F403923

General Info

Members Datasets Scaffolds Average Seq Length
316 187 292 152

Family's Representative Sequence

Representative Sequence 3300053148|Ga0500590_225293|Ga0500590_225293_155_688
Length 177
Sequence MLNFRLSGVSEKRRRIRWKKRDNKRDMKKALFFSVALLAGAVAMAQSSKQVSWNYSAKKLSDKVYEVHMTATVGGDYHIYAQHPGGDGPIPTSFKFTKNPLLLVTGNVKENGKLVKKFESAWGFEVIYYEKAVDFVVVVRLKGNVKTSLAGTVEFMVCNDHECLPPANVDIKVNIGG

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
5 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
6 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
7 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
8 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
9 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
10 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
11 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
12 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
13 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
14 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
130 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
164 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
172 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
175 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
178 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
179 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
180 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
183 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
184 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
185 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
186 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
187 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.46
Metatranscriptomes 2.85
Isolates 5.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.99
Nodule 0
Rhizoplane 0.95
Rhizosphere 65.19
Stem 0
Stem Tuber 0
Unclassified 14.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001467 3300001979 Bacteria 10822
2 JGI24739J22299_10039716 3300001989 Bacteria 1575
3 JGI25154J39366_1000020 3300002738 Bacteria 233181
4 JGI25157J39369_1003680 3300002741 Bacteria 3033
5 JGI25159J45721_1039445 3300002987 Bacteria 698
6 JGI25153J46596_10000268 3300003215 Bacteria 41181
7 JGI25153J46596_10014001 3300003215 Bacteria 3359
8 rootH1_10014754 3300003316 Bacteria 4231
9 rootH1_10078318 3300003316 Bacteria 1408
10 rootH2_10001202 3300003320 Bacteria 51390
11 rootH2_10009901 3300003320 Bacteria 3650
12 rootH2_10029245 3300003320 Unclassified 2340
13 rootH2_10081373 3300003320 Bacteria 1414
14 rootH2_10092437 3300003320 Bacteria 3110
15 rootH2_10152349 3300003320 Bacteria 1188
16 rootH2_10234178 3300003320 Bacteria 3170
17 rootL2_10040050 3300003322 Bacteria 3805
18 rootL2_10045218 3300003322 Bacteria 3930
19 rootL2_10049962 3300003322 Bacteria 6812
20 rootL2_10078076 3300003322 Bacteria 3695
21 rootL2_10179769 3300003322 Bacteria 3381
22 rootL2_10190388 3300003322 Bacteria 1016
23 rootH1_10001197 3300003323 Bacteria 1897
24 rootH1_10075127 3300003323 Bacteria 4985
25 rootH1_10096158 3300003323 Bacteria 1654
26 rootH1_10164288 3300003323 Bacteria 4784
27 rootH1_10292604 3300003323 Bacteria 1072
28 JGI25160J50197_1003243 3300003354 Bacteria 7340
29 JGI25160J50197_1004459 3300003354 Bacteria 6047
30 Ga0055542_1021878 3300003762 Bacteria 916
31 Ga0055526_1027493 3300003771 Bacteria 1756
32 Ga0055528_1002450 3300003790 Bacteria 9926
33 Ga0055530_10000584 3300003791 Bacteria 31522
34 Ga0055531_10000819 3300003794 Bacteria 25805
35 Ga0055531_10025662 3300003794 Bacteria 2131
36 Ga0055543_1010741 3300004625 Bacteria 1907
37 Ga0065165_1000914 3300005262 Bacteria 38063
38 Ga0065165_1015985 3300005262 Bacteria 2833
39 Ga0065704_10071111 3300005289 Bacteria 13098
40 Ga0070676_10584474 3300005328 Bacteria 803
41 Ga0070683_100016276 3300005329 Bacteria 6556
42 Ga0068869_100057433 3300005334 Unclassified 2841
43 Ga0070666_10003925 3300005335 Bacteria 9031
44 Ga0068868_100274812 3300005338 Bacteria 1424
45 Ga0070691_10149776 3300005341 Unclassified 1195
46 Ga0070671_100001243 3300005355 Bacteria 19091
47 Ga0070667_100717872 3300005367 Unclassified 925
48 Ga0070684_100013309 3300005535 Bacteria 6630
49 Ga0068853_100209290 3300005539 Bacteria 1777
50 Ga0068855_100013516 3300005563 Bacteria 9843
51 Ga0068855_100021783 3300005563 Bacteria 7687
52 Ga0068855_100078588 3300005563 Bacteria 3827
53 Ga0068855_100943632 3300005563 Unclassified 909
54 Ga0068857_100012019 3300005577 Bacteria 7529
55 Ga0068854_100020799 3300005578 Unclassified 4446
56 Ga0068854_100663253 3300005578 Unclassified 897
