F403563

General Info

Members Datasets Scaffolds Average Seq Length
316 199 316 135

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100806776|Ga0070663_1008067761
Length 164
Sequence MSPALPGGSWNIAPAGIRLSSARQQIAGAPMSLEPKGFGRGENPSRNVFGDPLQTCSLAPKTGFFRNGCCDTGPEDVGSHTVCVELTEEFLQFSKLRGNDLSTPQPDFGFPGLKAGDRWCLCAPRWQEAFEENHAPRVVLRATHEGALEYCSLADLKRHAIDLA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
199 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 1.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 2.53
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 2.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100166454 3300005329 Bacteria 2092
2 Ga0070670_101892136 3300005331 Unclassified 549
3 Ga0070680_100667308 3300005336 Bacteria 894
4 Ga0070661_100109160 3300005344 Bacteria 2065
5 Ga0070674_100313906 3300005356 Unclassified 1254
6 Ga0070673_100237321 3300005364 Bacteria 1584
7 Ga0070667_100588487 3300005367 Bacteria 1025
8 Ga0070709_10371169 3300005434 Bacteria 1062
9 Ga0070714_100102980 3300005435 Bacteria 2518
10 Ga0070714_100819965 3300005435 Bacteria 901
11 Ga0070714_101919103 3300005435 Unclassified 578
12 Ga0070710_10037047 3300005437 Bacteria 2670
13 Ga0070710_10583952 3300005437 Unclassified 776
14 Ga0070711_100011865 3300005439 Bacteria 5423
15 Ga0070711_100157120 3300005439 Bacteria 1720
16 Ga0070711_100673372 3300005439 Bacteria 869
17 Ga0070663_100806776 3300005455 Bacteria 805
18 Ga0070678_100762164 3300005456 Bacteria 876
19 Ga0070678_100852769 3300005456 Unclassified 830
20 Ga0070681_10041840 3300005458 Bacteria 4593
21 Ga0070681_10067305 3300005458 Bacteria 3550
22 Ga0068867_100068641 3300005459 Bacteria 2646
23 Ga0070706_100335879 3300005467 Bacteria 1409
24 Ga0070679_100471312 3300005530 Bacteria 1200
25 Ga0070679_101051005 3300005530 Bacteria 759
26 Ga0070672_100255467 3300005543 Bacteria 1477
27 Ga0070665_100760710 3300005548 Bacteria 982
28 Ga0068855_100108634 3300005563 Unclassified 3186
29 Ga0070664_100736710 3300005564 Bacteria 919
30 Ga0068856_100231826 3300005614 Bacteria 1861
31 Ga0070702_100481222 3300005615 Unclassified 907
32 Ga0068852_100836651 3300005616 Unclassified 935
33 Ga0068859_101466090 3300005617 Unclassified 753
34 Ga0068866_10682002 3300005718 Bacteria 703
35 Ga0068861_101242102 3300005719 Bacteria 722
36 Ga0068861_101893530 3300005719 Unclassified 593
37 Ga0068858_100498578 3300005842 Bacteria 1176
38 Ga0068860_100343255 3300005843 Bacteria 1468
39 Ga0068860_100375555 3300005843 Bacteria 1403
40 Ga0068860_100545629 3300005843 Bacteria 1161
41 Ga0070717_10084825 3300006028 Bacteria 2665
42 Ga0070717_10101118 3300006028 Bacteria 2448
43 Ga0070717_11662964 3300006028 Unclassified 578
44 Ga0070716_100311923 3300006173 Bacteria 1098
45 Ga0070712_100060768 3300006175 Bacteria 2666
46 Ga0097621_100263648 3300006237 Bacteria 1512
47 Ga0097621_100589985 3300006237 Unclassified 1015
48 Ga0097621_101508505 3300006237 Bacteria 638
49 Ga0068871_100135132 3300006358 Bacteria 2094
50 Ga0068871_100162696 3300006358 Bacteria 1909
51 Ga0068871_100170269 3300006358 Unclassified 1866
52 Ga0068871_101586852 3300006358 Unclassified 619
53 Ga0075428_100113840 3300006844 Bacteria 2947
54 Ga0075428_101220244 3300006844 Bacteria 792
55 Ga0075431_100396612 3300006847 Bacteria 1381
56 Ga0075434_101384216 3300006871 Unclassified 714
57 Ga0068865_100660512 3300006881 Unclassified 889
58 Ga0097620_101466462 3300006931 Unclassified 753
59 Ga0105240_10045016 3300009093 Bacteria 5601
60 Ga0105240_10377767 3300009093 Bacteria 1601
61 Ga0111539_11062516 3300009094 Unclassified 941
62 Ga0105241_10137024 3300009174 Bacteria 1989
63 Ga0105242_10013601 3300009176 Bacteria 6297
64 Ga0105242_10115356 3300009176 Bacteria 2296
65 Ga0105242_10403284 3300009176 Bacteria 1277
66 Ga0105248_10495704 3300009177 Bacteria 1377
67 Ga0105249_10767963 3300009553 Unclassified 1027
68 Ga0105239_10310971 3300010375 Unclassified 1776
69 Ga0105246_10117470 3300011119 Bacteria 1965
70 Ga0157369_10007235 3300013105 Bacteria 12785
71 Ga0157374_10191078 3300013296 Bacteria 2003
72 Ga0163162_10115275 3300013306 Bacteria 2787
73 Ga0163162_10220421 3300013306 Bacteria 2027
74 Ga0163162_10277154 3300013306 Bacteria 1809
75 Ga0163162_12056115 3300013306 Bacteria 655
76 Ga0157372_11570178 3300013307 Unclassified 758
77 Ga0157375_10036433 3300013308 Bacteria 4706
78 Ga0157375_10558286 3300013308 Bacteria 1306
79 Ga0163163_11106508 3300014325 Bacteria 855
80 Ga0163163_11573650 3300014325 Bacteria 718
81 Ga0182008_10140438 3300014497 Bacteria 1208
