F403591

General Info

Members Datasets Scaffolds Average Seq Length
316 217 632 288

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10000046|Ga0081455_100000462
Length 300
Sequence MQIGIHYANFTLPGGAEAIAATLGETARVADDGGISMITVMDHYFQMPQFAYDWQDPSRVADAHDPMLEGYATLGFLAAHTKKVQLGLLVTGVTYRHPGLLAKIVATLDILSGGRTNLGLGAAWYEREHKGLGVPYPPVSERFERLEETLQICQQMWSDDDGPYEGKHYQLAETICIPKPISSPRPRIMVGGSGERKTLRLVAKYADACNLFGSTPQEITHKLHVLADHCAAAGRDPDTISKTMVMNRDPLDGTDGFLEDMEAFAAAGIELITLTLKTQDPVGYTHRLVEEVVPRLSAVG

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
209 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
215 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
216 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
217 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0.95
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.48
Nodule 0
Rhizoplane 10.76
Rhizosphere 80.06
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10000046 3300005937 Bacteria 127053
2 Ga0055540_1001983 3300003792 Bacteria 11447
3 Ga0070670_100057643 3300005331 Bacteria 3334
4 Ga0070666_10120684 3300005335 Bacteria 1818
5 Ga0068868_100048883 3300005338 Bacteria 3319
6 Ga0070691_10027514 3300005341 Bacteria 2653
7 Ga0070691_10194081 3300005341 Bacteria 1064
8 Ga0070668_100003982 3300005347 Bacteria 10935
9 Ga0070668_100288877 3300005347 Bacteria 1372
10 Ga0070669_100182901 3300005353 Bacteria 1641
11 Ga0070671_100129208 3300005355 Bacteria 2127
12 Ga0070671_100289146 3300005355 Bacteria 1395
13 Ga0070674_100029788 3300005356 Bacteria 3601
14 Ga0070659_100179155 3300005366 Bacteria 1739
15 Ga0070667_100006558 3300005367 Bacteria 9674
16 Ga0070667_100012043 3300005367 Bacteria 7159
17 Ga0070703_10116360 3300005406 Bacteria 964
18 Ga0070709_10076984 3300005434 Bacteria 2167
19 Ga0070714_100142271 3300005435 Bacteria 2154
20 Ga0070714_100274701 3300005435 Bacteria 1564
21 Ga0070713_100015682 3300005436 Bacteria 5675
22 Ga0070710_10000957 3300005437 Bacteria 13688
23 Ga0070701_10000837 3300005438 Bacteria 11027
24 Ga0070711_100045089 3300005439 Bacteria 2996
25 Ga0070705_100314369 3300005440 Bacteria 1128
26 Ga0070700_100000375 3300005441 Bacteria 22955
27 Ga0070694_100005317 3300005444 Bacteria 7785
28 Ga0070663_100007908 3300005455 Bacteria 6510
29 Ga0070663_100178753 3300005455 Bacteria 1644
30 Ga0070678_100000144 3300005456 Bacteria 29367
31 Ga0070678_100063273 3300005456 Bacteria 2736
32 Ga0070678_100202344 3300005456 Bacteria 1640
33 Ga0070662_100037751 3300005457 Bacteria 3426
34 Ga0068867_100005927 3300005459 Bacteria 8668
35 Ga0070685_10036632 3300005466 Bacteria 2774
36 Ga0070679_100229615 3300005530 Bacteria 1815
37 Ga0068853_100089651 3300005539 Bacteria 2701
38 Ga0070695_100003238 3300005545 Bacteria 9501
39 Ga0070695_100379782 3300005545 Bacteria 1066
40 Ga0070696_100000635 3300005546 Bacteria 22384
41 Ga0070696_100284975 3300005546 Bacteria 1261
42 Ga0070696_100467586 3300005546 Bacteria 998
43 Ga0070693_100038853 3300005547 Bacteria 2663
44 Ga0070665_100001364 3300005548 Bacteria 28758
45 Ga0068855_100067660 3300005563 Bacteria 4160