57 Ga0068856_100014534 3300005614 Bacteria 7607
58 Ga0068856_100752898 3300005614 Bacteria 994
59 Ga0068856_100979120 3300005614 Bacteria 864
60 Ga0068852_100007573 3300005616 Bacteria 7934
61 Ga0068852_100407244 3300005616 Bacteria 1339
62 Ga0068852_100709441 3300005616 Unclassified 1016
63 Ga0068852_100786104 3300005616 Bacteria 965
64 Ga0068864_100346828 3300005618 Bacteria 1400
65 Ga0068866_10360545 3300005718 Bacteria 926
66 Ga0068851_10400324 3300005834 Bacteria 808
67 Ga0068858_100257479 3300005842 Unclassified 1658
68 Ga0068860_100128366 3300005843 Bacteria 2431
69 Ga0070715_10510252 3300006163 Bacteria 690
70 Ga0075366_10025407 3300006195 Bacteria 3460
71 Ga0075366_10163402 3300006195 Unclassified 1350
72 Ga0097621_100082229 3300006237 Bacteria 2681
73 Ga0097621_100793322 3300006237 Unclassified 877
74 Ga0068871_100001412 3300006358 Bacteria 16072
75 Ga0068871_100024833 3300006358 Bacteria 4653
76 Ga0068865_100060082 3300006881 Unclassified 2660
77 Ga0068865_100902492 3300006881 Bacteria 769
78 Ga0105240_10000431 3300009093 Bacteria 77497
79 Ga0105240_10003449 3300009093 Bacteria 24537
80 Ga0105240_10006516 3300009093 Bacteria 17139
81 Ga0105240_10007181 3300009093 Bacteria 16222
82 Ga0105240_10008725 3300009093 Bacteria 14451
83 Ga0105240_10020350 3300009093 Bacteria 8856
84 Ga0105240_10023755 3300009093 Bacteria 8097
85 Ga0105240_10047245 3300009093 Bacteria 5448
86 Ga0105241_10006712 3300009174 Bacteria 8468
87 Ga0105241_10098371 3300009174 Bacteria 2321
88 Ga0105241_10717676 3300009174 Unclassified 914
89 Ga0105248_10054669 3300009177 Bacteria 4477
90 Ga0105237_10024435 3300009545 Bacteria 6181
91 Ga0105237_10035825 3300009545 Bacteria 5020
92 Ga0105237_10738386 3300009545 Bacteria 991
93 Ga0105237_12235245 3300009545 Bacteria 557
94 Ga0105238_10103500 3300009551 Unclassified 2828
95 Ga0105238_10105729 3300009551 Unclassified 2796
96 Ga0105249_10387830 3300009553 Bacteria 1424
97 Ga0105239_10056103 3300010375 Bacteria 4321
98 Ga0105239_10141352 3300010375 Bacteria 2682
99 Ga0105239_10184529 3300010375 Bacteria 2334
100 Ga0105239_10346807 3300010375 Bacteria 1676
101 Ga0105239_11944263 3300010375 Unclassified 682
102 Ga0105246_10225897 3300011119 Bacteria 1471
103 Ga0157373_10161062 3300013100 Bacteria 1579
104 Ga0157370_10001756 3300013104 Bacteria 26720
105 Ga0157370_10182607 3300013104 Bacteria 1949
106 Ga0157370_10803833 3300013104 Unclassified 856
107 Ga0157369_10016069 3300013105 Bacteria 8421
108 Ga0157369_10067775 3300013105 Bacteria 3835
109 Ga0157374_10000025 3300013296 Bacteria 245131
110 Ga0157374_10439136 3300013296 Unclassified 1305
111 Ga0157378_10025976 3300013297 Bacteria 5161
112 Ga0157378_12146772 3300013297 Bacteria 609
113 Ga0163162_10000994 3300013306 Bacteria 26396
114 Ga0163162_10007556 3300013306 Bacteria 10587
115 Ga0157372_10002934 3300013307 Bacteria 18400
116 Ga0157372_10079465 3300013307 Bacteria 3709
117 Ga0157372_10211719 3300013307 Bacteria 2246
118 Ga0157372_10661755 3300013307 Unclassified 1216
119 Ga0157375_10012214 3300013308 Bacteria 7614
120 Ga0157375_10043641 3300013308 Bacteria 4350
121 Ga0163163_10026569 3300014325 Bacteria 5536
122 Ga0157377_11471671 3300014745 Bacteria 540
123 Ga0157379_10040496 3300014968 Bacteria 4158
124 Ga0157379_10085764 3300014968 Bacteria 2823
125 Ga0157376_10000404 3300014969 Bacteria 28086
126 Ga0157376_10003131 3300014969 Bacteria 11367
127 Ga0157376_10004871 3300014969 Bacteria 9359
128 Ga0182005_1000116 3300015265 Bacteria 57638
129 Ga0163161_10025530 3300017792 Bacteria 4182
130 Ga0163161_10026974 3300017792 Bacteria 4073
131 Ga0197907_10267666 3300020069 Bacteria 1317
132 Ga0206356_10206394 3300020070 Bacteria 645
133 Ga0206356_10425736 3300020070 Bacteria 1380
134 Ga0206352_10351310 3300020078 Unclassified 663
135 Ga0206352_11032421 3300020078 Bacteria 1476
136 Ga0206354_10466767 3300020081 Unclassified 789
137 Ga0206353_11527644 3300020082 Bacteria 1320
138 Ga0224712_10091696 3300022467 Bacteria 1274
139 Ga0209436_105907 3300025208 Bacteria 2745
140 Ga0209258_100075 3300025242 Bacteria 270751
141 Ga0209646_1000005 3300025246 Bacteria 717627
142 Ga0209646_1013872 3300025246 Bacteria 1219
143 Ga0209026_1000149 3300025250 Bacteria 111200
144 Ga0209148_1000085 3300025254 Bacteria 265193
145 Ga0209673_1000242 3300025273 Bacteria 104669
146 Ga0209130_1001019 3300025284 Bacteria 21610
147 Ga0209675_1067749 3300025291 Unclassified 687
148 Ga0209564_1012258 3300025295 Bacteria 3753
149 Ga0209758_1000795 3300025297 Bacteria 44872
150 Ga0209758_1008721 3300025297 Bacteria 6481