82 Ga0157379_10685687 3300014968 Bacteria 961
83 Ga0163161_10156186 3300017792 Bacteria 1737
84 Ga0213873_10232320 3300021358 Bacteria 580
85 Ga0213874_10451160 3300021377 Bacteria 508
86 Ga0213875_10000642 3300021388 Bacteria 27861
87 Ga0213875_10047589 3300021388 Bacteria 2012
88 Ga0213871_10077481 3300021441 Bacteria 948
89 Ga0228598_1005032 3300024227 Bacteria 2779
90 Ga0207692_10989656 3300025898 Bacteria 555
91 Ga0207642_10048724 3300025899 Bacteria 1901
92 Ga0207642_10608353 3300025899 Bacteria 681
93 Ga0207647_10042807 3300025904 Bacteria 2838
94 Ga0207685_10031098 3300025905 Bacteria 1908
95 Ga0207699_10365494 3300025906 Bacteria 1021
96 Ga0207645_10763620 3300025907 Bacteria 657
97 Ga0207705_10718638 3300025909 Bacteria 776
98 Ga0207654_10048012 3300025911 Bacteria 2441
99 Ga0207707_10373768 3300025912 Bacteria 1226
100 Ga0207707_10855515 3300025912 Bacteria 754
101 Ga0207695_10102772 3300025913 Bacteria 2850
102 Ga0207671_10425072 3300025914 Bacteria 1057
103 Ga0207693_10562673 3300025915 Unclassified 889
104 Ga0207663_10081576 3300025916 Unclassified 2119
105 Ga0207660_10891286 3300025917 Bacteria 726
106 Ga0207657_11486369 3300025919 Unclassified 507
107 Ga0207649_10320032 3300025920 Bacteria 1139
108 Ga0207694_10190701 3300025924 Bacteria 1665
109 Ga0207650_10754227 3300025925 Bacteria 824
110 Ga0207650_11701505 3300025925 Unclassified 535
111 Ga0207700_10559886 3300025928 Bacteria 1015
112 Ga0207706_10130181 3300025933 Bacteria 2213
113 Ga0207686_10180293 3300025934 Unclassified 1497
114 Ga0207686_10481854 3300025934 Bacteria 959
115 Ga0207669_10663956 3300025937 Unclassified 854
116 Ga0207691_10902069 3300025940 Bacteria 740
117 Ga0207689_10582567 3300025942 Bacteria 941
118 Ga0207661_10382754 3300025944 Bacteria 1274
119 Ga0207679_10385622 3300025945 Bacteria 1229
120 Ga0207667_10196656 3300025949 Unclassified 2068
121 Ga0207651_10206555 3300025960 Bacteria 1578
122 Ga0207658_10720368 3300025986 Bacteria 902
123 Ga0207677_10164935 3300026023 Bacteria 1726
124 Ga0207703_12046309 3300026035 Bacteria 549
125 Ga0207702_10066447 3300026078 Bacteria 3091
126 Ga0207702_10180071 3300026078 Bacteria 1946
127 Ga0207702_11312170 3300026078 Unclassified 718
128 Ga0207648_10014388 3300026089 Bacteria 7312
129 Ga0207683_10012819 3300026121 Bacteria 7156
130 Ga0207683_10365600 3300026121 Bacteria 1325
131 Ga0268264_10192104 3300028381 Bacteria 1862
132 Ga0265337_1000550 3300028556 Bacteria 19821
133 Ga0265334_10000841 3300028573 Bacteria 15343
134 Ga0265336_10244478 3300028666 Bacteria 533
135 Ga0265338_10037842 3300028800 Bacteria 4582
136 Ga0265338_10041127 3300028800 Bacteria 4328
137 Ga0265338_10975281 3300028800 Bacteria 574
138 Ga0265762_1041721 3300030760 Bacteria 900
139 Ga0265762_1199848 3300030760 Unclassified 501
140 Ga0265763_1002186 3300030763 Bacteria 1480
141 Ga0265765_1020147 3300030879 Bacteria 802
142 Ga0265760_10139410 3300031090 Bacteria 789
143 Ga0265330_10314726 3300031235 Bacteria 660
144 Ga0265325_10316232 3300031241 Bacteria 694
145 Ga0265329_10137903 3300031242 Bacteria 787
146 Ga0265339_10001185 3300031249 Bacteria 19713
147 Ga0265339_10279259 3300031249 Bacteria 801
148 Ga0265316_10079555 3300031344 Bacteria 2515
149 Ga0265313_10003372 3300031595 Bacteria 13004
150 Ga0265313_10005442 3300031595 Bacteria 9371
151 Ga0265313_10033982 3300031595 Bacteria 2584
152 Ga0265314_10045210 3300031711 Bacteria 3115
153 Ga0265314_10111555 3300031711 Bacteria 1737
154 Ga0265342_10009324 3300031712 Bacteria 6930
155 Ga0265342_10034393 3300031712 Bacteria 3109
156 Ga0307516_10182595 3300031730 Bacteria 1830
157 Ga0373944_0084469 3300035089 Bacteria 1053
158 Ga0373923_0119702 3300035111 Bacteria 1176
159 Ga0373945_0051757 3300035116 Bacteria 1512
160 Ga0373945_0154363 3300035116 Bacteria 932
161 Ga0373953_0051566 3300035117 Bacteria 1664
162 Ga0373953_0453347 3300035117 Bacteria 567
163 Ga0373954_0220597 3300035118 Bacteria 933
164 Ga0373954_0699387 3300035118 Bacteria 503
165 Ga0373956_0192239 3300035119 Bacteria 966
166 Ga0373956_0243079 3300035119 Bacteria 855
167 Ga0373956_0313678 3300035119 Bacteria 747
168 Ga0373957_0044113 3300035120 Bacteria 1687
169 Ga0373957_0118445 3300035120 Bacteria 1071
170 Ga0373943_0000447 3300035170 Bacteria 17462
171 Ga0373946_0001610 3300035171 Bacteria 7854
172 Ga0373946_0261557 3300035171 Bacteria 847
173 Ga0373955_0267641 3300035172 Bacteria 1027
174 Ga0373935_0035097 3300035692 Bacteria 3129
175 Ga0373935_0626896 3300035692 Bacteria 788
176 Ga0373927_0001766 3300035695 Bacteria 16139
177 Ga0373927_0206577 3300035695 Bacteria 1290
