10020350 | 3300009093 | Bacteria | 8856 |
| 84 | Ga0105240_10023755 | 3300009093 | Bacteria | 8097 |
| 85 | Ga0105240_10047245 | 3300009093 | Bacteria | 5448 |
| 86 | Ga0105241_10006712 | 3300009174 | Bacteria | 8468 |
| 87 | Ga0105241_10098371 | 3300009174 | Bacteria | 2321 |
| 88 | Ga0105241_10717676 | 3300009174 | Unclassified | 914 |
| 89 | Ga0105248_10054669 | 3300009177 | Bacteria | 4477 |
| 90 | Ga0105237_10024435 | 3300009545 | Bacteria | 6181 |
| 91 | Ga0105237_10035825 | 3300009545 | Bacteria | 5020 |
| 92 | Ga0105237_10738386 | 3300009545 | Bacteria | 991 |
| 93 | Ga0105237_12235245 | 3300009545 | Bacteria | 557 |
| 94 | Ga0105238_10103500 | 3300009551 | Unclassified | 2828 |
| 95 | Ga0105238_10105729 | 3300009551 | Unclassified | 2796 |
| 96 | Ga0105249_10387830 | 3300009553 | Bacteria | 1424 |
| 97 | Ga0105239_10056103 | 3300010375 | Bacteria | 4321 |
| 98 | Ga0105239_10141352 | 3300010375 | Bacteria | 2682 |
| 99 | Ga0105239_10184529 | 3300010375 | Bacteria | 2334 |
| 100 | Ga0105239_10346807 | 3300010375 | Bacteria | 1676 |
| 101 | Ga0105239_11944263 | 3300010375 | Unclassified | 682 |
| 102 | Ga0105246_10225897 | 3300011119 | Bacteria | 1471 |
| 103 | Ga0157373_10161062 | 3300013100 | Bacteria | 1579 |
| 104 | Ga0157370_10001756 | 3300013104 | Bacteria | 26720 |
| 105 | Ga0157370_10182607 | 3300013104 | Bacteria | 1949 |
| 106 | Ga0157370_10803833 | 3300013104 | Unclassified | 856 |
| 107 | Ga0157369_10016069 | 3300013105 | Bacteria | 8421 |
| 108 | Ga0157369_10067775 | 3300013105 | Bacteria | 3835 |
| 109 | Ga0157374_10000025 | 3300013296 | Bacteria | 245131 |
| 110 | Ga0157374_10439136 | 3300013296 | Unclassified | 1305 |
| 111 | Ga0157378_10025976 | 3300013297 | Bacteria | 5161 |
| 112 | Ga0157378_12146772 | 3300013297 | Bacteria | 609 |
| 113 | Ga0163162_10000994 | 3300013306 | Bacteria | 26396 |
| 114 | Ga0163162_10007556 | 3300013306 | Bacteria | 10587 |
| 115 | Ga0157372_10002934 | 3300013307 | Bacteria | 18400 |
| 116 | Ga0157372_10079465 | 3300013307 | Bacteria | 3709 |
| 117 | Ga0157372_10211719 | 3300013307 | Bacteria | 2246 |
| 118 | Ga0157372_10661755 | 3300013307 | Unclassified | 1216 |
| 119 | Ga0157375_10012214 | 3300013308 | Bacteria | 7614 |
| 120 | Ga0157375_10043641 | 3300013308 | Bacteria | 4350 |
| 121 | Ga0163163_10026569 | 3300014325 | Bacteria | 5536 |
| 122 | Ga0157377_11471671 | 3300014745 | Bacteria | 540 |
| 123 | Ga0157379_10040496 | 3300014968 | Bacteria | 4158 |
| 124 | Ga0157379_10085764 | 3300014968 | Bacteria | 2823 |
| 125 | Ga0157376_10000404 | 3300014969 | Bacteria | 28086 |
| 126 | Ga0157376_10003131 | 3300014969 | Bacteria | 11367 |
| 127 | Ga0157376_10004871 | 3300014969 | Bacteria | 9359 |
| 128 | Ga0182005_1000116 | 3300015265 | Bacteria | 57638 |
| 129 | Ga0163161_10025530 | 3300017792 | Bacteria | 4182 |
| 130 | Ga0163161_10026974 | 3300017792 | Bacteria | 4073 |
| 131 | Ga0197907_10267666 | 3300020069 | Bacteria | 1317 |
| 132 | Ga0206356_10206394 | 3300020070 | Bacteria | 645 |
| 133 | Ga0206356_10425736 | 3300020070 | Bacteria | 1380 |
| 134 | Ga0206352_10351310 | 3300020078 | Unclassified | 663 |
| 135 | Ga0206352_11032421 | 3300020078 | Bacteria | 1476 |
| 136 | Ga0206354_10466767 | 3300020081 | Unclassified | 789 |
| 137 | Ga0206353_11527644 | 3300020082 | Bacteria | 1320 |
| 138 | Ga0224712_10091696 | 3300022467 | Bacteria | 1274 |
| 139 | Ga0209436_105907 | 3300025208 | Bacteria | 2745 |
| 140 | Ga0209258_100075 | 3300025242 | Bacteria | 270751 |
| 141 | Ga0209646_1000005 | 3300025246 | Bacteria | 717627 |
| 142 | Ga0209646_1013872 | 3300025246 | Bacteria | 1219 |
| 143 | Ga0209026_1000149 | 3300025250 | Bacteria | 111200 |
| 144 | Ga0209148_1000085 | 3300025254 | Bacteria | 265193 |
| 145 | Ga0209673_1000242 | 3300025273 | Bacteria | 104669 |
| 146 | Ga0209130_1001019 | 3300025284 | Bacteria | 21610 |
| 147 | Ga0209675_1067749 | 3300025291 | Unclassified | 687 |
| 148 | Ga0209564_1012258 | 3300025295 | Bacteria | 3753 |
| 149 | Ga0209758_1000795 | 3300025297 | Bacteria | 44872 |
| 150 | Ga0209758_1008721 | 3300025297 | Bacteria | 6481 |
| 151 | Ga0209758_1010337 | 3300025297 | Bacteria | 5601 |
| 152 | Ga0209758_1027895 | 3300025297 | Bacteria | 2403 |
| 153 | Ga0209050_1000298 | 3300025298 | Bacteria | 104315 |
| 154 | Ga0207426_1000057 | 3300025302 | Bacteria | 369548 |
| 155 | Ga0207426_1000262 | 3300025302 | Bacteria | 111889 |
| 156 | Ga0207426_1001013 | 3300025302 | Bacteria | 27217 |
| 157 | Ga0207426_1003809 | 3300025302 | Bacteria | 7818 |
| 158 | Ga0209051_1061131 | 3300025303 | Bacteria | 1185 |
| 159 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 160 | Ga0209257_1004947 | 3300025304 | Bacteria | 9775 |