151 Ga0209758_1010337 3300025297 Bacteria 5601
152 Ga0209758_1027895 3300025297 Bacteria 2403
153 Ga0209050_1000298 3300025298 Bacteria 104315
154 Ga0207426_1000057 3300025302 Bacteria 369548
155 Ga0207426_1000262 3300025302 Bacteria 111889
156 Ga0207426_1001013 3300025302 Bacteria 27217
157 Ga0207426_1003809 3300025302 Bacteria 7818
158 Ga0209051_1061131 3300025303 Bacteria 1185
159 Ga0209257_1000004 3300025304 Bacteria 1678347
160 Ga0209257_1004947 3300025304 Bacteria 9775
161 Ga0207642_10466611 3300025899 Bacteria 767
162 Ga0207647_10005447 3300025904 Bacteria 9325
163 Ga0207647_10430805 3300025904 Bacteria 741
164 Ga0207654_10015819 3300025911 Bacteria 3921
165 Ga0207654_10274496 3300025911 Unclassified 1138
166 Ga0207654_10436378 3300025911 Bacteria 916
167 Ga0207695_10000282 3300025913 Bacteria 126242
168 Ga0207695_10001519 3300025913 Bacteria 38506
169 Ga0207695_10003026 3300025913 Bacteria 24133
170 Ga0207695_10022792 3300025913 Bacteria 7094
171 Ga0207695_10073698 3300025913 Bacteria 3478
172 Ga0207695_10089115 3300025913 Unclassified 3103
173 Ga0207671_10005526 3300025914 Bacteria 11620
174 Ga0207671_10020846 3300025914 Bacteria 4984
175 Ga0207671_10055812 3300025914 Bacteria 2926
176 Ga0207671_10089966 3300025914 Unclassified 2311
177 Ga0207671_10375475 3300025914 Bacteria 1129
178 Ga0207694_10151096 3300025924 Unclassified 1871
179 Ga0207694_10660696 3300025924 Bacteria 881
180 Ga0207694_10798822 3300025924 Unclassified 797
181 Ga0207644_10010191 3300025931 Bacteria 6192
182 Ga0207704_10110082 3300025938 Unclassified 1860
183 Ga0207704_10305052 3300025938 Bacteria 1221
184 Ga0207711_10042641 3300025941 Unclassified 3867
185 Ga0207689_10250481 3300025942 Bacteria 1465
186 Ga0207689_10645467 3300025942 Unclassified 892
187 Ga0207661_10011006 3300025944 Bacteria 6537
188 Ga0207667_10000403 3300025949 Bacteria 58481
189 Ga0207667_10001258 3300025949 Bacteria 31777
190 Ga0207667_10099761 3300025949 Bacteria 2996
191 Ga0207640_10100670 3300025981 Bacteria 2025
192 Ga0207640_10261105 3300025981 Bacteria 1350
193 Ga0207677_10230105 3300026023 Bacteria 1493
194 Ga0207703_10703973 3300026035 Bacteria 961
195 Ga0207639_10009849 3300026041 Bacteria 6601
196 Ga0207639_10339839 3300026041 Unclassified 1338
197 Ga0207702_10135370 3300026078 Bacteria 2222
198 Ga0207702_10566994 3300026078 Bacteria 1112
199 Ga0207702_11081284 3300026078 Bacteria 796
200 Ga0207674_10014629 3300026116 Bacteria 8654
201 Ga0207674_10940092 3300026116 Bacteria 833
202 Ga0207698_10050815 3300026142 Unclassified 3166
203 Ga0207698_10100632 3300026142 Unclassified 2395
204 Ga0207698_11239637 3300026142 Unclassified 760
205 Ga0207698_11883163 3300026142 Bacteria 613
206 Ga0268266_10773435 3300028379 Bacteria 927
207 Ga0268264_10000015 3300028381 Bacteria 508501
208 Ga0268264_10000019 3300028381 Bacteria 488112
209 Ga0268264_10080252 3300028381 Bacteria 2786
210 Ga0268264_10347086 3300028381 Bacteria 1411
211 Ga0307517_10208584 3300028786 Bacteria 1208
212 Ga0307511_10000024 3300030521 Bacteria 112616
213 Ga0307516_10005057 3300031730 Bacteria 15964
214 Ga0307516_10280344 3300031730 Bacteria 1349
215 Ga0307414_10031478 3300032004 Bacteria 3481
216 Ga0307510_10003234 3300033180 Bacteria 18935
217 Ga0373935_0054675 3300035692 Bacteria 2543
218 Ga0439436_0026048 3300041404 Bacteria 1716
219 Ga0451800_0852966 3300041459 Bacteria 651
220 Ga0451833_0549414 3300041491 Bacteria 1548
221 Ga0451853_3721546 3300041512 Bacteria 532
222 Ga0439431_0000821 3300041997 Bacteria 6710
223 Ga0439431_0036646 3300041997 Bacteria 1236
224 Ga0439449_0076735 3300042007 Bacteria 1232
225 Ga0439462_0147346 3300042015 Bacteria 661
226 Ga0466969_0121033 3300044656 Bacteria 1218
227 Ga0466969_0188480 3300044656 Unclassified 943
228 Ga0466972_0002109 3300044658 Bacteria 9755
229 Ga0466972_0054687 3300044658 Bacteria 1920
230 Ga0466972_0085593 3300044658 Bacteria 1498
231 Ga0466965_0027837 3300044683 Bacteria 2744
232 Ga0466961_0029051 3300044693 Bacteria 3555
233 Ga0466971_0008879 3300044719 Bacteria 4391
234 Ga0466968_0081923 3300044735 Bacteria 1419
235 Ga0466970_0088527 3300044765 Bacteria 1679
236 Ga0466957_0054302 3300044842 Bacteria 2445
237 Ga0466957_0615867 3300044842 Bacteria 761
238 Ga0466959_0048418 3300045049 Bacteria 3123
239 Ga0466959_0069905 3300045049 Unclassified 2543
240 Ga0495627_003149 3300046453 Bacteria 7451
241 Ga0495638_0031003 3300046460 Unclassified 3438
242 Ga0495648_0000493 3300046524 Bacteria 42504
243 Ga0495648_0124364 3300046524 Viruses 1381
244 Ga0495633_0000022 3300046558 Bacteria 226582
245 Ga0495668_0001251 3300046616 Bacteria 25451