178 Ga0373927_0598485 3300035695 Bacteria 729
179 Ga0373933_0164154 3300035724 Bacteria 1412
180 Ga0373947_0002871 3300035725 Bacteria 10298
181 Ga0373947_0071892 3300035725 Bacteria 2123
182 Ga0373947_0133032 3300035725 Bacteria 1589
183 Ga0373947_0478335 3300035725 Bacteria 845
184 Ga0373937_0063946 3300036401 Bacteria 3384
185 Ga0373937_0095703 3300036401 Bacteria 2753
186 Ga0373937_0588431 3300036401 Bacteria 1056
187 Ga0373937_0692448 3300036401 Bacteria 965
188 Ga0373937_1117144 3300036401 Bacteria 737
189 Ga0373925_0017310 3300037068 Bacteria 5223
190 Ga0373925_0080673 3300037068 Bacteria 2473
191 Ga0373925_0242607 3300037068 Bacteria 1443
192 Ga0395898_0316152 3300037466 Bacteria 1490
193 Ga0436364_0594358 3300037853 Bacteria 2063
194 Ga0436364_1360907 3300037853 Bacteria 661
195 Ga0436365_0476333 3300039437 Bacteria 1419
196 Ga0436365_1210337 3300039437 Bacteria 1003
197 Ga0436360_0545165 3300039438 Bacteria 1601
198 Ga0436360_1233965 3300039438 Bacteria 5184
199 Ga0436363_0793788 3300039450 Bacteria 742
200 Ga0466966_0142494 3300044684 Bacteria 1464
201 Ga0466963_0015411 3300044694 Bacteria 4733
202 Ga0466957_0299435 3300044842 Bacteria 1080
203 Ga0466959_0279419 3300045049 Bacteria 1146
204 Ga0466958_0021877 3300045836 Bacteria 3740
205 Ga0466967_0620663 3300045976 Bacteria 1068
206 Ga0495592_0077481 3300046454 Bacteria 2410
207 Ga0495592_0095818 3300046454 Bacteria 2122
208 Ga0495592_0600051 3300046454 Bacteria 671
209 Ga0495603_0220725 3300046455 Bacteria 1094
210 Ga0495629_0093697 3300046459 Bacteria 2096
211 Ga0495629_0373456 3300046459 Bacteria 971
212 Ga0495629_0606838 3300046459 Bacteria 731
213 Ga0495651_0015400 3300046462 Bacteria 5913
214 Ga0495651_0044854 3300046462 Bacteria 3426
215 Ga0495653_0305642 3300046463 Bacteria 1036
216 Ga0495653_0779275 3300046463 Bacteria 576
217 Ga0495580_0038317 3300046472 Bacteria 3434
218 Ga0495580_0053242 3300046472 Bacteria 2857
219 Ga0495580_1072733 3300046472 Bacteria 511
220 Ga0495582_0382519 3300046473 Bacteria 811
221 Ga0495582_0663338 3300046473 Bacteria 604
222 Ga0495639_0029572 3300046475 Bacteria 2432
223 Ga0495639_0085685 3300046475 Bacteria 1473
224 Ga0495662_0016225 3300046476 Bacteria 3611
225 Ga0495662_0038210 3300046476 Bacteria 2320
226 Ga0495664_0035255 3300046477 Bacteria 2945
227 Ga0495664_0069671 3300046477 Bacteria 2100
228 Ga0495664_0306346 3300046477 Bacteria 959
229 Ga0495584_0100714 3300046491 Bacteria 1460
230 Ga0495585_0152891 3300046492 Bacteria 1202
231 Ga0495608_0043324 3300046511 Bacteria 3007
232 Ga0495608_0075560 3300046511 Bacteria 2196
233 Ga0495618_0116511 3300046514 Bacteria 1711
234 Ga0495618_0323380 3300046514 Bacteria 955
235 Ga0495618_0444071 3300046514 Bacteria 788
236 Ga0495628_0041335 3300046516 Bacteria 3680
237 Ga0495628_0099373 3300046516 Bacteria 2247
238 Ga0495628_0346525 3300046516 Bacteria 1093
239 Ga0495630_0002779 3300046517 Bacteria 12146
240 Ga0495666_0039494 3300046526 Bacteria 2291
241 Ga0495652_0103738 3300046529 Bacteria 2301
242 Ga0495652_0114331 3300046529 Bacteria 2165
243 Ga0495652_0122315 3300046529 Bacteria 2073
244 Ga0495665_0076905 3300046531 Bacteria 1756
245 Ga0495640_0045019 3300046533 Bacteria 3064
246 Ga0495640_0051074 3300046533 Bacteria 2844
247 Ga0495640_0131478 3300046533 Bacteria 1620
248 Ga0495640_0177405 3300046533 Bacteria 1359
249 Ga0495640_0261034 3300046533 Bacteria 1082
250 Ga0495640_0267447 3300046533 Bacteria 1067
251 Ga0495586_0095461 3300046535 Bacteria 1646
252 Ga0495587_0192732 3300046536 Unclassified 1154
253 Ga0495645_0053192 3300046543 Bacteria 2944
254 Ga0495645_0528481 3300046543 Bacteria 734
255 Ga0495667_0561301 3300046559 Bacteria 713
256 Ga0495634_0013848 3300046642 Bacteria 5827
257 Ga0495634_0095873 3300046642 Bacteria 1921
258 Ga0495634_0107286 3300046642 Bacteria 1799
259 Ga0495635_0020897 3300046663 Bacteria 4561
260 Ga0495657_0197668 3300046675 Bacteria 1227
261 Ga0495623_0033947 3300046679 Bacteria 3273
262 Ga0495623_0052526 3300046679 Bacteria 2575
263 Ga0495646_0488210 3300046680 Bacteria 633
264 Ga0495647_0141836 3300046681 Bacteria 1025
265 Ga0495613_0018442 3300046689 Bacteria 5203
266 Ga0495613_0308936 3300046689 Bacteria 1093
267 Ga0495613_0364099 3300046689 Unclassified 991
268 Ga0495624_0002686 3300046690 Bacteria 13404
269 Ga0495624_0137081 3300046690 Bacteria 1500
270 Ga0495624_0966226 3300046690 Bacteria 500
271 Ga0495600_0126624 3300046809 Bacteria 1661
272 Ga0495581_0005861 3300047315 Bacteria 7123
273 Ga0495604_0041623 3300047317 Bacteria 3603