46 Ga0068855_100554466 3300005563 Bacteria 1244
47 Ga0068855_100779861 3300005563 Unclassified 1017
48 Ga0070664_100541564 3300005564 Bacteria 1076
49 Ga0068857_100054786 3300005577 Bacteria 3539
50 Ga0068854_100001531 3300005578 Bacteria 14027
51 Ga0068854_100422012 3300005578 Bacteria 1108
52 Ga0070702_100032335 3300005615 Bacteria 2870
53 Ga0070702_100333558 3300005615 Bacteria 1061
54 Ga0068859_100104388 3300005617 Bacteria 2893
55 Ga0068859_100676315 3300005617 Bacteria 1123
56 Ga0068864_100235135 3300005618 Bacteria 1696
57 Ga0068866_10004861 3300005718 Bacteria 5517
58 Ga0068861_100001025 3300005719 Bacteria 17102
59 Ga0068863_100258692 3300005841 Bacteria 1682
60 Ga0068858_100105430 3300005842 Bacteria 2630
61 Ga0068858_100267244 3300005842 Bacteria 1627
62 Ga0068860_100000761 3300005843 Bacteria 36314
63 Ga0068860_100009435 3300005843 Bacteria 9695
64 Ga0075365_10046566 3300006038 Bacteria 2849
65 Ga0075365_10188398 3300006038 Bacteria 1443
66 Ga0075364_10074421 3300006051 Bacteria 2240
67 Ga0070715_10007395 3300006163 Bacteria 3780
68 Ga0070715_10081372 3300006163 Bacteria 1470
69 Ga0070716_100010353 3300006173 Bacteria 4672
70 Ga0070712_100000814 3300006175 Bacteria 18534
71 Ga0070712_100033957 3300006175 Bacteria 3455
72 Ga0097621_100082993 3300006237 Bacteria 2669
73 Ga0097621_100117899 3300006237 Bacteria 2249
74 Ga0068871_100152459 3300006358 Bacteria 1972
75 Ga0097620_100104391 3300006931 Bacteria 2893
76 Ga0097620_100676271 3300006931 Bacteria 1123
77 Ga0105245_10004643 3300009098 Bacteria 12135
78 Ga0105247_10004906 3300009101 Bacteria 8508
79 Ga0105241_10006276 3300009174 Bacteria 8763
80 Ga0105241_10123459 3300009174 Bacteria 2088
81 Ga0105242_10002380 3300009176 Bacteria 14827
82 Ga0105248_10012735 3300009177 Bacteria 9277
83 Ga0105248_10202155 3300009177 Bacteria 2238
84 Ga0105237_10240169 3300009545 Bacteria 1813
85 Ga0105249_10004619 3300009553 Bacteria 11895
86 Ga0105239_10021935 3300010375 Bacteria 7039
87 Ga0157369_10094203 3300013105 Bacteria 3196
88 Ga0157374_10015972 3300013296 Bacteria 6594
89 Ga0163162_10130196 3300013306 Bacteria 2625
90 Ga0157372_10004674 3300013307 Bacteria 14540
91 Ga0157372_10483617 3300013307 Bacteria 1443
92 Ga0157375_10006261 3300013308 Bacteria 10367
93 Ga0163163_10137378 3300014325 Bacteria 2486
94 Ga0157380_10000214 3300014326 Bacteria 34343
95 Ga0157379_10047421 3300014968 Bacteria 3833
96 Ga0206356_11804448 3300020070 Bacteria 2113
97 Ga0206353_10595124 3300020082 Bacteria 1063
98 Ga0213876_10002741 3300021384 Bacteria 10262
99 Ga0213876_10017858 3300021384 Bacteria 3743
100 Ga0224712_10046647 3300022467 Bacteria 1664
101 Ga0209051_1000401 3300025303 Bacteria 60172
102 Ga0207692_10064444 3300025898 Bacteria 1908
103 Ga0207692_10067971 3300025898 Bacteria 1867
104 Ga0207642_10013574 3300025899 Bacteria 2976
105 Ga0207688_10003526 3300025901 Bacteria 8542
106 Ga0207685_10001882 3300025905 Bacteria 4616
107 Ga0207699_10032525 3300025906 Bacteria 2939
108 Ga0207699_10051635 3300025906 Bacteria 2430
109 Ga0207699_10265761 3300025906 Bacteria 1187