| 161 | Ga0207642_10466611 | 3300025899 | Bacteria | 767 |
| 162 | Ga0207647_10005447 | 3300025904 | Bacteria | 9325 |
| 163 | Ga0207647_10430805 | 3300025904 | Bacteria | 741 |
| 164 | Ga0207654_10015819 | 3300025911 | Bacteria | 3921 |
| 165 | Ga0207654_10274496 | 3300025911 | Unclassified | 1138 |
| 166 | Ga0207654_10436378 | 3300025911 | Bacteria | 916 |
| 167 | Ga0207695_10000282 | 3300025913 | Bacteria | 126242 |
| 168 | Ga0207695_10001519 | 3300025913 | Bacteria | 38506 |
| 169 | Ga0207695_10003026 | 3300025913 | Bacteria | 24133 |
| 170 | Ga0207695_10022792 | 3300025913 | Bacteria | 7094 |
| 171 | Ga0207695_10073698 | 3300025913 | Bacteria | 3478 |
| 172 | Ga0207695_10089115 | 3300025913 | Unclassified | 3103 |
| 173 | Ga0207671_10005526 | 3300025914 | Bacteria | 11620 |
| 174 | Ga0207671_10020846 | 3300025914 | Bacteria | 4984 |
| 175 | Ga0207671_10055812 | 3300025914 | Bacteria | 2926 |
| 176 | Ga0207671_10089966 | 3300025914 | Unclassified | 2311 |
| 177 | Ga0207671_10375475 | 3300025914 | Bacteria | 1129 |
| 178 | Ga0207694_10151096 | 3300025924 | Unclassified | 1871 |
| 179 | Ga0207694_10660696 | 3300025924 | Bacteria | 881 |
| 180 | Ga0207694_10798822 | 3300025924 | Unclassified | 797 |
| 181 | Ga0207644_10010191 | 3300025931 | Bacteria | 6192 |
| 182 | Ga0207704_10110082 | 3300025938 | Unclassified | 1860 |
| 183 | Ga0207704_10305052 | 3300025938 | Bacteria | 1221 |
| 184 | Ga0207711_10042641 | 3300025941 | Unclassified | 3867 |
| 185 | Ga0207689_10250481 | 3300025942 | Bacteria | 1465 |
| 186 | Ga0207689_10645467 | 3300025942 | Unclassified | 892 |
| 187 | Ga0207661_10011006 | 3300025944 | Bacteria | 6537 |
| 188 | Ga0207667_10000403 | 3300025949 | Bacteria | 58481 |
| 189 | Ga0207667_10001258 | 3300025949 | Bacteria | 31777 |
| 190 | Ga0207667_10099761 | 3300025949 | Bacteria | 2996 |
| 191 | Ga0207640_10100670 | 3300025981 | Bacteria | 2025 |
| 192 | Ga0207640_10261105 | 3300025981 | Bacteria | 1350 |
| 193 | Ga0207677_10230105 | 3300026023 | Bacteria | 1493 |
| 194 | Ga0207703_10703973 | 3300026035 | Bacteria | 961 |
| 195 | Ga0207639_10009849 | 3300026041 | Bacteria | 6601 |
| 196 | Ga0207639_10339839 | 3300026041 | Unclassified | 1338 |
| 197 | Ga0207702_10135370 | 3300026078 | Bacteria | 2222 |
| 198 | Ga0207702_10566994 | 3300026078 | Bacteria | 1112 |
| 199 | Ga0207702_11081284 | 3300026078 | Bacteria | 796 |
| 200 | Ga0207674_10014629 | 3300026116 | Bacteria | 8654 |
| 201 | Ga0207674_10940092 | 3300026116 | Bacteria | 833 |
| 202 | Ga0207698_10050815 | 3300026142 | Unclassified | 3166 |
| 203 | Ga0207698_10100632 | 3300026142 | Unclassified | 2395 |
| 204 | Ga0207698_11239637 | 3300026142 | Unclassified | 760 |
| 205 | Ga0207698_11883163 | 3300026142 | Bacteria | 613 |
| 206 | Ga0268266_10773435 | 3300028379 | Bacteria | 927 |
| 207 | Ga0268264_10000015 | 3300028381 | Bacteria | 508501 |
| 208 | Ga0268264_10000019 | 3300028381 | Bacteria | 488112 |
| 209 | Ga0268264_10080252 | 3300028381 | Bacteria | 2786 |
| 210 | Ga0268264_10347086 | 3300028381 | Bacteria | 1411 |
| 211 | Ga0307517_10208584 | 3300028786 | Bacteria | 1208 |
| 212 | Ga0307511_10000024 | 3300030521 | Bacteria | 112616 |
| 213 | Ga0307516_10005057 | 3300031730 | Bacteria | 15964 |
| 214 | Ga0307516_10280344 | 3300031730 | Bacteria | 1349 |
| 215 | Ga0307414_10031478 | 3300032004 | Bacteria | 3481 |
| 216 | Ga0307510_10003234 | 3300033180 | Bacteria | 18935 |
| 217 | Ga0373935_0054675 | 3300035692 | Bacteria | 2543 |
| 218 | Ga0439436_0026048 | 3300041404 | Bacteria | 1716 |
| 219 | Ga0451800_0852966 | 3300041459 | Bacteria | 651 |
| 220 | Ga0451833_0549414 | 3300041491 | Bacteria | 1548 |
| 221 | Ga0451853_3721546 | 3300041512 | Bacteria | 532 |
| 222 | Ga0439431_0000821 | 3300041997 | Bacteria | 6710 |
| 223 | Ga0439431_0036646 | 3300041997 | Bacteria | 1236 |
| 224 | Ga0439449_0076735 | 3300042007 | Bacteria | 1232 |
| 225 | Ga0439462_0147346 | 3300042015 | Bacteria | 661 |
| 226 | Ga0466969_0121033 | 3300044656 | Bacteria | 1218 |
| 227 | Ga0466969_0188480 | 3300044656 | Unclassified | 943 |
| 228 | Ga0466972_0002109 | 3300044658 | Bacteria | 9755 |
| 229 | Ga0466972_0054687 | 3300044658 | Bacteria | 1920 |
| 230 | Ga0466972_0085593 | 3300044658 | Bacteria | 1498 |
| 231 | Ga0466965_0027837 | 3300044683 | Bacteria | 2744 |
| 232 | Ga0466961_0029051 | 3300044693 | Bacteria | 3555 |
| 233 | Ga0466971_0008879 | 3300044719 | Bacteria | 4391 |
| 234 | Ga0466968_0081923 | 3300044735 | Bacteria | 1419 |
| 235 | Ga0466970_0088527 | 3300044765 | Bacteria | 1679 |
| 236 | Ga0466957_0054302 | 3300044842 | Bacteria | 2445 |