274 Ga0495604_0137507 3300047317 Bacteria 1749
275 Ga0495674_0123837 3300047319 Bacteria 2182
276 Ga0495674_0427347 3300047319 Bacteria 1067
277 Ga0495676_0064315 3300047321 Bacteria 2854
278 Ga0495680_0006961 3300047322 Bacteria 10433
279 Ga0495680_0235281 3300047322 Bacteria 1303
280 Ga0495675_0011220 3300047444 Bacteria 5620
281 Ga0495675_0014592 3300047444 Bacteria 4967
282 Ga0495675_0505223 3300047444 Bacteria 694
283 Ga0495675_0593720 3300047444 Bacteria 628
284 Ga0495673_0323058 3300047469 Bacteria 549
285 Ga0495684_0005055 3300047471 Bacteria 10300
286 Ga0495593_0014818 3300047673 Bacteria 4429
287 Ga0495602_0004414 3300048088 Bacteria 14679
288 Ga0495602_0046983 3300048088 Bacteria 3894
289 Ga0495602_0341172 3300048088 Unclassified 1084
290 Ga0496100_0670970 3300048903 Bacteria 808
291 Ga0496102_1246423 3300048905 Unclassified 663
292 Ga0496104_0014012 3300048907 Bacteria 7234
293 Ga0496104_0574699 3300048907 Bacteria 1038
294 Ga0496105_0010713 3300048908 Bacteria 7215
295 Ga0496111_1251315 3300048914 Bacteria 524
296 Ga0496114_0086461 3300048917 Bacteria 2657
297 Ga0496115_0033813 3300048918 Bacteria 4038
298 nmdc:mga05p37_94846_c1 3300050507 Bacteria 3676
299 nmdc:mga06r32_327591_c1 3300050510 Bacteria 1517
300 nmdc:mga0n895_1497072_c1 3300050512 Bacteria 641
301 Ga0495601_0127585 3300053077 Bacteria 1655
302 Ga0495601_0249803 3300053077 Bacteria 1158
303 Ga0495601_0366750 3300053077 Bacteria 935
304 Ga0495601_0368687 3300053077 Bacteria 933
305 Ga0495601_0461966 3300053077 Bacteria 821
306 Ga0495612_0067505 3300053078 Bacteria 1487
307 Ga0495612_0098214 3300053078 Bacteria 1245
308 Ga0495612_0128999 3300053078 Bacteria 1092
309 Ga0495595_0105255 3300053084 Bacteria 1364
310 Ga0495595_0184505 3300053084 Bacteria 1035
311 Ga0495595_0254527 3300053084 Bacteria 880
312 Ga0495619_0087367 3300053085 Bacteria 2108
313 Ga0495619_0446786 3300053085 Bacteria 891
314 Ga0495619_0465118 3300053085 Bacteria 871
315 Ga0500655_011400 3300053133 Bacteria 1610
316 Ga0500636_0170228 3300053177 Bacteria 1179

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046454 Ga0495592_0077481 Ga0495592_0077481_1215_1646 125
2 3300046462 Ga0495651_0044854 Ga0495651_0044854_772_1203 125
3 3300046477 Ga0495664_0035255 Ga0495664_0035255_560_991 125
4 3300046511 Ga0495608_0075560 Ga0495608_0075560_796_1227 125
5 3300046514 Ga0495618_0444071 Ga0495618_0444071_140_571 125
6 3300046516 Ga0495628_0041335 Ga0495628_0041335_1214_1645 125
7 3300046529 Ga0495652_0114331 Ga0495652_0114331_1689_2120 125
8 3300046533 Ga0495640_0051074 Ga0495640_0051074_36_467 125
9 3300046559 Ga0495667_0561301 Ga0495667_0561301_245_676 125
10 3300046642 Ga0495634_0107286 Ga0495634_0107286_535_966 125
11 3300046663 Ga0495635_0020897 Ga0495635_0020897_3032_3463 125
12 3300046679 Ga0495623_0052526 Ga0495623_0052526_177_608 125
13 3300046809 Ga0495600_0126624 Ga0495600_0126624_39_470 125
14 3300047317 Ga0495604_0041623 Ga0495604_0041623_3006_3437 125
15 3300047322 Ga0495680_0006961 Ga0495680_0006961_8460_8891 125
16 3300047444 Ga0495675_0014592 Ga0495675_0014592_2001_2432 125
17 3300048088 Ga0495602_0046983 Ga0495602_0046983_785_1216 125
18 3300046690 Ga0495624_0966226 Ga0495624_0966226_24_443 128
19 3300053078 Ga0495612_0128999 Ga0495612_0128999_47_466 128
20 3300005439 Ga0070711_100011865 Ga0070711_1000118651 132
21 3300021358 Ga0213873_10232320 Ga0213873_102323201 132
22 3300021441 Ga0213871_10077481 Ga0213871_100774812 132
23 3300025909 Ga0207705_10718638 Ga0207705_107186382 132
24 3300031730 Ga0307516_10182595 Ga0307516_101825952 132
25 3300035118 Ga0373954_0220597 Ga0373954_0220597_246_662 132
26 3300035119 Ga0373956_0243079 Ga0373956_0243079_29_445 132
27 3300035172 Ga0373955_0267641 Ga0373955_0267641_302_718 132
28 3300035692 Ga0373935_0626896 Ga0373935_0626896_28_444 132
29 3300035724 Ga0373933_0164154 Ga0373933_0164154_341_757 132
30 3300046473 Ga0495582_0663338 Ga0495582_0663338_103_519 132
31 3300047469 Ga0495673_0323058 Ga0495673_0323058_114_512 132
32 3300048903 Ga0496100_0670970 Ga0496100_0670970_244_660 132
33 3300048907 Ga0496104_0014012 Ga0496104_0014012_5615_6031 132
34 3300048908 Ga0496105_0010713 Ga0496105_0010713_2181_2597 132
35 3300048917 Ga0496114_0086461 Ga0496114_0086461_960_1376 132
36 3300048918 Ga0496115_0033813 Ga0496115_0033813_2469_2885 132
37 3300053077 Ga0495601_0461966 Ga0495601_0461966_256_672 132
38 3300053177 Ga0500636_0170228 Ga0500636_0170228_82_480 132
39 3300005435 Ga0070714_100102980 Ga0070714_1001029803 133
40 3300005458 Ga0070681_10067305 Ga0070681_100673052 133