110 Ga0207699_10280581 3300025906 Bacteria 1157
111 Ga0207693_10000498 3300025915 Bacteria 35481
112 Ga0207693_10006479 3300025915 Bacteria 9701
113 Ga0207663_10014505 3300025916 Bacteria 4316
114 Ga0207663_10040867 3300025916 Bacteria 2822
115 Ga0207660_10102840 3300025917 Bacteria 2136
116 Ga0207681_10072841 3300025923 Bacteria 2401
117 Ga0207687_10021296 3300025927 Bacteria 4307
118 Ga0207700_10020549 3300025928 Bacteria 4487
119 Ga0207664_10025416 3300025929 Bacteria 4461
120 Ga0207664_10536502 3300025929 Bacteria 1049
121 Ga0207644_10028129 3300025931 Bacteria 3888
122 Ga0207644_10253722 3300025931 Bacteria 1404
123 Ga0207706_10009577 3300025933 Bacteria 8893
124 Ga0207686_10000867 3300025934 Bacteria 18316
125 Ga0207709_10002105 3300025935 Bacteria 12816
126 Ga0207670_10078649 3300025936 Bacteria 2300
127 Ga0207669_10000304 3300025937 Bacteria 22560
128 Ga0207669_10256823 3300025937 Bacteria 1305
129 Ga0207704_10000284 3300025938 Bacteria 24146
130 Ga0207665_10199624 3300025939 Bacteria 1457
131 Ga0207691_10049181 3300025940 Bacteria 3864
132 Ga0207691_10066645 3300025940 Bacteria 3257
133 Ga0207711_10025064 3300025941 Bacteria 5004
134 Ga0207667_10113795 3300025949 Bacteria 2789
135 Ga0207712_10008532 3300025961 Bacteria 6479
136 Ga0207712_10138094 3300025961 Bacteria 1867
137 Ga0207668_10004548 3300025972 Bacteria 8158
138 Ga0207658_10008085 3300025986 Bacteria 7164
139 Ga0207677_10002342 3300026023 Bacteria 9943
140 Ga0207703_10031216 3300026035 Bacteria 4212
141 Ga0207703_10239273 3300026035 Bacteria 1631
142 Ga0207639_10555249 3300026041 Bacteria 1055
143 Ga0207678_10020208 3300026067 Bacteria 5846
144 Ga0207708_10010774 3300026075 Bacteria 6795
145 Ga0207702_10360061 3300026078 Bacteria 1394
146 Ga0207641_10004533 3300026088 Bacteria 12013
147 Ga0207641_10228671 3300026088 Bacteria 1728
148 Ga0207648_10003140 3300026089 Bacteria 17432
149 Ga0207676_10055965 3300026095 Bacteria 3099
150 Ga0207676_10534872 3300026095 Bacteria 1118
151 Ga0207674_10071359 3300026116 Bacteria 3489
152 Ga0207683_10000505 3300026121 Bacteria 35999
153 Ga0268266_10033629 3300028379 Bacteria 4358
154 Ga0268266_10248889 3300028379 Bacteria 1643
155 Ga0268265_10005069 3300028380 Bacteria 9039
156 Ga0268264_10006925 3300028381 Bacteria 9512
157 Ga0268264_10023347 3300028381 Bacteria 5046
158 Ga0265327_10000367 3300031251 Bacteria 85619
159 Ga0265327_10004986 3300031251 Bacteria 11392
160 Ga0265327_10005959 3300031251 Bacteria 9934
161 Ga0265327_10048085 3300031251 Bacteria 2246
162 Ga0373959_0048852 3300034820 Bacteria 908
163 Ga0373934_0036095 3300035086 Bacteria 1946
164 Ga0373940_0015115 3300035088 Bacteria 1894
165 Ga0373923_0012823 3300035111 Bacteria 3110
166 Ga0373941_0005072 3300035115 Bacteria 3075
167 Ga0373927_0102338 3300035695 Bacteria 1863
168 Ga0400483_129156 3300039062 Bacteria 1215
169 Ga0436365_0815018 3300039437 Bacteria 21496
170 Ga0436365_1776852 3300039437 Bacteria 23405
171 Ga0436360_0356632 3300039438 Bacteria 982
172 Ga0436363_1061462 3300039450 Bacteria 1877
173 Ga0466969_0026778 3300044656 Bacteria 2956