| 237 | Ga0466957_0615867 | 3300044842 | Bacteria | 761 |
| 238 | Ga0466959_0048418 | 3300045049 | Bacteria | 3123 |
| 239 | Ga0466959_0069905 | 3300045049 | Unclassified | 2543 |
| 240 | Ga0495627_003149 | 3300046453 | Bacteria | 7451 |
| 241 | Ga0495638_0031003 | 3300046460 | Unclassified | 3438 |
| 242 | Ga0495648_0000493 | 3300046524 | Bacteria | 42504 |
| 243 | Ga0495648_0124364 | 3300046524 | Viruses | 1381 |
| 244 | Ga0495633_0000022 | 3300046558 | Bacteria | 226582 |
| 245 | Ga0495668_0001251 | 3300046616 | Bacteria | 25451 |
| 246 | Ga0495611_0000538 | 3300046648 | Bacteria | 22219 |
| 247 | Ga0495625_0302097 | 3300046660 | Unclassified | 1024 |
| 248 | Ga0495649_0208059 | 3300046694 | Bacteria | 1014 |
| 249 | Ga0495672_0001585 | 3300047320 | Bacteria | 22189 |
| 250 | Ga0495686_0000128 | 3300047472 | Bacteria | 156223 |
| 251 | Ga0496101_0315934 | 3300048904 | Bacteria | 1225 |
| 252 | Ga0496114_0079426 | 3300048917 | Bacteria | 2769 |
| 253 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 254 | Ga0496125_0475052 | 3300048928 | Bacteria | 710 |
| 255 | Ga0496126_0043669 | 3300048929 | Bacteria | 4133 |
| 256 | Ga0501319_004597 | 3300049535 | Bacteria | 965 |
| 257 | Ga0501034_0023444 | 3300049571 | Bacteria | 6289 |
| 258 | Ga0501034_0400701 | 3300049571 | Bacteria | 1295 |
| 259 | Ga0501047_0343510 | 3300049581 | Bacteria | 1330 |
| 260 | Ga0501067_0172863 | 3300049583 | Unclassified | 1203 |
| 261 | Ga0501238_041193 | 3300049671 | Bacteria | 680 |
| 262 | Ga0501251_023735 | 3300049681 | Bacteria | 833 |
| 263 | Ga0501083_0457260 | 3300049744 | Unclassified | 831 |
| 264 | Ga0501241_002778 | 3300049758 | Bacteria | 3371 |
| 265 | Ga0501035_0792111 | 3300049822 | Unclassified | 758 |
| 266 | Ga0501044_0194509 | 3300049823 | Unclassified | 1989 |
| 267 | Ga0501044_0528815 | 3300049823 | Unclassified | 1078 |
| 268 | nmdc:mga0k408_155477_c1 | 3300050493 | Bacteria | 1362 |
| 269 | nmdc:mga0k408_34987_c1 | 3300050493 | Bacteria | 2878 |
| 270 | Ga0500643_058838 | 3300053087 | Unclassified | 1083 |
| 271 | Ga0500646_0005181 | 3300053090 | Bacteria | 3300 |
| 272 | Ga0500646_0011746 | 3300053090 | Bacteria | 2255 |
| 273 | Ga0500583_0003555 | 3300053092 | Bacteria | 4928 |
| 274 | Ga0500583_0023890 | 3300053092 | Bacteria | 2585 |
| 275 | Ga0500651_0050624 | 3300053093 | Bacteria | 2606 |
| 276 | Ga0500652_001355 | 3300053131 | Bacteria | 7662 |
| 277 | Ga0500658_0126041 | 3300053134 | Bacteria | 1138 |
| 278 | Ga0500568_0013673 | 3300053139 | Bacteria | 3692 |
| 279 | Ga0500568_0038273 | 3300053139 | Unclassified | 1941 |
| 280 | Ga0500577_0003027 | 3300053142 | Bacteria | 4341 |
| 281 | Ga0500588_0262191 | 3300053146 | Unclassified | 650 |
| 282 | Ga0500590_068942 | 3300053148 | Bacteria | 1761 |
| 283 | Ga0500590_225293 | 3300053148 | Unclassified | 769 |
| 284 | Ga0500604_0013370 | 3300053151 | Bacteria | 2224 |
| 285 | Ga0500616_0010035 | 3300053153 | Bacteria | 5693 |
| 286 | Ga0500622_0000497 | 3300053156 | Bacteria | 36689 |
| 287 | Ga0500622_0004431 | 3300053156 | Bacteria | 8826 |
| 288 | Ga0500634_0072686 | 3300053161 | Bacteria | 1795 |
| 289 | Ga0500636_0071095 | 3300053177 | Bacteria | 2018 |
| 290 | Ga0500637_0096099 | 3300053178 | Bacteria | 1717 |
| 291 | Ga0500661_002867 | 3300055283 | Bacteria | 3249 |
| 292 | Ga0500661_065864 | 3300055283 | Unclassified | 658 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005335 | Ga0070666_10003925 | Ga0070666_100039251 | 132 |
| 2 | 3300049671 | Ga0501238_041193 | Ga0501238_041193_12_440 | 142 |
| 3 | iso_pu_bacteria | 2929921140 | 2929927701 | 146 |
| 4 | 3300031730 | Ga0307516_10280344 | Ga0307516_102803442 | 147 |
| 5 | 3300046460 | Ga0495638_0031003 | Ga0495638_0031003_2246_2692 | 147 |
| 6 | 3300049823 | Ga0501044_0194509 | Ga0501044_0194509_594_1040 | 147 |
| 7 | 3300049823 | Ga0501044_0528815 | Ga0501044_0528815_432_878 | 147 |
| 8 | iso_pu_bacteria | 2818991442 | 2819571918 | 147 |
| 9 | iso_pu_bacteria | 2818991460 | 2819677692 | 147 |
| 10 | iso_pu_bacteria | 2821136567 | 2821141838 | 147 |
| 11 | iso_pu_bacteria | 2840677318 | 2840679344 | 147 |
| 12 | iso_pu_bacteria | 2883068021 | 2883069869 | 147 |
| 13 | iso_pu_bacteria | 2884791551 | 2884797634 | 147 |
| 14 | iso_pu_bacteria | 2896085136 | 2896087155 | 147 |
| 15 | iso_pu_bacteria | 2896109856 | 2896114428 | 147 |
| 16 | iso_pu_bacteria | 2904467357 | 2904469747 | 147 |
| 17 | iso_pu_bacteria | 2929177148 | 2929180135 | 147 |
| 18 | iso_pu_bacteria | 2929177148 | 2929183317 | 147 |
| 19 | iso_pu_bacteria | 2929239360 | 2929245437 | 147 |
| 20 | iso_pu_bacteria | 2945977869 | 2945979277 | 147 |