246 Ga0495611_0000538 3300046648 Bacteria 22219
247 Ga0495625_0302097 3300046660 Unclassified 1024
248 Ga0495649_0208059 3300046694 Bacteria 1014
249 Ga0495672_0001585 3300047320 Bacteria 22189
250 Ga0495686_0000128 3300047472 Bacteria 156223
251 Ga0496101_0315934 3300048904 Bacteria 1225
252 Ga0496114_0079426 3300048917 Bacteria 2769
253 Ga0496121_0000010 3300048924 Bacteria 793488
254 Ga0496125_0475052 3300048928 Bacteria 710
255 Ga0496126_0043669 3300048929 Bacteria 4133
256 Ga0501319_004597 3300049535 Bacteria 965
257 Ga0501034_0023444 3300049571 Bacteria 6289
258 Ga0501034_0400701 3300049571 Bacteria 1295
259 Ga0501047_0343510 3300049581 Bacteria 1330
260 Ga0501067_0172863 3300049583 Unclassified 1203
261 Ga0501238_041193 3300049671 Bacteria 680
262 Ga0501251_023735 3300049681 Bacteria 833
263 Ga0501083_0457260 3300049744 Unclassified 831
264 Ga0501241_002778 3300049758 Bacteria 3371
265 Ga0501035_0792111 3300049822 Unclassified 758
266 Ga0501044_0194509 3300049823 Unclassified 1989
267 Ga0501044_0528815 3300049823 Unclassified 1078
268 nmdc:mga0k408_155477_c1 3300050493 Bacteria 1362
269 nmdc:mga0k408_34987_c1 3300050493 Bacteria 2878
270 Ga0500643_058838 3300053087 Unclassified 1083
271 Ga0500646_0005181 3300053090 Bacteria 3300
272 Ga0500646_0011746 3300053090 Bacteria 2255
273 Ga0500583_0003555 3300053092 Bacteria 4928
274 Ga0500583_0023890 3300053092 Bacteria 2585
275 Ga0500651_0050624 3300053093 Bacteria 2606
276 Ga0500652_001355 3300053131 Bacteria 7662
277 Ga0500658_0126041 3300053134 Bacteria 1138
278 Ga0500568_0013673 3300053139 Bacteria 3692
279 Ga0500568_0038273 3300053139 Unclassified 1941
280 Ga0500577_0003027 3300053142 Bacteria 4341
281 Ga0500588_0262191 3300053146 Unclassified 650
282 Ga0500590_068942 3300053148 Bacteria 1761
283 Ga0500590_225293 3300053148 Unclassified 769
284 Ga0500604_0013370 3300053151 Bacteria 2224
285 Ga0500616_0010035 3300053153 Bacteria 5693
286 Ga0500622_0000497 3300053156 Bacteria 36689
287 Ga0500622_0004431 3300053156 Bacteria 8826
288 Ga0500634_0072686 3300053161 Bacteria 1795
289 Ga0500636_0071095 3300053177 Bacteria 2018
290 Ga0500637_0096099 3300053178 Bacteria 1717
291 Ga0500661_002867 3300055283 Bacteria 3249
292 Ga0500661_065864 3300055283 Unclassified 658

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_10003925 Ga0070666_100039251 132
2 3300049671 Ga0501238_041193 Ga0501238_041193_12_440 142
3 iso_pu_bacteria 2929921140 2929927701 146
4 3300031730 Ga0307516_10280344 Ga0307516_102803442 147
5 3300046460 Ga0495638_0031003 Ga0495638_0031003_2246_2692 147
6 3300049823 Ga0501044_0194509 Ga0501044_0194509_594_1040 147
7 3300049823 Ga0501044_0528815 Ga0501044_0528815_432_878 147
8 iso_pu_bacteria 2818991442 2819571918 147
9 iso_pu_bacteria 2818991460 2819677692 147
10 iso_pu_bacteria 2821136567 2821141838 147
11 iso_pu_bacteria 2840677318 2840679344 147
12 iso_pu_bacteria 2883068021 2883069869 147
13 iso_pu_bacteria 2884791551 2884797634 147
14 iso_pu_bacteria 2896085136 2896087155 147
15 iso_pu_bacteria 2896109856 2896114428 147
16 iso_pu_bacteria 2904467357 2904469747 147
17 iso_pu_bacteria 2929177148 2929180135 147
18 iso_pu_bacteria 2929177148 2929183317 147
19 iso_pu_bacteria 2929239360 2929245437 147
20 iso_pu_bacteria 2945977869 2945979277 147
21 iso_pu_bacteria 2945977869 2945982540 147
22 iso_pu_bacteria 2946013367 2946014852 147
23 iso_pu_bacteria 2946013367 2946018069 147
24 iso_pu_bacteria 8003151029 8003151549 147
25 3300003316 rootH1_10014754 rootH1_100147543 148
26 3300003320 rootH2_10001202 rootH2_1000120236 148
27 3300003320 rootH2_10029245 rootH2_100292452 148
28 3300003320 rootH2_10152349 rootH2_101523492 148
29 3300003320 rootH2_10234178 rootH2_102341782 148
30 3300003322 rootL2_10078076 rootL2_100780762 148
31 3300003323 rootH1_10292604 rootH1_102926042 148
32 3300005328 Ga0070676_10584474 Ga0070676_105844741 148
33 3300005329 Ga0070683_100016276 Ga0070683_1000162764 148
34 3300005334 Ga0068869_100057433 Ga0068869_1000574332 148
35 3300005338 Ga0068868_100274812 Ga0068868_1002748122 148
36 3300005341 Ga0070691_10149776 Ga0070691_101497762 148
37 3300005367 Ga0070667_100717872 Ga0070667_1007178721 148
38 3300005535 Ga0070684_100013309 Ga0070684_1000133094 148
39 3300005539 Ga0068853_100209290 Ga0068853_1002092901 148
40 3300005563 Ga0068855_100013516 Ga0068855_1000135162 148
41 3300005563 Ga0068855_100021783 Ga0068855_1000217835 148
42 3300005563 Ga0068855_100078588 Ga0068855_1000785883 148
43 3300005563 Ga0068855_100943632 Ga0068855_1009436322 148
44 3300005577 Ga0068857_100012019 Ga0068857_1000120195 148