174 Ga0466972_0160288 3300044658 Bacteria 1057
175 Ga0466966_0003232 3300044684 Bacteria 10740
176 Ga0466966_0010351 3300044684 Bacteria 6192
177 Ga0466961_0003187 3300044693 Bacteria 10214
178 Ga0466961_0008027 3300044693 Bacteria 6727
179 Ga0466961_0201172 3300044693 Bacteria 1232
180 Ga0466963_0041466 3300044694 Bacteria 3020
181 Ga0466963_0069087 3300044694 Bacteria 2374
182 Ga0466963_0069131 3300044694 Bacteria 2373
183 Ga0466963_0132996 3300044694 Bacteria 1719
184 Ga0466968_0000663 3300044735 Bacteria 11787
185 Ga0466970_0011705 3300044765 Bacteria 4475
186 Ga0466957_0000331 3300044842 Bacteria 23031
187 Ga0466957_0008691 3300044842 Bacteria 5784
188 Ga0466957_0324368 3300044842 Bacteria 1040
189 Ga0466959_0038534 3300045049 Bacteria 3532
190 Ga0466959_0072015 3300045049 Bacteria 2502
191 Ga0466959_0119990 3300045049 Bacteria 1870
192 Ga0466958_0005966 3300045836 Bacteria 6592
193 Ga0466958_0016635 3300045836 Bacteria 4238
194 Ga0466958_0032553 3300045836 Bacteria 3102
195 Ga0466967_0035121 3300045976 Bacteria 4263
196 Ga0466967_0062432 3300045976 Bacteria 3307
197 Ga0495592_0072319 3300046454 Bacteria 2509
198 Ga0495592_0124907 3300046454 Bacteria 1807
199 Ga0495603_0069518 3300046455 Bacteria 2071
200 Ga0495641_0018772 3300046461 Bacteria 3560
201 Ga0495641_0040496 3300046461 Bacteria 2166
202 Ga0495651_0021234 3300046462 Bacteria 5046
203 Ga0495653_0193217 3300046463 Bacteria 1387
204 Ga0495662_0036276 3300046476 Bacteria 2380
205 Ga0495664_0076539 3300046477 Bacteria 2003
206 Ga0495606_0079376 3300046507 Bacteria 2044
207 Ga0495608_0044489 3300046511 Bacteria 2963
208 Ga0495608_0160346 3300046511 Bacteria 1430
209 Ga0495628_0005642 3300046516 Bacteria 10954
210 Ga0495630_0034194 3300046517 Bacteria 3794
211 Ga0495648_0012214 3300046524 Bacteria 6419
212 Ga0495652_0135585 3300046529 Bacteria 1942
213 Ga0495652_0230693 3300046529 Bacteria 1385
214 Ga0495654_0038322 3300046530 Bacteria 2398
215 Ga0495668_0012039 3300046616 Bacteria 5149
216 Ga0495634_0085972 3300046642 Bacteria 2049
217 Ga0495611_0018209 3300046648 Bacteria 3010
218 Ga0495625_0127946 3300046660 Bacteria 1723
219 Ga0495635_0155504 3300046663 Bacteria 1556
220 Ga0495635_0279960 3300046663 Bacteria 1120
221 Ga0495657_0016394 3300046675 Bacteria 5399
222 Ga0495623_0235965 3300046679 Bacteria 1035
223 Ga0495624_0053166 3300046690 Bacteria 2557
224 Ga0495624_0100313 3300046690 Bacteria 1783
225 Ga0495600_0200294 3300046809 Bacteria 1282
226 Ga0495581_0019489 3300047315 Bacteria 3938
227 Ga0495581_0129467 3300047315 Bacteria 1470
228 Ga0495672_0000358 3300047320 Bacteria 58575
229 Ga0495672_0004499 3300047320 Bacteria 11391
230 Ga0495676_0088585 3300047321 Bacteria 2321
231 Ga0495680_0043166 3300047322 Bacteria 3572
232 Ga0495675_0065813 3300047444 Bacteria 2292
233 Ga0495673_0000928 3300047469 Bacteria 26577
234 Ga0495684_0122501 3300047471 Bacteria 1957
235 Ga0495684_0137543 3300047471 Bacteria 1833
236 Ga0496100_0075507 3300048903 Bacteria 2260
237 Ga0496100_0096524 3300048903 Bacteria 2028
238 Ga0496101_0001092 3300048904 Bacteria 16101