| 21 | iso_pu_bacteria | 2945977869 | 2945982540 | 147 |
| 22 | iso_pu_bacteria | 2946013367 | 2946014852 | 147 |
| 23 | iso_pu_bacteria | 2946013367 | 2946018069 | 147 |
| 24 | iso_pu_bacteria | 8003151029 | 8003151549 | 147 |
| 25 | 3300003316 | rootH1_10014754 | rootH1_100147543 | 148 |
| 26 | 3300003320 | rootH2_10001202 | rootH2_1000120236 | 148 |
| 27 | 3300003320 | rootH2_10029245 | rootH2_100292452 | 148 |
| 28 | 3300003320 | rootH2_10152349 | rootH2_101523492 | 148 |
| 29 | 3300003320 | rootH2_10234178 | rootH2_102341782 | 148 |
| 30 | 3300003322 | rootL2_10078076 | rootL2_100780762 | 148 |
| 31 | 3300003323 | rootH1_10292604 | rootH1_102926042 | 148 |
| 32 | 3300005328 | Ga0070676_10584474 | Ga0070676_105844741 | 148 |
| 33 | 3300005329 | Ga0070683_100016276 | Ga0070683_1000162764 | 148 |
| 34 | 3300005334 | Ga0068869_100057433 | Ga0068869_1000574332 | 148 |
| 35 | 3300005338 | Ga0068868_100274812 | Ga0068868_1002748122 | 148 |
| 36 | 3300005341 | Ga0070691_10149776 | Ga0070691_101497762 | 148 |
| 37 | 3300005367 | Ga0070667_100717872 | Ga0070667_1007178721 | 148 |
| 38 | 3300005535 | Ga0070684_100013309 | Ga0070684_1000133094 | 148 |
| 39 | 3300005539 | Ga0068853_100209290 | Ga0068853_1002092901 | 148 |
| 40 | 3300005563 | Ga0068855_100013516 | Ga0068855_1000135162 | 148 |
| 41 | 3300005563 | Ga0068855_100021783 | Ga0068855_1000217835 | 148 |
| 42 | 3300005563 | Ga0068855_100078588 | Ga0068855_1000785883 | 148 |
| 43 | 3300005563 | Ga0068855_100943632 | Ga0068855_1009436322 | 148 |
| 44 | 3300005577 | Ga0068857_100012019 | Ga0068857_1000120195 | 148 |
| 45 | 3300005578 | Ga0068854_100020799 | Ga0068854_1000207993 | 148 |
| 46 | 3300005578 | Ga0068854_100663253 | Ga0068854_1006632532 | 148 |
| 47 | 3300005614 | Ga0068856_100014534 | Ga0068856_1000145344 | 148 |
| 48 | 3300005614 | Ga0068856_100752898 | Ga0068856_1007528982 | 148 |
| 49 | 3300005614 | Ga0068856_100979120 | Ga0068856_1009791201 | 148 |
| 50 | 3300005616 | Ga0068852_100007573 | Ga0068852_1000075733 | 148 |
| 51 | 3300005616 | Ga0068852_100407244 | Ga0068852_1004072441 | 148 |
| 52 | 3300005616 | Ga0068852_100709441 | Ga0068852_1007094412 | 148 |
| 53 | 3300005616 | Ga0068852_100786104 | Ga0068852_1007861042 | 148 |
| 54 | 3300005618 | Ga0068864_100346828 | Ga0068864_1003468282 | 148 |
| 55 | 3300005834 | Ga0068851_10400324 | Ga0068851_104003241 | 148 |
| 56 | 3300005843 | Ga0068860_100128366 | Ga0068860_1001283662 | 148 |
| 57 | 3300006237 | Ga0097621_100793322 | Ga0097621_1007933222 | 148 |
| 58 | 3300006358 | Ga0068871_100024833 | Ga0068871_1000248333 | 148 |
| 59 | 3300006881 | Ga0068865_100060082 | Ga0068865_1000600822 | 148 |
| 60 | 3300009093 | Ga0105240_10000431 | Ga0105240_1000043135 | 148 |
| 61 | 3300009093 | Ga0105240_10003449 | Ga0105240_1000344920 | 148 |
| 62 | 3300009093 | Ga0105240_10006516 | Ga0105240_100065164 | 148 |
| 63 | 3300009093 | Ga0105240_10008725 | Ga0105240_100087258 | 148 |
| 64 | 3300009093 | Ga0105240_10020350 | Ga0105240_100203502 | 148 |
| 65 | 3300009093 | Ga0105240_10020350 | Ga0105240_100203503 | 148 |
| 66 | 3300009093 | Ga0105240_10023755 | Ga0105240_100237554 | 148 |
| 67 | 3300009093 | Ga0105240_10047245 | Ga0105240_100472455 | 148 |
| 68 | 3300009174 | Ga0105241_10006712 | Ga0105241_100067124 | 148 |
| 69 | 3300009174 | Ga0105241_10717676 | Ga0105241_107176762 | 148 |
| 70 | 3300009545 | Ga0105237_10024435 | Ga0105237_100244354 | 148 |
| 71 | 3300009545 | Ga0105237_10024435 | Ga0105237_100244355 | 148 |
| 72 | 3300009545 | Ga0105237_10738386 | Ga0105237_107383862 | 148 |
| 73 | 3300009545 | Ga0105237_12235245 | Ga0105237_122352451 | 148 |
| 74 | 3300009551 | Ga0105238_10103500 | Ga0105238_101035002 | 148 |
| 75 | 3300009551 | Ga0105238_10105729 | Ga0105238_101057292 | 148 |
| 76 | 3300010375 | Ga0105239_10056103 | Ga0105239_100561032 | 148 |
| 77 | 3300010375 | Ga0105239_10056103 | Ga0105239_100561033 | 148 |
| 78 | 3300010375 | Ga0105239_10141352 | Ga0105239_101413522 | 148 |
| 79 | 3300010375 | Ga0105239_10184529 | Ga0105239_101845293 | 148 |
| 80 | 3300010375 | Ga0105239_11944263 | Ga0105239_119442631 | 148 |
| 81 | 3300011119 | Ga0105246_10225897 | Ga0105246_102258972 | 148 |
| 82 | 3300013100 | Ga0157373_10161062 | Ga0157373_101610623 | 148 |
| 83 | 3300013104 | Ga0157370_10001756 | Ga0157370_1000175614 | 148 |
| 84 | 3300013104 | Ga0157370_10803833 | Ga0157370_108038332 | 148 |
| 85 | 3300013105 | Ga0157369_10016069 | Ga0157369_100160694 | 148 |
| 86 | 3300013105 | Ga0157369_10067775 | Ga0157369_100677752 | 148 |
| 87 | 3300013296 | Ga0157374_10000025 | Ga0157374_1000002528 | 148 |