41 3300005530 Ga0070679_101051005 Ga0070679_1010510051 133
42 3300006028 Ga0070717_10101118 Ga0070717_101011182 133
43 3300009093 Ga0105240_10045016 Ga0105240_100450165 133
44 3300014497 Ga0182008_10140438 Ga0182008_101404382 133
45 3300025898 Ga0207692_10989656 Ga0207692_109896561 133
46 3300025912 Ga0207707_10373768 Ga0207707_103737682 133
47 3300030760 Ga0265762_1199848 Ga0265762_11998481 133
48 3300044684 Ga0466966_0142494 Ga0466966_0142494_1028_1432 133
49 3300044694 Ga0466963_0015411 Ga0466963_0015411_3247_3651 133
50 3300044842 Ga0466957_0299435 Ga0466957_0299435_225_629 133
51 3300045049 Ga0466959_0279419 Ga0466959_0279419_185_589 133
52 3300045836 Ga0466958_0021877 Ga0466958_0021877_3066_3470 133
53 3300045976 Ga0466967_0620663 Ga0466967_0620663_325_729 133
54 3300046514 Ga0495618_0323380 Ga0495618_0323380_404_808 133
55 3300046529 Ga0495652_0103738 Ga0495652_0103738_597_1001 133
56 3300046533 Ga0495640_0177405 Ga0495640_0177405_626_1030 133
57 3300046536 Ga0495587_0192732 Ga0495587_0192732_566_970 133
58 3300046680 Ga0495646_0488210 Ga0495646_0488210_91_495 133
59 3300053077 Ga0495601_0127585 Ga0495601_0127585_328_732 133
60 3300005329 Ga0070683_100166454 Ga0070683_1001664541 134
61 3300005331 Ga0070670_101892136 Ga0070670_1018921361 134
62 3300005336 Ga0070680_100667308 Ga0070680_1006673082 134
63 3300005344 Ga0070661_100109160 Ga0070661_1001091602 134
64 3300005356 Ga0070674_100313906 Ga0070674_1003139063 134
65 3300005364 Ga0070673_100237321 Ga0070673_1002373213 134
66 3300005367 Ga0070667_100588487 Ga0070667_1005884872 134
67 3300005434 Ga0070709_10371169 Ga0070709_103711692 134
68 3300005435 Ga0070714_100819965 Ga0070714_1008199652 134
69 3300005435 Ga0070714_101919103 Ga0070714_1019191031 134
70 3300005437 Ga0070710_10037047 Ga0070710_100370472 134
71 3300005437 Ga0070710_10583952 Ga0070710_105839522 134
72 3300005439 Ga0070711_100157120 Ga0070711_1001571202 134
73 3300005439 Ga0070711_100673372 Ga0070711_1006733721 134
74 3300005455 Ga0070663_100806776 Ga0070663_1008067761 134
75 3300005456 Ga0070678_100762164 Ga0070678_1007621641 134
76 3300005456 Ga0070678_100852769 Ga0070678_1008527692 134
77 3300005458 Ga0070681_10041840 Ga0070681_100418403 134
78 3300005459 Ga0068867_100068641 Ga0068867_1000686412 134
79 3300005467 Ga0070706_100335879 Ga0070706_1003358791 134
80 3300005530 Ga0070679_100471312 Ga0070679_1004713122 134
81 3300005543 Ga0070672_100255467 Ga0070672_1002554672 134
82 3300005548 Ga0070665_100760710 Ga0070665_1007607102 134
83 3300005563 Ga0068855_100108634 Ga0068855_1001086343 134
84 3300005564 Ga0070664_100736710 Ga0070664_1007367102 134
85 3300005614 Ga0068856_100231826 Ga0068856_1002318262 134
86 3300005615 Ga0070702_100481222 Ga0070702_1004812221 134
87 3300005616 Ga0068852_100836651 Ga0068852_1008366512 134
88 3300005617 Ga0068859_101466090 Ga0068859_1014660901 134
89 3300005718 Ga0068866_10682002 Ga0068866_106820021 134
90 3300005719 Ga0068861_101242102 Ga0068861_1012421022 134
91 3300005719 Ga0068861_101893530 Ga0068861_1018935301 134
92 3300005842 Ga0068858_100498578 Ga0068858_1004985782 134
93 3300005843 Ga0068860_100343255 Ga0068860_1003432552 134
94 3300005843 Ga0068860_100375555 Ga0068860_1003755553 134
95 3300005843 Ga0068860_100545629 Ga0068860_1005456292 134
96 3300006028 Ga0070717_10084825 Ga0070717_100848253 134
97 3300006028 Ga0070717_11662964 Ga0070717_116629641 134
98 3300006173 Ga0070716_100311923 Ga0070716_1003119231 134
99 3300006175 Ga0070712_100060768 Ga0070712_1000607683 134
100 3300006237 Ga0097621_100263648 Ga0097621_1002636482 134
101 3300006237 Ga0097621_100589985 Ga0097621_1005899852 134
102 3300006237 Ga0097621_101508505 Ga0097621_1015085052 134
103 3300006358 Ga0068871_100135132 Ga0068871_1001351322 134
104 3300006358 Ga0068871_100162696 Ga0068871_1001626962 134
105 3300006358 Ga0068871_100170269 Ga0068871_1001702692 134
106 3300006358 Ga0068871_101586852 Ga0068871_1015868521 134
107 3300006844 Ga0075428_100113840 Ga0075428_1001138402 134
108 3300006844 Ga0075428_101220244 Ga0075428_1012202442 134
109 3300006847 Ga0075431_100396612 Ga0075431_1003966122 134
110 3300006871 Ga0075434_101384216 Ga0075434_1013842161 134
111 3300006881 Ga0068865_100660512 Ga0068865_1006605121 134
112 3300006931 Ga0097620_101466462 Ga0097620_1014664621 134
113 3300009093 Ga0105240_10377767 Ga0105240_103777672 134
114 3300009094 Ga0111539_11062516 Ga0111539_110625162 134
115 3300009174 Ga0105241_10137024 Ga0105241_101370242 134
116 3300009176 Ga0105242_10013601 Ga0105242_100136012 134
117 3300009176 Ga0105242_10115356 Ga0105242_101153563 134
118 3300009176 Ga0105242_10403284 Ga0105242_104032842 134
119 3300009177 Ga0105248_10495704 Ga0105248_104957042 134
120 3300009553 Ga0105249_10767963 Ga0105249_107679631 134
121 3300010375 Ga0105239_10310971 Ga0105239_103109712 134
122 3300011119 Ga0105246_10117470 Ga0105246_101174703 134
123 3300013105 Ga0157369_10007235 Ga0157369_100072353 134
124 3300013296 Ga0157374_10191078 Ga0157374_101910781 134
125 3300013306 Ga0163162_10115275 Ga0163162_101152753 134
126 3300013306 Ga0163162_10220421 Ga0163162_102204212 134
127 3300013306 Ga0163162_10277154 Ga0163162_102771542 134
128 3300013306 Ga0163162_12056115 Ga0163162_120561152 134
129 3300013307 Ga0157372_11570178 Ga0157372_115701781 134
130 3300013308 Ga0157375_10036433 Ga0157375_100364333 134
131 3300013308 Ga0157375_10558286 Ga0157375_105582862 134
132 3300014325 Ga0163163_11106508 Ga0163163_111065081 134
133 3300014325 Ga0163163_11573650 Ga0163163_115736502 134
134 3300014968 Ga0157379_10685687 Ga0157379_106856872 134
135 3300017792 Ga0163161_10156186 Ga0163161_101561863 134
136 3300021377 Ga0213874_10451160 Ga0213874_104511601 134
137 3300021388 Ga0213875_10000642 Ga0213875_100006425 134
138 3300021388 Ga0213875_10047589 Ga0213875_100475893 134
139 3300024227 Ga0228598_1005032 Ga0228598_10050322 134
140 3300025899 Ga0207642_10048724 Ga0207642_100487243 134
141 3300025899 Ga0207642_10608353 Ga0207642_106083532 134
142 3300025904 Ga0207647_10042807 Ga0207647_100428073 134
143 3300025905 Ga0207685_10031098 Ga0207685_100310983 134
144 3300025906 Ga0207699_10365494 Ga0207699_103654942 134
145 3300025907 Ga0207645_10763620 Ga0207645_107636201 134
146 3300025911 Ga0207654_10048012 Ga0207654_100480123 134
147 3300025912 Ga0207707_10855515 Ga0207707_108555152 134
148 3300025913 Ga0207695_10102772 Ga0207695_101027722 134
149 3300025914 Ga0207671_10425072 Ga0207671_104250722 134
150 3300025915 Ga0207693_10562673 Ga0207693_105626732 134
151 3300025916 Ga0207663_10081576 Ga0207663_100815764 134
152 3300025917 Ga0207660_10891286 Ga0207660_108912862 134
153 3300025919 Ga0207657_11486369 Ga0207657_114863691 134
154 3300025920 Ga0207649_10320032 Ga0207649_103200321 134
155 3300025924 Ga0207694_10190701 Ga0207694_101907012 134
156 3300025925 Ga0207650_10754227 Ga0207650_107542272 134
157 3300025925 Ga0207650_11701505 Ga0207650_117015051 134
158 3300025928 Ga0207700_10559886 Ga0207700_105598862 134
159 3300025933 Ga0207706_10130181 Ga0207706_101301813 134
160 3300025934 Ga0207686_10180293 Ga0207686_101802932 134
161 3300025934 Ga0207686_10481854 Ga0207686_104818542 134
162 3300025937 Ga0207669_10663956 Ga0207669_106639561 134
163 3300025940 Ga0207691_10902069 Ga0207691_109020692 134
164 3300025942 Ga0207689_10582567 Ga0207689_105825672 134
165 3300025944 Ga0207661_10382754 Ga0207661_103827542 134
166 3300025945 Ga0207679_10385622 Ga0207679_103856222 134
167 3300025949 Ga0207667_10196656 Ga0207667_101966562 134
168 3300025960 Ga0207651_10206555 Ga0207651_102065553 134
169 3300025986 Ga0207658_10720368 Ga0207658_107203682 134
170 3300026023 Ga0207677_10164935 Ga0207677_101649352 134
171 3300026035 Ga0207703_12046309 Ga0207703_120463091 134
172 3300026078 Ga0207702_10066447 Ga0207702_100664473 134
173 3300026078 Ga0207702_10180071 Ga0207702_101800712 134
174 3300026078 Ga0207702_11312170 Ga0207702_113121702 134
175 3300026089 Ga0207648_10014388 Ga0207648_100143883 134
176 3300026121 Ga0207683_10012819 Ga0207683_100128192 134
177 3300026121 Ga0207683_10365600 Ga0207683_103656001 134
178 3300028381 Ga0268264_10192104 Ga0268264_101921042 134
179 3300028556 Ga0265337_1000550 Ga0265337_10005505 134
180 3300028573 Ga0265334_10000841 Ga0265334_100008416 134
181 3300028666 Ga0265336_10244478 Ga0265336_102444781 134
182 3300028800 Ga0265338_10037842 Ga0265338_100378422 134
183 3300028800 Ga0265338_10041127 Ga0265338_100411274 134
184 3300028800 Ga0265338_10975281 Ga0265338_109752811 134
185 3300030760 Ga0265762_1041721 Ga0265762_10417212 134
186 3300030763 Ga0265763_1002186 Ga0265763_10021862 134
187 3300030879 Ga0265765_1020147 Ga0265765_10201471 134
188 3300031090 Ga0265760_10139410 Ga0265760_101394102 134
189 3300031235 Ga0265330_10314726 Ga0265330_103147261 134
190 3300031241 Ga0265325_10316232 Ga0265325_103162321 134
191 3300031242 Ga0265329_10137903 Ga0265329_101379032 134
192 3300031249 Ga0265339_10001185 Ga0265339_100011856 134
193 3300031249 Ga0265339_10279259 Ga0265339_102792592 134
194 3300031344 Ga0265316_10079555 Ga0265316_100795552 134
195 3300031595 Ga0265313_10003372 Ga0265313_1000337213 134
196 3300031595 Ga0265313_10005442 Ga0265313_100054423 134
197 3300031595 Ga0265313_10033982 Ga0265313_100339823 134
198 3300031711 Ga0265314_10045210 Ga0265314_100452102 134
199 3300031711 Ga0265314_10111555 Ga0265314_101115552 134
200 3300031712 Ga0265342_10009324 Ga0265342_100093247 134
201 3300031712 Ga0265342_10034393 Ga0265342_100343932 134
202 3300035089 Ga0373944_0084469 Ga0373944_0084469_247_654 134
203 3300035111 Ga0373923_0119702 Ga0373923_0119702_30_437 134
204 3300035116 Ga0373945_0051757 Ga0373945_0051757_238_669 134
205 3300035116 Ga0373945_0154363 Ga0373945_0154363_150_557 134
206 3300035117 Ga0373953_0051566 Ga0373953_0051566_1170_1574 134
207 3300035117 Ga0373953_0453347 Ga0373953_0453347_78_485 134
208 3300035118 Ga0373954_0699387 Ga0373954_0699387_20_451 134
209 3300035119 Ga0373956_0192239 Ga0373956_0192239_503_907 134
210 3300035119 Ga0373956_0313678 Ga0373956_0313678_165_572 134
211 3300035120 Ga0373957_0044113 Ga0373957_0044113_436_840 134
212 3300035120 Ga0373957_0118445 Ga0373957_0118445_631_1038 134
213 3300035170 Ga0373943_0000447 Ga0373943_0000447_9377_9784 134
214 3300035171 Ga0373946_0001610 Ga0373946_0001610_4885_5292 134
215 3300035171 Ga0373946_0261557 Ga0373946_0261557_297_701 134
216 3300035692 Ga0373935_0035097 Ga0373935_0035097_1298_1705 134
217 3300035695 Ga0373927_0001766 Ga0373927_0001766_3604_4011 134
218 3300035695 Ga0373927_0206577 Ga0373927_0206577_689_1096 134
219 3300035695 Ga0373927_0598485 Ga0373927_0598485_23_430 134
220 3300035725 Ga0373947_0002871 Ga0373947_0002871_1712_2119 134
221 3300035725 Ga0373947_0071892 Ga0373947_0071892_497_904 134
222 3300035725 Ga0373947_0133032 Ga0373947_0133032_1018_1425 134
223 3300035725 Ga0373947_0478335 Ga0373947_0478335_336_767 134
224 3300036401 Ga0373937_0063946 Ga0373937_0063946_2225_2629 134
225 3300036401 Ga0373937_0095703 Ga0373937_0095703_782_1189 134
226 3300036401 Ga0373937_0588431 Ga0373937_0588431_555_959 134
227 3300036401 Ga0373937_0692448 Ga0373937_0692448_12_416 134
228 3300036401 Ga0373937_1117144 Ga0373937_1117144_301_705 134
229 3300037068 Ga0373925_0017310 Ga0373925_0017310_3340_3747 134
230 3300037068 Ga0373925_0080673 Ga0373925_0080673_896_1303 134
231 3300037068 Ga0373925_0242607 Ga0373925_0242607_131_538 134
232 3300037466 Ga0395898_0316152 Ga0395898_0316152_504_911 134
233 3300037853 Ga0436364_0594358 Ga0436364_0594358_358_762 134
234 3300037853 Ga0436364_1360907 Ga0436364_1360907_58_462 134
235 3300039437 Ga0436365_0476333 Ga0436365_0476333_658_1065 134
236 3300039437 Ga0436365_1210337 Ga0436365_1210337_298_711 134
237 3300039438 Ga0436360_0545165 Ga0436360_0545165_459_872 134
238 3300039438 Ga0436360_1233965 Ga0436360_1233965_703_1134 134
239 3300039450 Ga0436363_0793788 Ga0436363_0793788_188_595 134
240 3300046454 Ga0495592_0095818 Ga0495592_0095818_367_774 134
241 3300046454 Ga0495592_0600051 Ga0495592_0600051_99_506 134
242 3300046455 Ga0495603_0220725 Ga0495603_0220725_229_636 134
243 3300046459 Ga0495629_0093697 Ga0495629_0093697_387_794 134
244 3300046459 Ga0495629_0373456 Ga0495629_0373456_219_626 134
245 3300046459 Ga0495629_0606838 Ga0495629_0606838_24_431 134
246 3300046462 Ga0495651_0015400 Ga0495651_0015400_282_689 134
247 3300046463 Ga0495653_0305642 Ga0495653_0305642_59_466 134
248 3300046463 Ga0495653_0779275 Ga0495653_0779275_72_479 134
249 3300046472 Ga0495580_0038317 Ga0495580_0038317_2114_2521 134
250 3300046472 Ga0495580_0053242 Ga0495580_0053242_784_1188 134
251 3300046472 Ga0495580_1072733 Ga0495580_1072733_61_468 134
252 3300046473 Ga0495582_0382519 Ga0495582_0382519_306_713 134
253 3300046475 Ga0495639_0029572 Ga0495639_0029572_1682_2089 134
254 3300046475 Ga0495639_0085685 Ga0495639_0085685_593_1000 134
255 3300046476 Ga0495662_0016225 Ga0495662_0016225_1556_1963 134
256 3300046476 Ga0495662_0038210 Ga0495662_0038210_519_926 134
257 3300046477 Ga0495664_0069671 Ga0495664_0069671_289_696 134
258 3300046477 Ga0495664_0306346 Ga0495664_0306346_318_725 134
259 3300046491 Ga0495584_0100714 Ga0495584_0100714_491_898 134
260 3300046492 Ga0495585_0152891 Ga0495585_0152891_473_880 134
261 3300046511 Ga0495608_0043324 Ga0495608_0043324_665_1072 134
262 3300046514 Ga0495618_0116511 Ga0495618_0116511_187_591 134
263 3300046516 Ga0495628_0099373 Ga0495628_0099373_1376_1783 134
264 3300046516 Ga0495628_0346525 Ga0495628_0346525_273_680 134
265 3300046517 Ga0495630_0002779 Ga0495630_0002779_10121_10528 134
266 3300046526 Ga0495666_0039494 Ga0495666_0039494_609_1016 134
267 3300046529 Ga0495652_0122315 Ga0495652_0122315_262_669 134