239 Ga0496101_0006914 3300048904 Bacteria 7324
240 Ga0496101_0071123 3300048904 Bacteria 2550
241 Ga0496101_0111755 3300048904 Bacteria 2057
242 Ga0496101_0269880 3300048904 Bacteria 1328
243 Ga0496102_0000041 3300048905 Bacteria 196634
244 Ga0496102_0014719 3300048905 Bacteria 6800
245 Ga0496102_0105824 3300048905 Bacteria 2617
246 Ga0496102_0241276 3300048905 Bacteria 1704
247 Ga0496103_0000150 3300048906 Bacteria 72561
248 Ga0496103_0001144 3300048906 Bacteria 18335
249 Ga0496103_0080635 3300048906 Bacteria 2046
250 Ga0496104_0009716 3300048907 Bacteria 8576
251 Ga0496105_0019676 3300048908 Bacteria 5446
252 Ga0496105_0040714 3300048908 Bacteria 3831
253 Ga0496106_0002024 3300048909 Bacteria 15255
254 Ga0496106_0022547 3300048909 Bacteria 4680
255 Ga0496107_0000127 3300048910 Bacteria 37071
256 Ga0496107_0328798 3300048910 Bacteria 1137
257 Ga0496108_0014490 3300048911 Bacteria 6437
258 Ga0496108_0302390 3300048911 Bacteria 1393
259 Ga0496109_0272005 3300048912 Bacteria 1596
260 Ga0496110_0136572 3300048913 Bacteria 2216
261 Ga0496110_0219114 3300048913 Bacteria 1730
262 Ga0496111_0267901 3300048914 Bacteria 1267
263 Ga0496112_0054155 3300048915 Bacteria 3941
264 Ga0496113_0120828 3300048916 Bacteria 2048
265 Ga0496114_0000176 3300048917 Bacteria 45206
266 Ga0496114_0020068 3300048917 Bacteria 5421
267 Ga0496114_0254605 3300048917 Bacteria 1545
268 Ga0496115_0018829 3300048918 Bacteria 5308
269 Ga0496115_0042809 3300048918 Bacteria 3609
270 Ga0496116_0000098 3300048919 Bacteria 196497
271 Ga0496117_0000096 3300048920 Bacteria 196788
272 Ga0496117_0051067 3300048920 Bacteria 2927
273 Ga0496118_0000067 3300048921 Bacteria 207219
274 Ga0496118_0000073 3300048921 Bacteria 196712
275 Ga0496120_0116362 3300048923 Bacteria 1388
276 Ga0496121_0001389 3300048924 Bacteria 40961
277 Ga0496126_0000762 3300048929 Bacteria 58311
278 Ga0496126_0011096 3300048929 Bacteria 9361
279 Ga0501031_0030449 3300049568 Bacteria 3520
280 Ga0501032_0000516 3300049569 Bacteria 31374
281 Ga0501033_0006745 3300049570 Bacteria 8969
282 Ga0501034_0000731 3300049571 Bacteria 49750
283 Ga0501034_0003109 3300049571 Bacteria 19140
284 Ga0501036_0016384 3300049572 Bacteria 6192
285 Ga0501036_0068543 3300049572 Bacteria 3002
286 Ga0501037_0000165 3300049573 Bacteria 62545
287 Ga0501038_0000292 3300049574 Bacteria 42699
288 Ga0501039_0000485 3300049575 Bacteria 28766
289 Ga0501043_0002674 3300049579 Bacteria 14951
290 Ga0501043_0028645 3300049579 Bacteria 4372
291 Ga0501046_0043790 3300049580 Bacteria 3562
292 Ga0501047_0017692 3300049581 Bacteria 6829
293 Ga0501070_0000573 3300049586 Bacteria 33479
294 Ga0501070_0005509 3300049586 Bacteria 10801
295 Ga0501071_0052446 3300049587 Bacteria 2941
296 Ga0501072_0000411 3300049588 Bacteria 30561
297 Ga0501075_0225206 3300049591 Bacteria 1430
298 Ga0501044_0016034 3300049823 Bacteria 8059
299 Ga0501044_0101479 3300049823 Bacteria 2895
300 nmdc:mga0yw44_158928_c1 3300050492 Bacteria 1478
301 nmdc:mga08x19_16019_c1 3300050514 Bacteria 4567
302 Ga0495619_0046111 3300053085 Bacteria 2865
303 Ga0495619_0063542 3300053085 Bacteria 2459