| 88 | 3300013306 | Ga0163162_10007556 | Ga0163162_100075567 | 148 |
| 89 | 3300013307 | Ga0157372_10002934 | Ga0157372_1000293411 | 148 |
| 90 | 3300013307 | Ga0157372_10079465 | Ga0157372_100794654 | 148 |
| 91 | 3300013307 | Ga0157372_10211719 | Ga0157372_102117192 | 148 |
| 92 | 3300013307 | Ga0157372_10661755 | Ga0157372_106617553 | 148 |
| 93 | 3300013308 | Ga0157375_10012214 | Ga0157375_100122146 | 148 |
| 94 | 3300014325 | Ga0163163_10026569 | Ga0163163_100265692 | 148 |
| 95 | 3300014745 | Ga0157377_11471671 | Ga0157377_114716711 | 148 |
| 96 | 3300014968 | Ga0157379_10085764 | Ga0157379_100857642 | 148 |
| 97 | 3300014969 | Ga0157376_10003131 | Ga0157376_100031314 | 148 |
| 98 | 3300014969 | Ga0157376_10004871 | Ga0157376_100048714 | 148 |
| 99 | 3300017792 | Ga0163161_10026974 | Ga0163161_100269745 | 148 |
| 100 | 3300020069 | Ga0197907_10267666 | Ga0197907_102676662 | 148 |
| 101 | 3300020070 | Ga0206356_10425736 | Ga0206356_104257362 | 148 |
| 102 | 3300020078 | Ga0206352_10351310 | Ga0206352_103513101 | 148 |
| 103 | 3300020078 | Ga0206352_11032421 | Ga0206352_110324212 | 148 |
| 104 | 3300020081 | Ga0206354_10466767 | Ga0206354_104667671 | 148 |
| 105 | 3300020082 | Ga0206353_11527644 | Ga0206353_115276442 | 148 |
| 106 | 3300022467 | Ga0224712_10091696 | Ga0224712_100916961 | 148 |
| 107 | 3300025904 | Ga0207647_10005447 | Ga0207647_100054474 | 148 |
| 108 | 3300025904 | Ga0207647_10430805 | Ga0207647_104308051 | 148 |
| 109 | 3300025911 | Ga0207654_10015819 | Ga0207654_100158192 | 148 |
| 110 | 3300025911 | Ga0207654_10274496 | Ga0207654_102744962 | 148 |
| 111 | 3300025911 | Ga0207654_10436378 | Ga0207654_104363782 | 148 |
| 112 | 3300025913 | Ga0207695_10000282 | Ga0207695_10000282100 | 148 |
| 113 | 3300025913 | Ga0207695_10001519 | Ga0207695_100015196 | 148 |
| 114 | 3300025913 | Ga0207695_10003026 | Ga0207695_100030264 | 148 |
| 115 | 3300025913 | Ga0207695_10022792 | Ga0207695_100227926 | 148 |
| 116 | 3300025913 | Ga0207695_10073698 | Ga0207695_100736985 | 148 |
| 117 | 3300025913 | Ga0207695_10089115 | Ga0207695_100891152 | 148 |
| 118 | 3300025913 | Ga0207695_10089115 | Ga0207695_100891153 | 148 |
| 119 | 3300025914 | Ga0207671_10005526 | Ga0207671_100055264 | 148 |
| 120 | 3300025914 | Ga0207671_10055812 | Ga0207671_100558123 | 148 |
| 121 | 3300025914 | Ga0207671_10089966 | Ga0207671_100899662 | 148 |
| 122 | 3300025914 | Ga0207671_10089966 | Ga0207671_100899663 | 148 |
| 123 | 3300025914 | Ga0207671_10375475 | Ga0207671_103754752 | 148 |
| 124 | 3300025924 | Ga0207694_10151096 | Ga0207694_101510962 | 148 |
| 125 | 3300025924 | Ga0207694_10660696 | Ga0207694_106606962 | 148 |
| 126 | 3300025924 | Ga0207694_10798822 | Ga0207694_107988221 | 148 |
| 127 | 3300025938 | Ga0207704_10110082 | Ga0207704_101100822 | 148 |
| 128 | 3300025942 | Ga0207689_10250481 | Ga0207689_102504812 | 148 |
| 129 | 3300025942 | Ga0207689_10645467 | Ga0207689_106454671 | 148 |
| 130 | 3300025944 | Ga0207661_10011006 | Ga0207661_100110064 | 148 |
| 131 | 3300025949 | Ga0207667_10000403 | Ga0207667_1000040352 | 148 |
| 132 | 3300025949 | Ga0207667_10001258 | Ga0207667_1000125823 | 148 |
| 133 | 3300025949 | Ga0207667_10099761 | Ga0207667_100997612 | 148 |
| 134 | 3300025981 | Ga0207640_10100670 | Ga0207640_101006703 | 148 |
| 135 | 3300025981 | Ga0207640_10261105 | Ga0207640_102611052 | 148 |
| 136 | 3300026023 | Ga0207677_10230105 | Ga0207677_102301052 | 148 |
| 137 | 3300026041 | Ga0207639_10009849 | Ga0207639_100098495 | 148 |
| 138 | 3300026041 | Ga0207639_10339839 | Ga0207639_103398392 | 148 |
| 139 | 3300026078 | Ga0207702_10135370 | Ga0207702_101353701 | 148 |
| 140 | 3300026078 | Ga0207702_10566994 | Ga0207702_105669942 | 148 |
| 141 | 3300026078 | Ga0207702_11081284 | Ga0207702_110812842 | 148 |
| 142 | 3300026116 | Ga0207674_10014629 | Ga0207674_100146296 | 148 |
| 143 | 3300026142 | Ga0207698_10050815 | Ga0207698_100508152 | 148 |
| 144 | 3300026142 | Ga0207698_10100632 | Ga0207698_101006322 | 148 |
| 145 | 3300026142 | Ga0207698_11239637 | Ga0207698_112396372 | 148 |
| 146 | 3300026142 | Ga0207698_11883163 | Ga0207698_118831631 | 148 |
| 147 | 3300028381 | Ga0268264_10000015 | Ga0268264_10000015176 | 148 |
| 148 | 3300028381 | Ga0268264_10000019 | Ga0268264_10000019274 | 148 |
| 149 | 3300028381 | Ga0268264_10080252 | Ga0268264_100802524 | 148 |
| 150 | 3300028381 | Ga0268264_10347086 | Ga0268264_103470861 | 148 |
| 151 | 3300028786 | Ga0307517_10208584 | Ga0307517_102085842 | 148 |
| 152 | 3300030521 | Ga0307511_10000024 | Ga0307511_1000002472 | 148 |
| 153 | 3300031730 | Ga0307516_10005057 | Ga0307516_100050572 | 148 |
| 154 | 3300033180 | Ga0307510_10003234 | Ga0307510_100032344 | 148 |