45 3300005578 Ga0068854_100020799 Ga0068854_1000207993 148
46 3300005578 Ga0068854_100663253 Ga0068854_1006632532 148
47 3300005614 Ga0068856_100014534 Ga0068856_1000145344 148
48 3300005614 Ga0068856_100752898 Ga0068856_1007528982 148
49 3300005614 Ga0068856_100979120 Ga0068856_1009791201 148
50 3300005616 Ga0068852_100007573 Ga0068852_1000075733 148
51 3300005616 Ga0068852_100407244 Ga0068852_1004072441 148
52 3300005616 Ga0068852_100709441 Ga0068852_1007094412 148
53 3300005616 Ga0068852_100786104 Ga0068852_1007861042 148
54 3300005618 Ga0068864_100346828 Ga0068864_1003468282 148
55 3300005834 Ga0068851_10400324 Ga0068851_104003241 148
56 3300005843 Ga0068860_100128366 Ga0068860_1001283662 148
57 3300006237 Ga0097621_100793322 Ga0097621_1007933222 148
58 3300006358 Ga0068871_100024833 Ga0068871_1000248333 148
59 3300006881 Ga0068865_100060082 Ga0068865_1000600822 148
60 3300009093 Ga0105240_10000431 Ga0105240_1000043135 148
61 3300009093 Ga0105240_10003449 Ga0105240_1000344920 148
62 3300009093 Ga0105240_10006516 Ga0105240_100065164 148
63 3300009093 Ga0105240_10008725 Ga0105240_100087258 148
64 3300009093 Ga0105240_10020350 Ga0105240_100203502 148
65 3300009093 Ga0105240_10020350 Ga0105240_100203503 148
66 3300009093 Ga0105240_10023755 Ga0105240_100237554 148
67 3300009093 Ga0105240_10047245 Ga0105240_100472455 148
68 3300009174 Ga0105241_10006712 Ga0105241_100067124 148
69 3300009174 Ga0105241_10717676 Ga0105241_107176762 148
70 3300009545 Ga0105237_10024435 Ga0105237_100244354 148
71 3300009545 Ga0105237_10024435 Ga0105237_100244355 148
72 3300009545 Ga0105237_10738386 Ga0105237_107383862 148
73 3300009545 Ga0105237_12235245 Ga0105237_122352451 148
74 3300009551 Ga0105238_10103500 Ga0105238_101035002 148
75 3300009551 Ga0105238_10105729 Ga0105238_101057292 148
76 3300010375 Ga0105239_10056103 Ga0105239_100561032 148
77 3300010375 Ga0105239_10056103 Ga0105239_100561033 148
78 3300010375 Ga0105239_10141352 Ga0105239_101413522 148
79 3300010375 Ga0105239_10184529 Ga0105239_101845293 148
80 3300010375 Ga0105239_11944263 Ga0105239_119442631 148
81 3300011119 Ga0105246_10225897 Ga0105246_102258972 148
82 3300013100 Ga0157373_10161062 Ga0157373_101610623 148
83 3300013104 Ga0157370_10001756 Ga0157370_1000175614 148
84 3300013104 Ga0157370_10803833 Ga0157370_108038332 148
85 3300013105 Ga0157369_10016069 Ga0157369_100160694 148
86 3300013105 Ga0157369_10067775 Ga0157369_100677752 148
87 3300013296 Ga0157374_10000025 Ga0157374_1000002528 148
88 3300013306 Ga0163162_10007556 Ga0163162_100075567 148
89 3300013307 Ga0157372_10002934 Ga0157372_1000293411 148
90 3300013307 Ga0157372_10079465 Ga0157372_100794654 148
91 3300013307 Ga0157372_10211719 Ga0157372_102117192 148
92 3300013307 Ga0157372_10661755 Ga0157372_106617553 148
93 3300013308 Ga0157375_10012214 Ga0157375_100122146 148
94 3300014325 Ga0163163_10026569 Ga0163163_100265692 148
95 3300014745 Ga0157377_11471671 Ga0157377_114716711 148
96 3300014968 Ga0157379_10085764 Ga0157379_100857642 148
97 3300014969 Ga0157376_10003131 Ga0157376_100031314 148
98 3300014969 Ga0157376_10004871 Ga0157376_100048714 148
99 3300017792 Ga0163161_10026974 Ga0163161_100269745 148
100 3300020069 Ga0197907_10267666 Ga0197907_102676662 148
101 3300020070 Ga0206356_10425736 Ga0206356_104257362 148
102 3300020078 Ga0206352_10351310 Ga0206352_103513101 148
103 3300020078 Ga0206352_11032421 Ga0206352_110324212 148
104 3300020081 Ga0206354_10466767 Ga0206354_104667671 148
105 3300020082 Ga0206353_11527644 Ga0206353_115276442 148
106 3300022467 Ga0224712_10091696 Ga0224712_100916961 148
107 3300025904 Ga0207647_10005447 Ga0207647_100054474 148
108 3300025904 Ga0207647_10430805 Ga0207647_104308051 148
109 3300025911 Ga0207654_10015819 Ga0207654_100158192 148
110 3300025911 Ga0207654_10274496 Ga0207654_102744962 148
111 3300025911 Ga0207654_10436378 Ga0207654_104363782 148
112 3300025913 Ga0207695_10000282 Ga0207695_10000282100 148
113 3300025913 Ga0207695_10001519 Ga0207695_100015196 148
114 3300025913 Ga0207695_10003026 Ga0207695_100030264 148
115 3300025913 Ga0207695_10022792 Ga0207695_100227926 148
116 3300025913 Ga0207695_10073698 Ga0207695_100736985 148
117 3300025913 Ga0207695_10089115 Ga0207695_100891152 148
118 3300025913 Ga0207695_10089115 Ga0207695_100891153 148
119 3300025914 Ga0207671_10005526 Ga0207671_100055264 148
120 3300025914 Ga0207671_10055812 Ga0207671_100558123 148
121 3300025914 Ga0207671_10089966 Ga0207671_100899662 148
122 3300025914 Ga0207671_10089966 Ga0207671_100899663 148
123 3300025914 Ga0207671_10375475 Ga0207671_103754752 148
124 3300025924 Ga0207694_10151096 Ga0207694_101510962 148
125 3300025924 Ga0207694_10660696 Ga0207694_106606962 148
126 3300025924 Ga0207694_10798822 Ga0207694_107988221 148
127 3300025938 Ga0207704_10110082 Ga0207704_101100822 148
128 3300025942 Ga0207689_10250481 Ga0207689_102504812 148
129 3300025942 Ga0207689_10645467 Ga0207689_106454671 148
130 3300025944 Ga0207661_10011006 Ga0207661_100110064 148
131 3300025949 Ga0207667_10000403 Ga0207667_1000040352 148
132 3300025949 Ga0207667_10001258 Ga0207667_1000125823 148
133 3300025949 Ga0207667_10099761 Ga0207667_100997612 148
134 3300025981 Ga0207640_10100670 Ga0207640_101006703 148
135 3300025981 Ga0207640_10261105 Ga0207640_102611052 148
136 3300026023 Ga0207677_10230105 Ga0207677_102301052 148
137 3300026041 Ga0207639_10009849 Ga0207639_100098495 148
138 3300026041 Ga0207639_10339839 Ga0207639_103398392 148
139 3300026078 Ga0207702_10135370 Ga0207702_101353701 148
140 3300026078 Ga0207702_10566994 Ga0207702_105669942 148
141 3300026078 Ga0207702_11081284 Ga0207702_110812842 148
142 3300026116 Ga0207674_10014629 Ga0207674_100146296 148
143 3300026142 Ga0207698_10050815 Ga0207698_100508152 148
144 3300026142 Ga0207698_10100632 Ga0207698_101006322 148
145 3300026142 Ga0207698_11239637 Ga0207698_112396372 148
146 3300026142 Ga0207698_11883163 Ga0207698_118831631 148
147 3300028381 Ga0268264_10000015 Ga0268264_10000015176 148
148 3300028381 Ga0268264_10000019 Ga0268264_10000019274 148
149 3300028381 Ga0268264_10080252 Ga0268264_100802524 148
150 3300028381 Ga0268264_10347086 Ga0268264_103470861 148
151 3300028786 Ga0307517_10208584 Ga0307517_102085842 148
152 3300030521 Ga0307511_10000024 Ga0307511_1000002472 148
153 3300031730 Ga0307516_10005057 Ga0307516_100050572 148
154 3300033180 Ga0307510_10003234 Ga0307510_100032344 148
155 3300035692 Ga0373935_0054675 Ga0373935_0054675_1843_2298 148
156 3300041512 Ga0451853_3721546 Ga0451853_3721546_47_499 148
157 3300044656 Ga0466969_0188480 Ga0466969_0188480_458_913 148
158 3300044658 Ga0466972_0002109 Ga0466972_0002109_7344_7802 148
159 3300044658 Ga0466972_0054687 Ga0466972_0054687_494_955 148
160 3300044693 Ga0466961_0029051 Ga0466961_0029051_2538_2993 148
161 3300044719 Ga0466971_0008879 Ga0466971_0008879_2824_3279 148
162 3300044735 Ga0466968_0081923 Ga0466968_0081923_279_737 148
163 3300044765 Ga0466970_0088527 Ga0466970_0088527_1065_1520 148
164 3300044842 Ga0466957_0054302 Ga0466957_0054302_784_1239 148
165 3300045049 Ga0466959_0069905 Ga0466959_0069905_526_981 148
166 3300046460 Ga0495638_0031003 Ga0495638_0031003_1733_2188 148
167 3300046524 Ga0495648_0000493 Ga0495648_0000493_30239_30697 148
168 3300046524 Ga0495648_0124364 Ga0495648_0124364_613_1068 148
169 3300046648 Ga0495611_0000538 Ga0495611_0000538_5455_5910 148
170 3300046694 Ga0495649_0208059 Ga0495649_0208059_549_1004 148
171 3300047472 Ga0495686_0000128 Ga0495686_0000128_93179_93634 148
172 3300049581 Ga0501047_0343510 Ga0501047_0343510_817_1275 148
173 3300049583 Ga0501067_0172863 Ga0501067_0172863_227_685 148
174 3300049744 Ga0501083_0457260 Ga0501083_0457260_308_760 148
175 3300049822 Ga0501035_0792111 Ga0501035_0792111_153_611 148
176 3300053087 Ga0500643_058838 Ga0500643_058838_328_786 148
177 3300053090 Ga0500646_0011746 Ga0500646_0011746_962_1420 148
178 3300053092 Ga0500583_0003555 Ga0500583_0003555_1734_2192 148
179 3300053139 Ga0500568_0013673 Ga0500568_0013673_1589_2047 148
180 3300053146 Ga0500588_0262191 Ga0500588_0262191_96_551 148
181 3300053148 Ga0500590_225293 Ga0500590_225293_155_688 148
182 3300053156 Ga0500622_0004431 Ga0500622_0004431_4475_4933 148
183 3300053178 Ga0500637_0096099 Ga0500637_0096099_696_1229 148
184 3300055283 Ga0500661_065864 Ga0500661_065864_37_492 148
185 3300005355 Ga0070671_100001243 Ga0070671_10000124311 149
186 3300005718 Ga0068866_10360545 Ga0068866_103605452 149
187 3300005842 Ga0068858_100257479 Ga0068858_1002574792 149
188 3300006163 Ga0070715_10510252 Ga0070715_105102521 149
189 3300006195 Ga0075366_10025407 Ga0075366_100254073 149
190 3300006237 Ga0097621_100082229 Ga0097621_1000822293 149
191 3300006358 Ga0068871_100001412 Ga0068871_10000141212 149
192 3300006881 Ga0068865_100902492 Ga0068865_1009024921 149
193 3300009174 Ga0105241_10098371 Ga0105241_100983712 149
194 3300009177 Ga0105248_10054669 Ga0105248_100546695 149
195 3300009545 Ga0105237_10035825 Ga0105237_100358254 149
196 3300009553 Ga0105249_10387830 Ga0105249_103878302 149
197 3300013296 Ga0157374_10439136 Ga0157374_104391362 149
198 3300013297 Ga0157378_10025976 Ga0157378_100259762 149