304 Ga0495619_0137049 3300053085 Bacteria 1684
305 Ga0500643_005366 3300053087 Bacteria 5540
306 Ga0500572_044926 3300053111 Bacteria 1297
307 Ga0500568_0089586 3300053139 Bacteria 1161
308 Ga0500616_0000110 3300053153 Bacteria 152339
309 Ga0500616_0003234 3300053153 Bacteria 12622
310 Ga0501084_0021617 3300054114 Bacteria 5364
311 Ga0466962_0005066 3300061719 Bacteria 6337
312 Ga0466962_0059989 3300061719 Bacteria 1816
313 Ga0530510_0099180 3300061734 Bacteria 2130
314 2812363278 2811994880 Bacteria 4147780
315 2929218340 2929212328 Bacteria 7708288
316 2995470326 2995463766 Bacteria 8577691
317 Ga0081455_10000046
318 Ga0055540_1001983
319 Ga0070670_100057643
320 Ga0070666_10120684
321 Ga0068868_100048883
322 Ga0070691_10027514
323 Ga0070691_10194081
324 Ga0070668_100003982
325 Ga0070668_100288877
326 Ga0070669_100182901
327 Ga0070671_100129208
328 Ga0070671_100289146
329 Ga0070674_100029788
330 Ga0070659_100179155
331 Ga0070667_100006558
332 Ga0070667_100012043
333 Ga0070703_10116360
334 Ga0070709_10076984
335 Ga0070714_100142271
336 Ga0070714_100274701
337 Ga0070713_100015682
338 Ga0070710_10000957
339 Ga0070701_10000837
340 Ga0070711_100045089
341 Ga0070705_100314369
342 Ga0070700_100000375
343 Ga0070694_100005317
344 Ga0070663_100007908
345 Ga0070663_100178753
346 Ga0070678_100000144
347 Ga0070678_100063273
348 Ga0070678_100202344
349 Ga0070662_100037751
350 Ga0068867_100005927
351 Ga0070685_10036632
352 Ga0070679_100229615
353 Ga0068853_100089651
354 Ga0070695_100003238
355 Ga0070695_100379782
356 Ga0070696_100000635
357 Ga0070696_100284975
358 Ga0070696_100467586
359 Ga0070693_100038853
360 Ga0070665_100001364
361 Ga0068855_100067660
362 Ga0068855_100554466
363 Ga0068855_100779861
364 Ga0070664_100541564
365 Ga0068857_100054786
366 Ga0068854_100001531
367 Ga0068854_100422012
368 Ga0070702_100032335
369 Ga0070702_100333558
370 Ga0068859_100104388
371 Ga0068859_100676315
372 Ga0068864_100235135
373 Ga0068866_10004861
374 Ga0068861_100001025
375 Ga0068863_100258692
376 Ga0068858_100105430
377 Ga0068858_100267244
378 Ga0068860_100000761
379 Ga0068860_100009435
380 Ga0075365_10046566
381 Ga0075365_10188398
382 Ga0075364_10074421
383 Ga0070715_10007395
384 Ga0070715_10081372
385 Ga0070716_100010353
386 Ga0070712_100000814
387 Ga0070712_100033957
388 Ga0097621_100082993
389 Ga0097621_100117899
390 Ga0068871_100152459
391 Ga0097620_100104391
392 Ga0097620_100676271
393 Ga0105245_10004643
394 Ga0105247_10004906
395 Ga0105241_10006276
396 Ga0105241_10123459
397 Ga0105242_10002380
398 Ga0105248_10012735
399 Ga0105248_10202155
400 Ga0105237_10240169
401 Ga0105249_10004619
402 Ga0105239_10021935
403 Ga0157369_10094203
404 Ga0157374_10015972
405 Ga0163162_10130196
406 Ga0157372_10004674
407 Ga0157372_10483617
408 Ga0157375_10006261
409 Ga0163163_10137378
410 Ga0157380_10000214
411 Ga0157379_10047421
412 Ga0206356_11804448
413 Ga0206353_10595124
414 Ga0213876_10002741
415 Ga0213876_10017858
416 Ga0224712_10046647
417 Ga0209051_1000401
418 Ga0207692_10064444
419 Ga0207692_10067971
420 Ga0207642_10013574
421 Ga0207688_10003526