| 155 | 3300035692 | Ga0373935_0054675 | Ga0373935_0054675_1843_2298 | 148 |
| 156 | 3300041512 | Ga0451853_3721546 | Ga0451853_3721546_47_499 | 148 |
| 157 | 3300044656 | Ga0466969_0188480 | Ga0466969_0188480_458_913 | 148 |
| 158 | 3300044658 | Ga0466972_0002109 | Ga0466972_0002109_7344_7802 | 148 |
| 159 | 3300044658 | Ga0466972_0054687 | Ga0466972_0054687_494_955 | 148 |
| 160 | 3300044693 | Ga0466961_0029051 | Ga0466961_0029051_2538_2993 | 148 |
| 161 | 3300044719 | Ga0466971_0008879 | Ga0466971_0008879_2824_3279 | 148 |
| 162 | 3300044735 | Ga0466968_0081923 | Ga0466968_0081923_279_737 | 148 |
| 163 | 3300044765 | Ga0466970_0088527 | Ga0466970_0088527_1065_1520 | 148 |
| 164 | 3300044842 | Ga0466957_0054302 | Ga0466957_0054302_784_1239 | 148 |
| 165 | 3300045049 | Ga0466959_0069905 | Ga0466959_0069905_526_981 | 148 |
| 166 | 3300046460 | Ga0495638_0031003 | Ga0495638_0031003_1733_2188 | 148 |
| 167 | 3300046524 | Ga0495648_0000493 | Ga0495648_0000493_30239_30697 | 148 |
| 168 | 3300046524 | Ga0495648_0124364 | Ga0495648_0124364_613_1068 | 148 |
| 169 | 3300046648 | Ga0495611_0000538 | Ga0495611_0000538_5455_5910 | 148 |
| 170 | 3300046694 | Ga0495649_0208059 | Ga0495649_0208059_549_1004 | 148 |
| 171 | 3300047472 | Ga0495686_0000128 | Ga0495686_0000128_93179_93634 | 148 |
| 172 | 3300049581 | Ga0501047_0343510 | Ga0501047_0343510_817_1275 | 148 |
| 173 | 3300049583 | Ga0501067_0172863 | Ga0501067_0172863_227_685 | 148 |
| 174 | 3300049744 | Ga0501083_0457260 | Ga0501083_0457260_308_760 | 148 |
| 175 | 3300049822 | Ga0501035_0792111 | Ga0501035_0792111_153_611 | 148 |
| 176 | 3300053087 | Ga0500643_058838 | Ga0500643_058838_328_786 | 148 |
| 177 | 3300053090 | Ga0500646_0011746 | Ga0500646_0011746_962_1420 | 148 |
| 178 | 3300053092 | Ga0500583_0003555 | Ga0500583_0003555_1734_2192 | 148 |
| 179 | 3300053139 | Ga0500568_0013673 | Ga0500568_0013673_1589_2047 | 148 |
| 180 | 3300053146 | Ga0500588_0262191 | Ga0500588_0262191_96_551 | 148 |
| 181 | 3300053148 | Ga0500590_225293 | Ga0500590_225293_155_688 | 148 |
| 182 | 3300053156 | Ga0500622_0004431 | Ga0500622_0004431_4475_4933 | 148 |
| 183 | 3300053178 | Ga0500637_0096099 | Ga0500637_0096099_696_1229 | 148 |
| 184 | 3300055283 | Ga0500661_065864 | Ga0500661_065864_37_492 | 148 |
| 185 | 3300005355 | Ga0070671_100001243 | Ga0070671_10000124311 | 149 |
| 186 | 3300005718 | Ga0068866_10360545 | Ga0068866_103605452 | 149 |
| 187 | 3300005842 | Ga0068858_100257479 | Ga0068858_1002574792 | 149 |
| 188 | 3300006163 | Ga0070715_10510252 | Ga0070715_105102521 | 149 |
| 189 | 3300006195 | Ga0075366_10025407 | Ga0075366_100254073 | 149 |
| 190 | 3300006237 | Ga0097621_100082229 | Ga0097621_1000822293 | 149 |
| 191 | 3300006358 | Ga0068871_100001412 | Ga0068871_10000141212 | 149 |
| 192 | 3300006881 | Ga0068865_100902492 | Ga0068865_1009024921 | 149 |
| 193 | 3300009174 | Ga0105241_10098371 | Ga0105241_100983712 | 149 |
| 194 | 3300009177 | Ga0105248_10054669 | Ga0105248_100546695 | 149 |
| 195 | 3300009545 | Ga0105237_10035825 | Ga0105237_100358254 | 149 |
| 196 | 3300009553 | Ga0105249_10387830 | Ga0105249_103878302 | 149 |
| 197 | 3300013296 | Ga0157374_10439136 | Ga0157374_104391362 | 149 |
| 198 | 3300013297 | Ga0157378_10025976 | Ga0157378_100259762 | 149 |
| 199 | 3300013297 | Ga0157378_12146772 | Ga0157378_121467721 | 149 |
| 200 | 3300013306 | Ga0163162_10000994 | Ga0163162_100009944 | 149 |
| 201 | 3300013308 | Ga0157375_10043641 | Ga0157375_100436413 | 149 |
| 202 | 3300014968 | Ga0157379_10040496 | Ga0157379_100404964 | 149 |
| 203 | 3300014969 | Ga0157376_10000404 | Ga0157376_100004044 | 149 |
| 204 | 3300017792 | Ga0163161_10025530 | Ga0163161_100255302 | 149 |
| 205 | 3300025899 | Ga0207642_10466611 | Ga0207642_104666112 | 149 |
| 206 | 3300025914 | Ga0207671_10020846 | Ga0207671_100208463 | 149 |
| 207 | 3300025931 | Ga0207644_10010191 | Ga0207644_100101915 | 149 |
| 208 | 3300025938 | Ga0207704_10305052 | Ga0207704_103050522 | 149 |
| 209 | 3300025941 | Ga0207711_10042641 | Ga0207711_100426412 | 149 |
| 210 | 3300028379 | Ga0268266_10773435 | Ga0268266_107734351 | 149 |
| 211 | 3300041997 | Ga0439431_0000821 | Ga0439431_0000821_4163_4612 | 149 |
| 212 | 3300042015 | Ga0439462_0147346 | Ga0439462_0147346_183_632 | 149 |
| 213 | 3300048904 | Ga0496101_0315934 | Ga0496101_0315934_588_1046 | 149 |
| 214 | 3300048917 | Ga0496114_0079426 | Ga0496114_0079426_1058_1516 | 149 |
| 215 | 3300050493 | nmdc:mga0k408_155477_c1 | nmdc:mga0k408_155477_c1_873_1346 | 149 |
| 216 | 3300003322 | rootL2_10040050 | rootL2_100400503 | 150 |
| 217 | 3300009093 | Ga0105240_10007181 | Ga0105240_100071813 | 150 |