199 3300013297 Ga0157378_12146772 Ga0157378_121467721 149
200 3300013306 Ga0163162_10000994 Ga0163162_100009944 149
201 3300013308 Ga0157375_10043641 Ga0157375_100436413 149
202 3300014968 Ga0157379_10040496 Ga0157379_100404964 149
203 3300014969 Ga0157376_10000404 Ga0157376_100004044 149
204 3300017792 Ga0163161_10025530 Ga0163161_100255302 149
205 3300025899 Ga0207642_10466611 Ga0207642_104666112 149
206 3300025914 Ga0207671_10020846 Ga0207671_100208463 149
207 3300025931 Ga0207644_10010191 Ga0207644_100101915 149
208 3300025938 Ga0207704_10305052 Ga0207704_103050522 149
209 3300025941 Ga0207711_10042641 Ga0207711_100426412 149
210 3300028379 Ga0268266_10773435 Ga0268266_107734351 149
211 3300041997 Ga0439431_0000821 Ga0439431_0000821_4163_4612 149
212 3300042015 Ga0439462_0147346 Ga0439462_0147346_183_632 149
213 3300048904 Ga0496101_0315934 Ga0496101_0315934_588_1046 149
214 3300048917 Ga0496114_0079426 Ga0496114_0079426_1058_1516 149
215 3300050493 nmdc:mga0k408_155477_c1 nmdc:mga0k408_155477_c1_873_1346 149
216 3300003322 rootL2_10040050 rootL2_100400503 150
217 3300009093 Ga0105240_10007181 Ga0105240_100071813 150
218 3300047320 Ga0495672_0001585 Ga0495672_0001585_3733_4188 150
219 3300001979 JGI24740J21852_10001467 JGI24740J21852_100014677 151
220 3300001989 JGI24739J22299_10039716 JGI24739J22299_100397162 151
221 3300002738 JGI25154J39366_1000020 JGI25154J39366_100002088 151
222 3300002741 JGI25157J39369_1003680 JGI25157J39369_10036802 151
223 3300002987 JGI25159J45721_1039445 JGI25159J45721_10394452 151
224 3300003215 JGI25153J46596_10000268 JGI25153J46596_1000026814 151
225 3300003215 JGI25153J46596_10014001 JGI25153J46596_100140012 151
226 3300003316 rootH1_10078318 rootH1_100783182 151
227 3300003320 rootH2_10009901 rootH2_100099012 151
228 3300003320 rootH2_10081373 rootH2_100813732 151
229 3300003320 rootH2_10092437 rootH2_100924372 151
230 3300003322 rootL2_10045218 rootL2_100452183 151
231 3300003322 rootL2_10049962 rootL2_100499626 151
232 3300003322 rootL2_10179769 rootL2_101797693 151
233 3300003322 rootL2_10190388 rootL2_101903882 151
234 3300003323 rootH1_10001197 rootH1_100011972 151
235 3300003323 rootH1_10075127 rootH1_100751273 151
236 3300003323 rootH1_10096158 rootH1_100961582 151
237 3300003323 rootH1_10164288 rootH1_101642883 151
238 3300003354 JGI25160J50197_1003243 JGI25160J50197_10032434 151
239 3300003354 JGI25160J50197_1004459 JGI25160J50197_10044595 151
240 3300003762 Ga0055542_1021878 Ga0055542_10218782 151
241 3300003771 Ga0055526_1027493 Ga0055526_10274932 151
242 3300003790 Ga0055528_1002450 Ga0055528_10024504 151
243 3300003791 Ga0055530_10000584 Ga0055530_1000058423 151
244 3300003794 Ga0055531_10000819 Ga0055531_1000081915 151
245 3300003794 Ga0055531_10025662 Ga0055531_100256622 151
246 3300004625 Ga0055543_1010741 Ga0055543_10107412 151
247 3300005262 Ga0065165_1000914 Ga0065165_10009149 151
248 3300005262 Ga0065165_1015985 Ga0065165_10159854 151
249 3300005289 Ga0065704_10071111 Ga0065704_100711115 151
250 3300006195 Ga0075366_10163402 Ga0075366_101634022 151
251 3300010375 Ga0105239_10346807 Ga0105239_103468073 151
252 3300013104 Ga0157370_10182607 Ga0157370_101826072 151
253 3300015265 Ga0182005_1000116 Ga0182005_10001166 151
254 3300020070 Ga0206356_10206394 Ga0206356_102063942 151
255 3300025208 Ga0209436_105907 Ga0209436_1059072 151
256 3300025242 Ga0209258_100075 Ga0209258_10007572 151
257 3300025246 Ga0209646_1000005 Ga0209646_1000005473 151
258 3300025246 Ga0209646_1013872 Ga0209646_10138722 151
259 3300025250 Ga0209026_1000149 Ga0209026_100014934 151
260 3300025254 Ga0209148_1000085 Ga0209148_1000085157 151
261 3300025273 Ga0209673_1000242 Ga0209673_100024268 151
262 3300025284 Ga0209130_1001019 Ga0209130_100101911 151
263 3300025291 Ga0209675_1067749 Ga0209675_10677492 151
264 3300025295 Ga0209564_1012258 Ga0209564_10122582 151
265 3300025297 Ga0209758_1000795 Ga0209758_100079524 151
266 3300025297 Ga0209758_1008721 Ga0209758_10087211 151
267 3300025297 Ga0209758_1010337 Ga0209758_10103373 151
268 3300025297 Ga0209758_1027895 Ga0209758_10278952 151
269 3300025298 Ga0209050_1000298 Ga0209050_100029824 151
270 3300025302 Ga0207426_1000057 Ga0207426_100005737 151
271 3300025302 Ga0207426_1000262 Ga0207426_100026256 151
272 3300025302 Ga0207426_1001013 Ga0207426_100101321 151
273 3300025302 Ga0207426_1003809 Ga0207426_10038096 151
274 3300025303 Ga0209051_1061131 Ga0209051_10611312 151
275 3300025304 Ga0209257_1000004 Ga0209257_10000041073 151
276 3300025304 Ga0209257_1004947 Ga0209257_10049479 151
277 3300026035 Ga0207703_10703973 Ga0207703_107039732 151
278 3300026116 Ga0207674_10940092 Ga0207674_109400921 151
279 3300032004 Ga0307414_10031478 Ga0307414_100314784 151
280 3300041404 Ga0439436_0026048 Ga0439436_0026048_709_1230 151
281 3300041459 Ga0451800_0852966 Ga0451800_0852966_182_637 151
282 3300041491 Ga0451833_0549414 Ga0451833_0549414_166_621 151
283 3300041997 Ga0439431_0036646 Ga0439431_0036646_447_902 151
284 3300042007 Ga0439449_0076735 Ga0439449_0076735_558_1079 151
285 3300044656 Ga0466969_0121033 Ga0466969_0121033_152_607 151
286 3300044658 Ga0466972_0085593 Ga0466972_0085593_201_656 151
287 3300044683 Ga0466965_0027837 Ga0466965_0027837_603_1058 151
288 3300044842 Ga0466957_0615867 Ga0466957_0615867_235_690 151
289 3300045049 Ga0466959_0048418 Ga0466959_0048418_1976_2431 151
290 3300046453 Ga0495627_003149 Ga0495627_003149_4179_4634 151
291 3300046558 Ga0495633_0000022 Ga0495633_0000022_88003_88458 151
292 3300046616 Ga0495668_0001251 Ga0495668_0001251_10615_11073 151
293 3300046660 Ga0495625_0302097 Ga0495625_0302097_89_544 151
294 3300048924 Ga0496121_0000010 Ga0496121_0000010_172490_172945 151
295 3300048928 Ga0496125_0475052 Ga0496125_0475052_54_509 151
296 3300048929 Ga0496126_0043669 Ga0496126_0043669_2960_3415 151
297 3300049535 Ga0501319_004597 Ga0501319_004597_223_678 151
298 3300049571 Ga0501034_0023444 Ga0501034_0023444_3402_3857 151
299 3300049571 Ga0501034_0400701 Ga0501034_0400701_738_1193 151
300 3300049681 Ga0501251_023735 Ga0501251_023735_53_508 151
301 3300049758 Ga0501241_002778 Ga0501241_002778_692_1147 151
302 3300050493 nmdc:mga0k408_34987_c1 nmdc:mga0k408_34987_c1_34_489 151
303 3300053090 Ga0500646_0005181 Ga0500646_0005181_1121_1576 151
304 3300053092 Ga0500583_0023890 Ga0500583_0023890_667_1122 151
305 3300053093 Ga0500651_0050624 Ga0500651_0050624_1449_1904 151
306 3300053131 Ga0500652_001355 Ga0500652_001355_6203_6658 151
307 3300053134 Ga0500658_0126041 Ga0500658_0126041_260_715 151
308 3300053139 Ga0500568_0038273 Ga0500568_0038273_256_711 151
309 3300053142 Ga0500577_0003027 Ga0500577_0003027_3679_4134 151
310 3300053148 Ga0500590_068942 Ga0500590_068942_84_539 151
311 3300053151 Ga0500604_0013370 Ga0500604_0013370_1075_1533 151
312 3300053153 Ga0500616_0010035 Ga0500616_0010035_3753_4208 151
313 3300053156 Ga0500622_0000497 Ga0500622_0000497_17022_17477 151
314 3300053161 Ga0500634_0072686 Ga0500634_0072686_1183_1638 151
315 3300053177 Ga0500636_0071095 Ga0500636_0071095_151_606 151
316 3300055283 Ga0500661_002867 Ga0500661_002867_753_1208 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11412

DsbD_N

Thiol:disulfide interchange protein DsbD, N-terminal

44

175

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c29-assembly3.cif.gz_C crystal structure of the n-terminal periplasmic domain of scsb from proteus mirabilis 0.6785 25 149
1vrs-assembly3.cif.gz_C crystal structure of the disulfide-linked complex between the n-terminal and c-terminal domain of the electron transfer catalyst dsbd 0.6725 27 143
2k9f-assembly1.cif.gz_B structural features of the complex between the dsbd n-terminal and the pilb n-terminal domains from neisseria meningitidis 0.6653 21 145
5cn1-assembly5.cif.gz_C crystal structure of yeast gga1_gae domain-p21 0.656 23 148
6dnv-assembly2.cif.gz_B crystal structure of neisseria meningitidis dsbd n-terminal domain in the reduced form 0.6548 27 150
ID Description Score Start End Superfamily
af_Q5A6M6_713_823_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.6987 21 148 2.60.40.1230
af_I1NAT9_152_253_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6963 121 145 3.40.50.2000
af_Q9C615_34_137_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6757 121 145 2.60.40.10
af_Q86KI1_749_872_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.6733 25 146 2.60.40.1230
af_A4HT27_716_845_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.6645 24 146 2.60.40.1230
ID Description Score Start End GO Terms
AF-A0A1N7KL46-F1-model_v4 Thiol:disulfide interchange protein DsbD 0.9891 19 148 GO:0015035
GO:0045454
AF-A0A4P5T1Q3-F1-model_v4 Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein 0.9874 24 150
AF-A0A1Q3TG54-F1-model_v4 Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein 0.9812 21 148
AF-A0A3B7MKD2-F1-model_v4 Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein 0.9654 12 151 GO:0015035
GO:0045454
AF-A0A497D3M2-F1-model_v4 Disulfide bond formation protein DsbD 0.9599 20 151 GO:0015035
GO:0016020
GO:0017004
GO:0045454

Feature Viewer

pLDDT pTM Quality
87.78 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map