268 3300046531 Ga0495665_0076905 Ga0495665_0076905_61_468 134
269 3300046533 Ga0495640_0045019 Ga0495640_0045019_1997_2404 134
270 3300046533 Ga0495640_0131478 Ga0495640_0131478_766_1197 134
271 3300046533 Ga0495640_0261034 Ga0495640_0261034_398_805 134
272 3300046533 Ga0495640_0267447 Ga0495640_0267447_197_604 134
273 3300046535 Ga0495586_0095461 Ga0495586_0095461_1206_1610 134
274 3300046543 Ga0495645_0053192 Ga0495645_0053192_1756_2163 134
275 3300046543 Ga0495645_0528481 Ga0495645_0528481_218_649 134
276 3300046642 Ga0495634_0013848 Ga0495634_0013848_4862_5269 134
277 3300046642 Ga0495634_0095873 Ga0495634_0095873_1080_1487 134
278 3300046675 Ga0495657_0197668 Ga0495657_0197668_561_968 134
279 3300046679 Ga0495623_0033947 Ga0495623_0033947_804_1211 134
280 3300046681 Ga0495647_0141836 Ga0495647_0141836_23_430 134
281 3300046689 Ga0495613_0018442 Ga0495613_0018442_1625_2032 134
282 3300046689 Ga0495613_0308936 Ga0495613_0308936_86_493 134
283 3300046689 Ga0495613_0364099 Ga0495613_0364099_244_651 134
284 3300046690 Ga0495624_0002686 Ga0495624_0002686_2315_2722 134
285 3300046690 Ga0495624_0137081 Ga0495624_0137081_418_825 134
286 3300047315 Ga0495581_0005861 Ga0495581_0005861_3024_3431 134
287 3300047317 Ga0495604_0137507 Ga0495604_0137507_710_1117 134
288 3300047319 Ga0495674_0123837 Ga0495674_0123837_1661_2092 134
289 3300047319 Ga0495674_0427347 Ga0495674_0427347_464_871 134
290 3300047321 Ga0495676_0064315 Ga0495676_0064315_1285_1692 134
291 3300047322 Ga0495680_0235281 Ga0495680_0235281_209_616 134
292 3300047444 Ga0495675_0011220 Ga0495675_0011220_2897_3304 134
293 3300047444 Ga0495675_0505223 Ga0495675_0505223_247_651 134
294 3300047444 Ga0495675_0593720 Ga0495675_0593720_214_618 134
295 3300047471 Ga0495684_0005055 Ga0495684_0005055_6398_6805 134
296 3300047673 Ga0495593_0014818 Ga0495593_0014818_2498_2905 134
297 3300048088 Ga0495602_0004414 Ga0495602_0004414_2048_2455 134
298 3300048088 Ga0495602_0341172 Ga0495602_0341172_184_591 134
299 3300048905 Ga0496102_1246423 Ga0496102_1246423_187_594 134
300 3300048907 Ga0496104_0574699 Ga0496104_0574699_403_834 134
301 3300048914 Ga0496111_1251315 Ga0496111_1251315_29_436 134
302 3300050507 nmdc:mga05p37_94846_c1 nmdc:mga05p37_94846_c1_1420_1827 134
303 3300050510 nmdc:mga06r32_327591_c1 nmdc:mga06r32_327591_c1_924_1331 134
304 3300050512 nmdc:mga0n895_1497072_c1 nmdc:mga0n895_1497072_c1_218_622 134
305 3300053077 Ga0495601_0249803 Ga0495601_0249803_495_902 134
306 3300053077 Ga0495601_0366750 Ga0495601_0366750_244_651 134
307 3300053077 Ga0495601_0368687 Ga0495601_0368687_477_908 134
308 3300053078 Ga0495612_0067505 Ga0495612_0067505_510_917 134
309 3300053078 Ga0495612_0098214 Ga0495612_0098214_241_648 134
310 3300053084 Ga0495595_0105255 Ga0495595_0105255_559_966 134
311 3300053084 Ga0495595_0184505 Ga0495595_0184505_554_961 134
312 3300053084 Ga0495595_0254527 Ga0495595_0254527_234_665 134
313 3300053085 Ga0495619_0087367 Ga0495619_0087367_617_1024 134
314 3300053085 Ga0495619_0446786 Ga0495619_0446786_255_662 134
315 3300053085 Ga0495619_0465118 Ga0495619_0465118_450_857 134
316 3300053133 Ga0500655_011400 Ga0500655_011400_304_708 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09996

DUF2237

Uncharacterized protein conserved in bacteria (DUF2237)

46

160

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.9367 15 132
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.9291 15 132
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.8391 15 131
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.8124 15 131
5ghr-assembly2.cif.gz_D dna replication protein 0.5314 51 109
ID Description Score Start End Superfamily
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.9314 15 132 3.30.56.110
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.9236 15 132 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8516 17 131 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8239 17 131 3.30.56.110
af_K7LRE8_220_319_1.10.245.10 Mainly Alpha;Orthogonal Bundle;MDM2;SWIB/MDM2 domain 0.5748 55 78 1.10.245.10
ID Description Score Start End GO Terms
AF-A0A0A8JYT9-F1-model_v4 DUF2237 domain-containing protein 1.005 56 134
AF-A0A348WHA5-F1-model_v4 DUF2237 domain-containing protein 1.002 82 130
AF-A0A160TU93-F1-model_v4 DUF2237 domain-containing protein 0.9963 52 134
AF-Q0FK62-F1-model_v4 DUF2237 domain-containing protein 0.9962 59 130
AF-A0A817Q9G5-F1-model_v4 Uncharacterized protein 0.9958 56 103 GO:0016020

Feature Viewer

pLDDT pTM Quality
86.19 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map