| 218 | 3300047320 | Ga0495672_0001585 | Ga0495672_0001585_3733_4188 | 150 |
| 219 | 3300001979 | JGI24740J21852_10001467 | JGI24740J21852_100014677 | 151 |
| 220 | 3300001989 | JGI24739J22299_10039716 | JGI24739J22299_100397162 | 151 |
| 221 | 3300002738 | JGI25154J39366_1000020 | JGI25154J39366_100002088 | 151 |
| 222 | 3300002741 | JGI25157J39369_1003680 | JGI25157J39369_10036802 | 151 |
| 223 | 3300002987 | JGI25159J45721_1039445 | JGI25159J45721_10394452 | 151 |
| 224 | 3300003215 | JGI25153J46596_10000268 | JGI25153J46596_1000026814 | 151 |
| 225 | 3300003215 | JGI25153J46596_10014001 | JGI25153J46596_100140012 | 151 |
| 226 | 3300003316 | rootH1_10078318 | rootH1_100783182 | 151 |
| 227 | 3300003320 | rootH2_10009901 | rootH2_100099012 | 151 |
| 228 | 3300003320 | rootH2_10081373 | rootH2_100813732 | 151 |
| 229 | 3300003320 | rootH2_10092437 | rootH2_100924372 | 151 |
| 230 | 3300003322 | rootL2_10045218 | rootL2_100452183 | 151 |
| 231 | 3300003322 | rootL2_10049962 | rootL2_100499626 | 151 |
| 232 | 3300003322 | rootL2_10179769 | rootL2_101797693 | 151 |
| 233 | 3300003322 | rootL2_10190388 | rootL2_101903882 | 151 |
| 234 | 3300003323 | rootH1_10001197 | rootH1_100011972 | 151 |
| 235 | 3300003323 | rootH1_10075127 | rootH1_100751273 | 151 |
| 236 | 3300003323 | rootH1_10096158 | rootH1_100961582 | 151 |
| 237 | 3300003323 | rootH1_10164288 | rootH1_101642883 | 151 |
| 238 | 3300003354 | JGI25160J50197_1003243 | JGI25160J50197_10032434 | 151 |
| 239 | 3300003354 | JGI25160J50197_1004459 | JGI25160J50197_10044595 | 151 |
| 240 | 3300003762 | Ga0055542_1021878 | Ga0055542_10218782 | 151 |
| 241 | 3300003771 | Ga0055526_1027493 | Ga0055526_10274932 | 151 |
| 242 | 3300003790 | Ga0055528_1002450 | Ga0055528_10024504 | 151 |
| 243 | 3300003791 | Ga0055530_10000584 | Ga0055530_1000058423 | 151 |
| 244 | 3300003794 | Ga0055531_10000819 | Ga0055531_1000081915 | 151 |
| 245 | 3300003794 | Ga0055531_10025662 | Ga0055531_100256622 | 151 |
| 246 | 3300004625 | Ga0055543_1010741 | Ga0055543_10107412 | 151 |
| 247 | 3300005262 | Ga0065165_1000914 | Ga0065165_10009149 | 151 |
| 248 | 3300005262 | Ga0065165_1015985 | Ga0065165_10159854 | 151 |
| 249 | 3300005289 | Ga0065704_10071111 | Ga0065704_100711115 | 151 |
| 250 | 3300006195 | Ga0075366_10163402 | Ga0075366_101634022 | 151 |
| 251 | 3300010375 | Ga0105239_10346807 | Ga0105239_103468073 | 151 |
| 252 | 3300013104 | Ga0157370_10182607 | Ga0157370_101826072 | 151 |
| 253 | 3300015265 | Ga0182005_1000116 | Ga0182005_10001166 | 151 |
| 254 | 3300020070 | Ga0206356_10206394 | Ga0206356_102063942 | 151 |
| 255 | 3300025208 | Ga0209436_105907 | Ga0209436_1059072 | 151 |
| 256 | 3300025242 | Ga0209258_100075 | Ga0209258_10007572 | 151 |
| 257 | 3300025246 | Ga0209646_1000005 | Ga0209646_1000005473 | 151 |
| 258 | 3300025246 | Ga0209646_1013872 | Ga0209646_10138722 | 151 |
| 259 | 3300025250 | Ga0209026_1000149 | Ga0209026_100014934 | 151 |
| 260 | 3300025254 | Ga0209148_1000085 | Ga0209148_1000085157 | 151 |
| 261 | 3300025273 | Ga0209673_1000242 | Ga0209673_100024268 | 151 |
| 262 | 3300025284 | Ga0209130_1001019 | Ga0209130_100101911 | 151 |
| 263 | 3300025291 | Ga0209675_1067749 | Ga0209675_10677492 | 151 |
| 264 | 3300025295 | Ga0209564_1012258 | Ga0209564_10122582 | 151 |
| 265 | 3300025297 | Ga0209758_1000795 | Ga0209758_100079524 | 151 |
| 266 | 3300025297 | Ga0209758_1008721 | Ga0209758_10087211 | 151 |
| 267 | 3300025297 | Ga0209758_1010337 | Ga0209758_10103373 | 151 |
| 268 | 3300025297 | Ga0209758_1027895 | Ga0209758_10278952 | 151 |
| 269 | 3300025298 | Ga0209050_1000298 | Ga0209050_100029824 | 151 |
| 270 | 3300025302 | Ga0207426_1000057 | Ga0207426_100005737 | 151 |
| 271 | 3300025302 | Ga0207426_1000262 | Ga0207426_100026256 | 151 |
| 272 | 3300025302 | Ga0207426_1001013 | Ga0207426_100101321 | 151 |
| 273 | 3300025302 | Ga0207426_1003809 | Ga0207426_10038096 | 151 |
| 274 | 3300025303 | Ga0209051_1061131 | Ga0209051_10611312 | 151 |
| 275 | 3300025304 | Ga0209257_1000004 | Ga0209257_10000041073 | 151 |
| 276 | 3300025304 | Ga0209257_1004947 | Ga0209257_10049479 | 151 |
| 277 | 3300026035 | Ga0207703_10703973 | Ga0207703_107039732 | 151 |
| 278 | 3300026116 | Ga0207674_10940092 | Ga0207674_109400921 | 151 |
| 279 | 3300032004 | Ga0307414_10031478 | Ga0307414_100314784 | 151 |
| 280 | 3300041404 | Ga0439436_0026048 | Ga0439436_0026048_709_1230 | 151 |
| 281 | 3300041459 | Ga0451800_0852966 | Ga0451800_0852966_182_637 | 151 |
| 282 | 3300041491 | Ga0451833_0549414 | Ga0451833_0549414_166_621 | 151 |
| 283 | 3300041997 | Ga0439431_0036646 | Ga0439431_0036646_447_902 | 151 |