422 Ga0207685_10001882
423 Ga0207699_10032525
424 Ga0207699_10051635
425 Ga0207699_10265761
426 Ga0207699_10280581
427 Ga0207693_10000498
428 Ga0207693_10006479
429 Ga0207663_10014505
430 Ga0207663_10040867
431 Ga0207660_10102840
432 Ga0207681_10072841
433 Ga0207687_10021296
434 Ga0207700_10020549
435 Ga0207664_10025416
436 Ga0207664_10536502
437 Ga0207644_10028129
438 Ga0207644_10253722
439 Ga0207706_10009577
440 Ga0207686_10000867
441 Ga0207709_10002105
442 Ga0207670_10078649
443 Ga0207669_10000304
444 Ga0207669_10256823
445 Ga0207704_10000284
446 Ga0207665_10199624
447 Ga0207691_10049181
448 Ga0207691_10066645
449 Ga0207711_10025064
450 Ga0207667_10113795
451 Ga0207712_10008532
452 Ga0207712_10138094
453 Ga0207668_10004548
454 Ga0207658_10008085
455 Ga0207677_10002342
456 Ga0207703_10031216
457 Ga0207703_10239273
458 Ga0207639_10555249
459 Ga0207678_10020208
460 Ga0207708_10010774
461 Ga0207702_10360061
462 Ga0207641_10004533
463 Ga0207641_10228671
464 Ga0207648_10003140
465 Ga0207676_10055965
466 Ga0207676_10534872
467 Ga0207674_10071359
468 Ga0207683_10000505
469 Ga0268266_10033629
470 Ga0268266_10248889
471 Ga0268265_10005069
472 Ga0268264_10006925
473 Ga0268264_10023347
474 Ga0265327_10000367
475 Ga0265327_10004986
476 Ga0265327_10005959
477 Ga0265327_10048085
478 Ga0373959_0048852
479 Ga0373934_0036095
480 Ga0373940_0015115
481 Ga0373923_0012823
482 Ga0373941_0005072
483 Ga0373927_0102338
484 Ga0400483_129156
485 Ga0436365_0815018
486 Ga0436365_1776852
487 Ga0436360_0356632
488 Ga0436363_1061462
489 Ga0466969_0026778
490 Ga0466972_0160288
491 Ga0466966_0003232
492 Ga0466966_0010351
493 Ga0466961_0003187
494 Ga0466961_0008027
495 Ga0466961_0201172
496 Ga0466963_0041466
497 Ga0466963_0069087
498 Ga0466963_0069131
499 Ga0466963_0132996
500 Ga0466968_0000663
501 Ga0466970_0011705
502 Ga0466957_0000331
503 Ga0466957_0008691
504 Ga0466957_0324368
505 Ga0466959_0038534
506 Ga0466959_0072015
507 Ga0466959_0119990
508 Ga0466958_0005966
509 Ga0466958_0016635
510 Ga0466958_0032553
511 Ga0466967_0035121
512 Ga0466967_0062432
513 Ga0495592_0072319
514 Ga0495592_0124907
515 Ga0495603_0069518
516 Ga0495641_0018772
517 Ga0495641_0040496
518 Ga0495651_0021234
519 Ga0495653_0193217
520 Ga0495662_0036276
521 Ga0495664_0076539
522 Ga0495606_0079376
523 Ga0495608_0044489
524 Ga0495608_0160346
525 Ga0495628_0005642
526 Ga0495630_0034194
527 Ga0495648_0012214
528 Ga0495652_0135585
529 Ga0495652_0230693
530 Ga0495654_0038322
531 Ga0495668_0012039
532 Ga0495634_0085972
533 Ga0495611_0018209
534 Ga0495625_0127946
535 Ga0495635_0155504
536 Ga0495635_0279960
537 Ga0495657_0016394
538 Ga0495623_0235965
539 Ga0495624_0053166
540 Ga0495624_0100313
541 Ga0495600_0200294
542 Ga0495581_0019489
543 Ga0495581_0129467
544 Ga0495672_0000358
545 Ga0495672_0004499
546 Ga0495676_0088585
547 Ga0495680_0043166
548 Ga0495675_0065813
549 Ga0495673_0000928
550 Ga0495684_0122501
551 Ga0495684_0137543
552 Ga0496100_0075507
553 Ga0496100_0096524
554 Ga0496101_0001092
555 Ga0496101_0006914
556 Ga0496101_0071123
557 Ga0496101_0111755
558 Ga0496101_0269880
559 Ga0496102_0000041
560 Ga0496102_0014719
561 Ga0496102_0105824
562 Ga0496102_0241276
563 Ga0496103_0000150
564 Ga0496103_0001144
565 Ga0496103_0080635
566 Ga0496104_0009716
567 Ga0496105_0019676
568 Ga0496105_0040714
569 Ga0496106_0002024
570 Ga0496106_0022547
571 Ga0496107_0000127
572 Ga0496107_0328798
573 Ga0496108_0014490
574 Ga0496108_0302390
575 Ga0496109_0272005
576 Ga0496110_0136572
577 Ga0496110_0219114
578 Ga0496111_0267901
579 Ga0496112_0054155
580 Ga0496113_0120828
581 Ga0496114_0000176
582 Ga0496114_0020068
583 Ga0496114_0254605
584 Ga0496115_0018829
585 Ga0496115_0042809
586 Ga0496116_0000098
587 Ga0496117_0000096
588 Ga0496117_0051067
589 Ga0496118_0000067
590 Ga0496118_0000073
591 Ga0496120_0116362
592 Ga0496121_0001389
593 Ga0496126_0000762
594 Ga0496126_0011096
595 Ga0501031_0030449
596 Ga0501032_0000516
597 Ga0501033_0006745
598 Ga0501034_0000731
599 Ga0501034_0003109
600 Ga0501036_0016384
601 Ga0501036_0068543
602 Ga0501037_0000165
603 Ga0501038_0000292
604 Ga0501039_0000485
605 Ga0501043_0002674
606 Ga0501043_0028645
607 Ga0501046_0043790
608 Ga0501047_0017692
609 Ga0501070_0000573
610 Ga0501070_0005509
611 Ga0501071_0052446
612 Ga0501072_0000411
613 Ga0501075_0225206
614 Ga0501044_0016034
615 Ga0501044_0101479
616 nmdc:mga0yw44_158928_c1
617 nmdc:mga08x19_16019_c1
618 Ga0495619_0046111
619 Ga0495619_0063542
620 Ga0495619_0137049
621 Ga0500643_005366
622 Ga0500572_044926
623 Ga0500568_0089586
624 Ga0500616_0000110
625 Ga0500616_0003234
626 Ga0501084_0021617
627 Ga0466962_0005066
628 Ga0466962_0059989
629 Ga0530510_0099180
630 2812363278
631 2929218340
632 2995470326

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

1

252

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.8441 1 286
3c8n-assembly2.cif.gz_C crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.8423 3 288
3c8n-assembly1.cif.gz_B crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.8386 1 288
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.8359 1 286
3c8n-assembly1.cif.gz_B crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.8359 1 288
ID Description Score Start End Superfamily
af_P95159_1_299_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9018 1 272 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8897 1 273 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8663 1 273 3.20.20.30
af_P95159_1_299_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8514 1 272 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8335 1 286 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A1A2MXW7-F1-model_v4 LLM class F420-dependent oxidoreductase 0.983 38 229 GO:0008726
GO:0046306
AF-A0A495W335-F1-model_v4 F420-dependent oxidoreductase-like protein 0.9768 3 286 GO:0008726
GO:0046306
AF-A0A1A2MXW7-F1-model_v4 LLM class F420-dependent oxidoreductase 0.973 38 229 GO:0008726
GO:0046306
AF-A0A838DNK8-F1-model_v4 TIGR03560 family F420-dependent LLM class oxidoreductase 0.9724 29 196 GO:0008726
GO:0046306
AF-C1AXM4-F1-model_v4 Luciferase-like domain-containing protein 0.9684 3 186 GO:0008726
GO:0046306

Map