| 284 | 3300042007 | Ga0439449_0076735 | Ga0439449_0076735_558_1079 | 151 |
| 285 | 3300044656 | Ga0466969_0121033 | Ga0466969_0121033_152_607 | 151 |
| 286 | 3300044658 | Ga0466972_0085593 | Ga0466972_0085593_201_656 | 151 |
| 287 | 3300044683 | Ga0466965_0027837 | Ga0466965_0027837_603_1058 | 151 |
| 288 | 3300044842 | Ga0466957_0615867 | Ga0466957_0615867_235_690 | 151 |
| 289 | 3300045049 | Ga0466959_0048418 | Ga0466959_0048418_1976_2431 | 151 |
| 290 | 3300046453 | Ga0495627_003149 | Ga0495627_003149_4179_4634 | 151 |
| 291 | 3300046558 | Ga0495633_0000022 | Ga0495633_0000022_88003_88458 | 151 |
| 292 | 3300046616 | Ga0495668_0001251 | Ga0495668_0001251_10615_11073 | 151 |
| 293 | 3300046660 | Ga0495625_0302097 | Ga0495625_0302097_89_544 | 151 |
| 294 | 3300048924 | Ga0496121_0000010 | Ga0496121_0000010_172490_172945 | 151 |
| 295 | 3300048928 | Ga0496125_0475052 | Ga0496125_0475052_54_509 | 151 |
| 296 | 3300048929 | Ga0496126_0043669 | Ga0496126_0043669_2960_3415 | 151 |
| 297 | 3300049535 | Ga0501319_004597 | Ga0501319_004597_223_678 | 151 |
| 298 | 3300049571 | Ga0501034_0023444 | Ga0501034_0023444_3402_3857 | 151 |
| 299 | 3300049571 | Ga0501034_0400701 | Ga0501034_0400701_738_1193 | 151 |
| 300 | 3300049681 | Ga0501251_023735 | Ga0501251_023735_53_508 | 151 |
| 301 | 3300049758 | Ga0501241_002778 | Ga0501241_002778_692_1147 | 151 |
| 302 | 3300050493 | nmdc:mga0k408_34987_c1 | nmdc:mga0k408_34987_c1_34_489 | 151 |
| 303 | 3300053090 | Ga0500646_0005181 | Ga0500646_0005181_1121_1576 | 151 |
| 304 | 3300053092 | Ga0500583_0023890 | Ga0500583_0023890_667_1122 | 151 |
| 305 | 3300053093 | Ga0500651_0050624 | Ga0500651_0050624_1449_1904 | 151 |
| 306 | 3300053131 | Ga0500652_001355 | Ga0500652_001355_6203_6658 | 151 |
| 307 | 3300053134 | Ga0500658_0126041 | Ga0500658_0126041_260_715 | 151 |
| 308 | 3300053139 | Ga0500568_0038273 | Ga0500568_0038273_256_711 | 151 |
| 309 | 3300053142 | Ga0500577_0003027 | Ga0500577_0003027_3679_4134 | 151 |
| 310 | 3300053148 | Ga0500590_068942 | Ga0500590_068942_84_539 | 151 |
| 311 | 3300053151 | Ga0500604_0013370 | Ga0500604_0013370_1075_1533 | 151 |
| 312 | 3300053153 | Ga0500616_0010035 | Ga0500616_0010035_3753_4208 | 151 |
| 313 | 3300053156 | Ga0500622_0000497 | Ga0500622_0000497_17022_17477 | 151 |
| 314 | 3300053161 | Ga0500634_0072686 | Ga0500634_0072686_1183_1638 | 151 |
| 315 | 3300053177 | Ga0500636_0071095 | Ga0500636_0071095_151_606 | 151 |
| 316 | 3300055283 | Ga0500661_002867 | Ga0500661_002867_753_1208 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6c29-assembly3.cif.gz_C | crystal structure of the n-terminal periplasmic domain of scsb from proteus mirabilis | 0.6785 | 25 | 149 |
| 1vrs-assembly3.cif.gz_C | crystal structure of the disulfide-linked complex between the n-terminal and c-terminal domain of the electron transfer catalyst dsbd | 0.6725 | 27 | 143 |
| 2k9f-assembly1.cif.gz_B | structural features of the complex between the dsbd n-terminal and the pilb n-terminal domains from neisseria meningitidis | 0.6653 | 21 | 145 |
| 5cn1-assembly5.cif.gz_C | crystal structure of yeast gga1_gae domain-p21 | 0.656 | 23 | 148 |
| 6dnv-assembly2.cif.gz_B | crystal structure of neisseria meningitidis dsbd n-terminal domain in the reduced form | 0.6548 | 27 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5A6M6_713_823_2.60.40.1230 | Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain | 0.6987 | 21 | 148 | 2.60.40.1230 |
| af_I1NAT9_152_253_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.6963 | 121 | 145 | 3.40.50.2000 |
| af_Q9C615_34_137_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6757 | 121 | 145 | 2.60.40.10 |
| af_Q86KI1_749_872_2.60.40.1230 | Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain | 0.6733 | 25 | 146 | 2.60.40.1230 |
| af_A4HT27_716_845_2.60.40.1230 | Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain | 0.6645 | 24 | 146 | 2.60.40.1230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1N7KL46-F1-model_v4 | Thiol:disulfide interchange protein DsbD | 0.9891 | 19 | 148 |
GO:0015035
GO:0045454 |
| AF-A0A4P5T1Q3-F1-model_v4 | Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein | 0.9874 | 24 | 150 |
|
| AF-A0A1Q3TG54-F1-model_v4 | Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein | 0.9812 | 21 | 148 |
|
| AF-A0A3B7MKD2-F1-model_v4 | Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein | 0.9654 | 12 | 151 |
GO:0015035
GO:0045454 |
| AF-A0A497D3M2-F1-model_v4 | Disulfide bond formation protein DsbD | 0.9599 | 20 | 151 |
GO:0015035
GO:0016020 GO:0017004 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar