F403563
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 316 | 199 | 316 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100806776|Ga0070663_1008067761 |
| Length | 164 |
| Sequence | MSPALPGGSWNIAPAGIRLSSARQQIAGAPMSLEPKGFGRGENPSRNVFGDPLQTCSLAPKTGFFRNGCCDTGPEDVGSHTVCVELTEEFLQFSKLRGNDLSTPQPDFGFPGLKAGDRWCLCAPRWQEAFEENHAPRVVLRATHEGALEYCSLADLKRHAIDLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 27 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 58 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 59 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 60 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 61 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 62 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 99 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 107 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 108 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 114 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 115 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 116 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 117 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 118 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 121 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 122 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 123 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 124 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 126 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 127 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 132 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 133 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 134 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 135 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 136 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 137 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 138 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 139 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 140 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 141 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 186 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 187 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 188 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 189 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 190 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 191 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 199 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.42 |
| Metatranscriptomes | 1.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.63 |
| Nodule | 0 |
| Rhizoplane | 2.53 |
| Rhizosphere | 93.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100166454 | 3300005329 | Bacteria | 2092 |
| 2 | Ga0070670_101892136 | 3300005331 | Unclassified | 549 |
| 3 | Ga0070680_100667308 | 3300005336 | Bacteria | 894 |
| 4 | Ga0070661_100109160 | 3300005344 | Bacteria | 2065 |
| 5 | Ga0070674_100313906 | 3300005356 | Unclassified | 1254 |
| 6 | Ga0070673_100237321 | 3300005364 | Bacteria | 1584 |
| 7 | Ga0070667_100588487 | 3300005367 | Bacteria | 1025 |
| 8 | Ga0070709_10371169 | 3300005434 | Bacteria | 1062 |
| 9 | Ga0070714_100102980 | 3300005435 | Bacteria | 2518 |
| 10 | Ga0070714_100819965 | 3300005435 | Bacteria | 901 |
| 11 | Ga0070714_101919103 | 3300005435 | Unclassified | 578 |
| 12 | Ga0070710_10037047 | 3300005437 | Bacteria | 2670 |
| 13 | Ga0070710_10583952 | 3300005437 | Unclassified | 776 |
| 14 | Ga0070711_100011865 | 3300005439 | Bacteria | 5423 |
| 15 | Ga0070711_100157120 | 3300005439 | Bacteria | 1720 |
| 16 | Ga0070711_100673372 | 3300005439 | Bacteria | 869 |
| 17 | Ga0070663_100806776 | 3300005455 | Bacteria | 805 |
| 18 | Ga0070678_100762164 | 3300005456 | Bacteria | 876 |
| 19 | Ga0070678_100852769 | 3300005456 | Unclassified | 830 |
| 20 | Ga0070681_10041840 | 3300005458 | Bacteria | 4593 |
| 21 | Ga0070681_10067305 | 3300005458 | Bacteria | 3550 |
| 22 | Ga0068867_100068641 | 3300005459 | Bacteria | 2646 |
| 23 | Ga0070706_100335879 | 3300005467 | Bacteria | 1409 |
| 24 | Ga0070679_100471312 | 3300005530 | Bacteria | 1200 |
| 25 | Ga0070679_101051005 | 3300005530 | Bacteria | 759 |
| 26 | Ga0070672_100255467 | 3300005543 | Bacteria | 1477 |
| 27 | Ga0070665_100760710 | 3300005548 | Bacteria | 982 |
| 28 | Ga0068855_100108634 | 3300005563 | Unclassified | 3186 |
| 29 | Ga0070664_100736710 | 3300005564 | Bacteria | 919 |
| 30 | Ga0068856_100231826 | 3300005614 | Bacteria | 1861 |
| 31 | Ga0070702_100481222 | 3300005615 | Unclassified | 907 |
| 32 | Ga0068852_100836651 | 3300005616 | Unclassified | 935 |
| 33 | Ga0068859_101466090 | 3300005617 | Unclassified | 753 |
| 34 | Ga0068866_10682002 | 3300005718 | Bacteria | 703 |
| 35 | Ga0068861_101242102 | 3300005719 | Bacteria | 722 |
| 36 | Ga0068861_101893530 | 3300005719 | Unclassified | 593 |
| 37 | Ga0068858_100498578 | 3300005842 | Bacteria | 1176 |
| 38 | Ga0068860_100343255 | 3300005843 | Bacteria | 1468 |
| 39 | Ga0068860_100375555 | 3300005843 | Bacteria | 1403 |
| 40 | Ga0068860_100545629 | 3300005843 | Bacteria | 1161 |
| 41 | Ga0070717_10084825 | 3300006028 | Bacteria | 2665 |
| 42 | Ga0070717_10101118 | 3300006028 | Bacteria | 2448 |
| 43 | Ga0070717_11662964 | 3300006028 | Unclassified | 578 |
| 44 | Ga0070716_100311923 | 3300006173 | Bacteria | 1098 |
| 45 | Ga0070712_100060768 | 3300006175 | Bacteria | 2666 |
| 46 | Ga0097621_100263648 | 3300006237 | Bacteria | 1512 |
| 47 | Ga0097621_100589985 | 3300006237 | Unclassified | 1015 |
| 48 | Ga0097621_101508505 | 3300006237 | Bacteria | 638 |
| 49 | Ga0068871_100135132 | 3300006358 | Bacteria | 2094 |
| 50 | Ga0068871_100162696 | 3300006358 | Bacteria | 1909 |
| 51 | Ga0068871_100170269 | 3300006358 | Unclassified | 1866 |
| 52 | Ga0068871_101586852 | 3300006358 | Unclassified | 619 |
| 53 | Ga0075428_100113840 | 3300006844 | Bacteria | 2947 |
| 54 | Ga0075428_101220244 | 3300006844 | Bacteria | 792 |
| 55 | Ga0075431_100396612 | 3300006847 | Bacteria | 1381 |
| 56 | Ga0075434_101384216 | 3300006871 | Unclassified | 714 |
| 57 | Ga0068865_100660512 | 3300006881 | Unclassified | 889 |
| 58 | Ga0097620_101466462 | 3300006931 | Unclassified | 753 |
| 59 | Ga0105240_10045016 | 3300009093 | Bacteria | 5601 |
| 60 | Ga0105240_10377767 | 3300009093 | Bacteria | 1601 |
| 61 | Ga0111539_11062516 | 3300009094 | Unclassified | 941 |
| 62 | Ga0105241_10137024 | 3300009174 | Bacteria | 1989 |
| 63 | Ga0105242_10013601 | 3300009176 | Bacteria | 6297 |
| 64 | Ga0105242_10115356 | 3300009176 | Bacteria | 2296 |
| 65 | Ga0105242_10403284 | 3300009176 | Bacteria | 1277 |
| 66 | Ga0105248_10495704 | 3300009177 | Bacteria | 1377 |
| 67 | Ga0105249_10767963 | 3300009553 | Unclassified | 1027 |
| 68 | Ga0105239_10310971 | 3300010375 | Unclassified | 1776 |
| 69 | Ga0105246_10117470 | 3300011119 | Bacteria | 1965 |
| 70 | Ga0157369_10007235 | 3300013105 | Bacteria | 12785 |
| 71 | Ga0157374_10191078 | 3300013296 | Bacteria | 2003 |
| 72 | Ga0163162_10115275 | 3300013306 | Bacteria | 2787 |
| 73 | Ga0163162_10220421 | 3300013306 | Bacteria | 2027 |
| 74 | Ga0163162_10277154 | 3300013306 | Bacteria | 1809 |
| 75 | Ga0163162_12056115 | 3300013306 | Bacteria | 655 |
| 76 | Ga0157372_11570178 | 3300013307 | Unclassified | 758 |
| 77 | Ga0157375_10036433 | 3300013308 | Bacteria | 4706 |
| 78 | Ga0157375_10558286 | 3300013308 | Bacteria | 1306 |
| 79 | Ga0163163_11106508 | 3300014325 | Bacteria | 855 |
| 80 | Ga0163163_11573650 | 3300014325 | Bacteria | 718 |
| 81 | Ga0182008_10140438 | 3300014497 | Bacteria | 1208 |
| 82 | Ga0157379_10685687 | 3300014968 | Bacteria | 961 |
| 83 | Ga0163161_10156186 | 3300017792 | Bacteria | 1737 |
| 84 | Ga0213873_10232320 | 3300021358 | Bacteria | 580 |
| 85 | Ga0213874_10451160 | 3300021377 | Bacteria | 508 |
| 86 | Ga0213875_10000642 | 3300021388 | Bacteria | 27861 |
| 87 | Ga0213875_10047589 | 3300021388 | Bacteria | 2012 |
| 88 | Ga0213871_10077481 | 3300021441 | Bacteria | 948 |
| 89 | Ga0228598_1005032 | 3300024227 | Bacteria | 2779 |
| 90 | Ga0207692_10989656 | 3300025898 | Bacteria | 555 |
| 91 | Ga0207642_10048724 | 3300025899 | Bacteria | 1901 |
| 92 | Ga0207642_10608353 | 3300025899 | Bacteria | 681 |
| 93 | Ga0207647_10042807 | 3300025904 | Bacteria | 2838 |
| 94 | Ga0207685_10031098 | 3300025905 | Bacteria | 1908 |
| 95 | Ga0207699_10365494 | 3300025906 | Bacteria | 1021 |
| 96 | Ga0207645_10763620 | 3300025907 | Bacteria | 657 |
| 97 | Ga0207705_10718638 | 3300025909 | Bacteria | 776 |
| 98 | Ga0207654_10048012 | 3300025911 | Bacteria | 2441 |
| 99 | Ga0207707_10373768 | 3300025912 | Bacteria | 1226 |
| 100 | Ga0207707_10855515 | 3300025912 | Bacteria | 754 |
| 101 | Ga0207695_10102772 | 3300025913 | Bacteria | 2850 |
| 102 | Ga0207671_10425072 | 3300025914 | Bacteria | 1057 |
| 103 | Ga0207693_10562673 | 3300025915 | Unclassified | 889 |
| 104 | Ga0207663_10081576 | 3300025916 | Unclassified | 2119 |
| 105 | Ga0207660_10891286 | 3300025917 | Bacteria | 726 |
| 106 | Ga0207657_11486369 | 3300025919 | Unclassified | 507 |
| 107 | Ga0207649_10320032 | 3300025920 | Bacteria | 1139 |
| 108 | Ga0207694_10190701 | 3300025924 | Bacteria | 1665 |
| 109 | Ga0207650_10754227 | 3300025925 | Bacteria | 824 |
| 110 | Ga0207650_11701505 | 3300025925 | Unclassified | 535 |
| 111 | Ga0207700_10559886 | 3300025928 | Bacteria | 1015 |
| 112 | Ga0207706_10130181 | 3300025933 | Bacteria | 2213 |
| 113 | Ga0207686_10180293 | 3300025934 | Unclassified | 1497 |
| 114 | Ga0207686_10481854 | 3300025934 | Bacteria | 959 |
| 115 | Ga0207669_10663956 | 3300025937 | Unclassified | 854 |
| 116 | Ga0207691_10902069 | 3300025940 | Bacteria | 740 |
| 117 | Ga0207689_10582567 | 3300025942 | Bacteria | 941 |
| 118 | Ga0207661_10382754 | 3300025944 | Bacteria | 1274 |
| 119 | Ga0207679_10385622 | 3300025945 | Bacteria | 1229 |
| 120 | Ga0207667_10196656 | 3300025949 | Unclassified | 2068 |
| 121 | Ga0207651_10206555 | 3300025960 | Bacteria | 1578 |
| 122 | Ga0207658_10720368 | 3300025986 | Bacteria | 902 |
| 123 | Ga0207677_10164935 | 3300026023 | Bacteria | 1726 |
| 124 | Ga0207703_12046309 | 3300026035 | Bacteria | 549 |
| 125 | Ga0207702_10066447 | 3300026078 | Bacteria | 3091 |
| 126 | Ga0207702_10180071 | 3300026078 | Bacteria | 1946 |
| 127 | Ga0207702_11312170 | 3300026078 | Unclassified | 718 |
| 128 | Ga0207648_10014388 | 3300026089 | Bacteria | 7312 |
| 129 | Ga0207683_10012819 | 3300026121 | Bacteria | 7156 |
| 130 | Ga0207683_10365600 | 3300026121 | Bacteria | 1325 |
| 131 | Ga0268264_10192104 | 3300028381 | Bacteria | 1862 |
| 132 | Ga0265337_1000550 | 3300028556 | Bacteria | 19821 |
| 133 | Ga0265334_10000841 | 3300028573 | Bacteria | 15343 |
| 134 | Ga0265336_10244478 | 3300028666 | Bacteria | 533 |
| 135 | Ga0265338_10037842 | 3300028800 | Bacteria | 4582 |
| 136 | Ga0265338_10041127 | 3300028800 | Bacteria | 4328 |
| 137 | Ga0265338_10975281 | 3300028800 | Bacteria | 574 |
| 138 | Ga0265762_1041721 | 3300030760 | Bacteria | 900 |
| 139 | Ga0265762_1199848 | 3300030760 | Unclassified | 501 |
| 140 | Ga0265763_1002186 | 3300030763 | Bacteria | 1480 |
| 141 | Ga0265765_1020147 | 3300030879 | Bacteria | 802 |
| 142 | Ga0265760_10139410 | 3300031090 | Bacteria | 789 |
| 143 | Ga0265330_10314726 | 3300031235 | Bacteria | 660 |
| 144 | Ga0265325_10316232 | 3300031241 | Bacteria | 694 |
| 145 | Ga0265329_10137903 | 3300031242 | Bacteria | 787 |
| 146 | Ga0265339_10001185 | 3300031249 | Bacteria | 19713 |
| 147 | Ga0265339_10279259 | 3300031249 | Bacteria | 801 |
| 148 | Ga0265316_10079555 | 3300031344 | Bacteria | 2515 |
| 149 | Ga0265313_10003372 | 3300031595 | Bacteria | 13004 |
| 150 | Ga0265313_10005442 | 3300031595 | Bacteria | 9371 |
| 151 | Ga0265313_10033982 | 3300031595 | Bacteria | 2584 |
| 152 | Ga0265314_10045210 | 3300031711 | Bacteria | 3115 |
| 153 | Ga0265314_10111555 | 3300031711 | Bacteria | 1737 |
| 154 | Ga0265342_10009324 | 3300031712 | Bacteria | 6930 |
| 155 | Ga0265342_10034393 | 3300031712 | Bacteria | 3109 |
| 156 | Ga0307516_10182595 | 3300031730 | Bacteria | 1830 |
| 157 | Ga0373944_0084469 | 3300035089 | Bacteria | 1053 |
| 158 | Ga0373923_0119702 | 3300035111 | Bacteria | 1176 |
| 159 | Ga0373945_0051757 | 3300035116 | Bacteria | 1512 |
| 160 | Ga0373945_0154363 | 3300035116 | Bacteria | 932 |
| 161 | Ga0373953_0051566 | 3300035117 | Bacteria | 1664 |
| 162 | Ga0373953_0453347 | 3300035117 | Bacteria | 567 |
| 163 | Ga0373954_0220597 | 3300035118 | Bacteria | 933 |
| 164 | Ga0373954_0699387 | 3300035118 | Bacteria | 503 |
| 165 | Ga0373956_0192239 | 3300035119 | Bacteria | 966 |
| 166 | Ga0373956_0243079 | 3300035119 | Bacteria | 855 |
| 167 | Ga0373956_0313678 | 3300035119 | Bacteria | 747 |
| 168 | Ga0373957_0044113 | 3300035120 | Bacteria | 1687 |
| 169 | Ga0373957_0118445 | 3300035120 | Bacteria | 1071 |
| 170 | Ga0373943_0000447 | 3300035170 | Bacteria | 17462 |
| 171 | Ga0373946_0001610 | 3300035171 | Bacteria | 7854 |
| 172 | Ga0373946_0261557 | 3300035171 | Bacteria | 847 |
| 173 | Ga0373955_0267641 | 3300035172 | Bacteria | 1027 |
| 174 | Ga0373935_0035097 | 3300035692 | Bacteria | 3129 |
| 175 | Ga0373935_0626896 | 3300035692 | Bacteria | 788 |
| 176 | Ga0373927_0001766 | 3300035695 | Bacteria | 16139 |
| 177 | Ga0373927_0206577 | 3300035695 | Bacteria | 1290 |
| 178 | Ga0373927_0598485 | 3300035695 | Bacteria | 729 |
| 179 | Ga0373933_0164154 | 3300035724 | Bacteria | 1412 |
| 180 | Ga0373947_0002871 | 3300035725 | Bacteria | 10298 |
| 181 | Ga0373947_0071892 | 3300035725 | Bacteria | 2123 |
| 182 | Ga0373947_0133032 | 3300035725 | Bacteria | 1589 |
| 183 | Ga0373947_0478335 | 3300035725 | Bacteria | 845 |
| 184 | Ga0373937_0063946 | 3300036401 | Bacteria | 3384 |
| 185 | Ga0373937_0095703 | 3300036401 | Bacteria | 2753 |
| 186 | Ga0373937_0588431 | 3300036401 | Bacteria | 1056 |
| 187 | Ga0373937_0692448 | 3300036401 | Bacteria | 965 |
| 188 | Ga0373937_1117144 | 3300036401 | Bacteria | 737 |
| 189 | Ga0373925_0017310 | 3300037068 | Bacteria | 5223 |
| 190 | Ga0373925_0080673 | 3300037068 | Bacteria | 2473 |
| 191 | Ga0373925_0242607 | 3300037068 | Bacteria | 1443 |
| 192 | Ga0395898_0316152 | 3300037466 | Bacteria | 1490 |
| 193 | Ga0436364_0594358 | 3300037853 | Bacteria | 2063 |
| 194 | Ga0436364_1360907 | 3300037853 | Bacteria | 661 |
| 195 | Ga0436365_0476333 | 3300039437 | Bacteria | 1419 |
| 196 | Ga0436365_1210337 | 3300039437 | Bacteria | 1003 |
| 197 | Ga0436360_0545165 | 3300039438 | Bacteria | 1601 |
| 198 | Ga0436360_1233965 | 3300039438 | Bacteria | 5184 |
| 199 | Ga0436363_0793788 | 3300039450 | Bacteria | 742 |
| 200 | Ga0466966_0142494 | 3300044684 | Bacteria | 1464 |
| 201 | Ga0466963_0015411 | 3300044694 | Bacteria | 4733 |
| 202 | Ga0466957_0299435 | 3300044842 | Bacteria | 1080 |
| 203 | Ga0466959_0279419 | 3300045049 | Bacteria | 1146 |
| 204 | Ga0466958_0021877 | 3300045836 | Bacteria | 3740 |
| 205 | Ga0466967_0620663 | 3300045976 | Bacteria | 1068 |
| 206 | Ga0495592_0077481 | 3300046454 | Bacteria | 2410 |
| 207 | Ga0495592_0095818 | 3300046454 | Bacteria | 2122 |
| 208 | Ga0495592_0600051 | 3300046454 | Bacteria | 671 |
| 209 | Ga0495603_0220725 | 3300046455 | Bacteria | 1094 |
| 210 | Ga0495629_0093697 | 3300046459 | Bacteria | 2096 |
| 211 | Ga0495629_0373456 | 3300046459 | Bacteria | 971 |
| 212 | Ga0495629_0606838 | 3300046459 | Bacteria | 731 |
| 213 | Ga0495651_0015400 | 3300046462 | Bacteria | 5913 |
| 214 | Ga0495651_0044854 | 3300046462 | Bacteria | 3426 |
| 215 | Ga0495653_0305642 | 3300046463 | Bacteria | 1036 |
| 216 | Ga0495653_0779275 | 3300046463 | Bacteria | 576 |
| 217 | Ga0495580_0038317 | 3300046472 | Bacteria | 3434 |
| 218 | Ga0495580_0053242 | 3300046472 | Bacteria | 2857 |
| 219 | Ga0495580_1072733 | 3300046472 | Bacteria | 511 |
| 220 | Ga0495582_0382519 | 3300046473 | Bacteria | 811 |
| 221 | Ga0495582_0663338 | 3300046473 | Bacteria | 604 |
| 222 | Ga0495639_0029572 | 3300046475 | Bacteria | 2432 |
| 223 | Ga0495639_0085685 | 3300046475 | Bacteria | 1473 |
| 224 | Ga0495662_0016225 | 3300046476 | Bacteria | 3611 |
| 225 | Ga0495662_0038210 | 3300046476 | Bacteria | 2320 |
| 226 | Ga0495664_0035255 | 3300046477 | Bacteria | 2945 |
| 227 | Ga0495664_0069671 | 3300046477 | Bacteria | 2100 |
| 228 | Ga0495664_0306346 | 3300046477 | Bacteria | 959 |
| 229 | Ga0495584_0100714 | 3300046491 | Bacteria | 1460 |
| 230 | Ga0495585_0152891 | 3300046492 | Bacteria | 1202 |
| 231 | Ga0495608_0043324 | 3300046511 | Bacteria | 3007 |
| 232 | Ga0495608_0075560 | 3300046511 | Bacteria | 2196 |
| 233 | Ga0495618_0116511 | 3300046514 | Bacteria | 1711 |
| 234 | Ga0495618_0323380 | 3300046514 | Bacteria | 955 |
| 235 | Ga0495618_0444071 | 3300046514 | Bacteria | 788 |
| 236 | Ga0495628_0041335 | 3300046516 | Bacteria | 3680 |
| 237 | Ga0495628_0099373 | 3300046516 | Bacteria | 2247 |
| 238 | Ga0495628_0346525 | 3300046516 | Bacteria | 1093 |
| 239 | Ga0495630_0002779 | 3300046517 | Bacteria | 12146 |
| 240 | Ga0495666_0039494 | 3300046526 | Bacteria | 2291 |
| 241 | Ga0495652_0103738 | 3300046529 | Bacteria | 2301 |
| 242 | Ga0495652_0114331 | 3300046529 | Bacteria | 2165 |
| 243 | Ga0495652_0122315 | 3300046529 | Bacteria | 2073 |
| 244 | Ga0495665_0076905 | 3300046531 | Bacteria | 1756 |
| 245 | Ga0495640_0045019 | 3300046533 | Bacteria | 3064 |
| 246 | Ga0495640_0051074 | 3300046533 | Bacteria | 2844 |
| 247 | Ga0495640_0131478 | 3300046533 | Bacteria | 1620 |
| 248 | Ga0495640_0177405 | 3300046533 | Bacteria | 1359 |
| 249 | Ga0495640_0261034 | 3300046533 | Bacteria | 1082 |
| 250 | Ga0495640_0267447 | 3300046533 | Bacteria | 1067 |
| 251 | Ga0495586_0095461 | 3300046535 | Bacteria | 1646 |
| 252 | Ga0495587_0192732 | 3300046536 | Unclassified | 1154 |
| 253 | Ga0495645_0053192 | 3300046543 | Bacteria | 2944 |
| 254 | Ga0495645_0528481 | 3300046543 | Bacteria | 734 |
| 255 | Ga0495667_0561301 | 3300046559 | Bacteria | 713 |
| 256 | Ga0495634_0013848 | 3300046642 | Bacteria | 5827 |
| 257 | Ga0495634_0095873 | 3300046642 | Bacteria | 1921 |
| 258 | Ga0495634_0107286 | 3300046642 | Bacteria | 1799 |
| 259 | Ga0495635_0020897 | 3300046663 | Bacteria | 4561 |
| 260 | Ga0495657_0197668 | 3300046675 | Bacteria | 1227 |
| 261 | Ga0495623_0033947 | 3300046679 | Bacteria | 3273 |
| 262 | Ga0495623_0052526 | 3300046679 | Bacteria | 2575 |
| 263 | Ga0495646_0488210 | 3300046680 | Bacteria | 633 |
| 264 | Ga0495647_0141836 | 3300046681 | Bacteria | 1025 |
| 265 | Ga0495613_0018442 | 3300046689 | Bacteria | 5203 |
| 266 | Ga0495613_0308936 | 3300046689 | Bacteria | 1093 |
| 267 | Ga0495613_0364099 | 3300046689 | Unclassified | 991 |
| 268 | Ga0495624_0002686 | 3300046690 | Bacteria | 13404 |
| 269 | Ga0495624_0137081 | 3300046690 | Bacteria | 1500 |
| 270 | Ga0495624_0966226 | 3300046690 | Bacteria | 500 |
| 271 | Ga0495600_0126624 | 3300046809 | Bacteria | 1661 |
| 272 | Ga0495581_0005861 | 3300047315 | Bacteria | 7123 |
| 273 | Ga0495604_0041623 | 3300047317 | Bacteria | 3603 |
| 274 | Ga0495604_0137507 | 3300047317 | Bacteria | 1749 |
| 275 | Ga0495674_0123837 | 3300047319 | Bacteria | 2182 |
| 276 | Ga0495674_0427347 | 3300047319 | Bacteria | 1067 |
| 277 | Ga0495676_0064315 | 3300047321 | Bacteria | 2854 |
| 278 | Ga0495680_0006961 | 3300047322 | Bacteria | 10433 |
| 279 | Ga0495680_0235281 | 3300047322 | Bacteria | 1303 |
| 280 | Ga0495675_0011220 | 3300047444 | Bacteria | 5620 |
| 281 | Ga0495675_0014592 | 3300047444 | Bacteria | 4967 |
| 282 | Ga0495675_0505223 | 3300047444 | Bacteria | 694 |
| 283 | Ga0495675_0593720 | 3300047444 | Bacteria | 628 |
| 284 | Ga0495673_0323058 | 3300047469 | Bacteria | 549 |
| 285 | Ga0495684_0005055 | 3300047471 | Bacteria | 10300 |
| 286 | Ga0495593_0014818 | 3300047673 | Bacteria | 4429 |
| 287 | Ga0495602_0004414 | 3300048088 | Bacteria | 14679 |
| 288 | Ga0495602_0046983 | 3300048088 | Bacteria | 3894 |
| 289 | Ga0495602_0341172 | 3300048088 | Unclassified | 1084 |
| 290 | Ga0496100_0670970 | 3300048903 | Bacteria | 808 |
| 291 | Ga0496102_1246423 | 3300048905 | Unclassified | 663 |
| 292 | Ga0496104_0014012 | 3300048907 | Bacteria | 7234 |
| 293 | Ga0496104_0574699 | 3300048907 | Bacteria | 1038 |
| 294 | Ga0496105_0010713 | 3300048908 | Bacteria | 7215 |
| 295 | Ga0496111_1251315 | 3300048914 | Bacteria | 524 |
| 296 | Ga0496114_0086461 | 3300048917 | Bacteria | 2657 |
| 297 | Ga0496115_0033813 | 3300048918 | Bacteria | 4038 |
| 298 | nmdc:mga05p37_94846_c1 | 3300050507 | Bacteria | 3676 |
| 299 | nmdc:mga06r32_327591_c1 | 3300050510 | Bacteria | 1517 |
| 300 | nmdc:mga0n895_1497072_c1 | 3300050512 | Bacteria | 641 |
| 301 | Ga0495601_0127585 | 3300053077 | Bacteria | 1655 |
| 302 | Ga0495601_0249803 | 3300053077 | Bacteria | 1158 |
| 303 | Ga0495601_0366750 | 3300053077 | Bacteria | 935 |
| 304 | Ga0495601_0368687 | 3300053077 | Bacteria | 933 |
| 305 | Ga0495601_0461966 | 3300053077 | Bacteria | 821 |
| 306 | Ga0495612_0067505 | 3300053078 | Bacteria | 1487 |
| 307 | Ga0495612_0098214 | 3300053078 | Bacteria | 1245 |
| 308 | Ga0495612_0128999 | 3300053078 | Bacteria | 1092 |
| 309 | Ga0495595_0105255 | 3300053084 | Bacteria | 1364 |
| 310 | Ga0495595_0184505 | 3300053084 | Bacteria | 1035 |
| 311 | Ga0495595_0254527 | 3300053084 | Bacteria | 880 |
| 312 | Ga0495619_0087367 | 3300053085 | Bacteria | 2108 |
| 313 | Ga0495619_0446786 | 3300053085 | Bacteria | 891 |
| 314 | Ga0495619_0465118 | 3300053085 | Bacteria | 871 |
| 315 | Ga0500655_011400 | 3300053133 | Bacteria | 1610 |
| 316 | Ga0500636_0170228 | 3300053177 | Bacteria | 1179 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046454 | Ga0495592_0077481 | Ga0495592_0077481_1215_1646 | 125 |
| 2 | 3300046462 | Ga0495651_0044854 | Ga0495651_0044854_772_1203 | 125 |
| 3 | 3300046477 | Ga0495664_0035255 | Ga0495664_0035255_560_991 | 125 |
| 4 | 3300046511 | Ga0495608_0075560 | Ga0495608_0075560_796_1227 | 125 |
| 5 | 3300046514 | Ga0495618_0444071 | Ga0495618_0444071_140_571 | 125 |
| 6 | 3300046516 | Ga0495628_0041335 | Ga0495628_0041335_1214_1645 | 125 |
| 7 | 3300046529 | Ga0495652_0114331 | Ga0495652_0114331_1689_2120 | 125 |
| 8 | 3300046533 | Ga0495640_0051074 | Ga0495640_0051074_36_467 | 125 |
| 9 | 3300046559 | Ga0495667_0561301 | Ga0495667_0561301_245_676 | 125 |
| 10 | 3300046642 | Ga0495634_0107286 | Ga0495634_0107286_535_966 | 125 |
| 11 | 3300046663 | Ga0495635_0020897 | Ga0495635_0020897_3032_3463 | 125 |
| 12 | 3300046679 | Ga0495623_0052526 | Ga0495623_0052526_177_608 | 125 |
| 13 | 3300046809 | Ga0495600_0126624 | Ga0495600_0126624_39_470 | 125 |
| 14 | 3300047317 | Ga0495604_0041623 | Ga0495604_0041623_3006_3437 | 125 |
| 15 | 3300047322 | Ga0495680_0006961 | Ga0495680_0006961_8460_8891 | 125 |
| 16 | 3300047444 | Ga0495675_0014592 | Ga0495675_0014592_2001_2432 | 125 |
| 17 | 3300048088 | Ga0495602_0046983 | Ga0495602_0046983_785_1216 | 125 |
| 18 | 3300046690 | Ga0495624_0966226 | Ga0495624_0966226_24_443 | 128 |
| 19 | 3300053078 | Ga0495612_0128999 | Ga0495612_0128999_47_466 | 128 |
| 20 | 3300005439 | Ga0070711_100011865 | Ga0070711_1000118651 | 132 |
| 21 | 3300021358 | Ga0213873_10232320 | Ga0213873_102323201 | 132 |
| 22 | 3300021441 | Ga0213871_10077481 | Ga0213871_100774812 | 132 |
| 23 | 3300025909 | Ga0207705_10718638 | Ga0207705_107186382 | 132 |
| 24 | 3300031730 | Ga0307516_10182595 | Ga0307516_101825952 | 132 |
| 25 | 3300035118 | Ga0373954_0220597 | Ga0373954_0220597_246_662 | 132 |
| 26 | 3300035119 | Ga0373956_0243079 | Ga0373956_0243079_29_445 | 132 |
| 27 | 3300035172 | Ga0373955_0267641 | Ga0373955_0267641_302_718 | 132 |
| 28 | 3300035692 | Ga0373935_0626896 | Ga0373935_0626896_28_444 | 132 |
| 29 | 3300035724 | Ga0373933_0164154 | Ga0373933_0164154_341_757 | 132 |
| 30 | 3300046473 | Ga0495582_0663338 | Ga0495582_0663338_103_519 | 132 |
| 31 | 3300047469 | Ga0495673_0323058 | Ga0495673_0323058_114_512 | 132 |
| 32 | 3300048903 | Ga0496100_0670970 | Ga0496100_0670970_244_660 | 132 |
| 33 | 3300048907 | Ga0496104_0014012 | Ga0496104_0014012_5615_6031 | 132 |
| 34 | 3300048908 | Ga0496105_0010713 | Ga0496105_0010713_2181_2597 | 132 |
| 35 | 3300048917 | Ga0496114_0086461 | Ga0496114_0086461_960_1376 | 132 |
| 36 | 3300048918 | Ga0496115_0033813 | Ga0496115_0033813_2469_2885 | 132 |
| 37 | 3300053077 | Ga0495601_0461966 | Ga0495601_0461966_256_672 | 132 |
| 38 | 3300053177 | Ga0500636_0170228 | Ga0500636_0170228_82_480 | 132 |
| 39 | 3300005435 | Ga0070714_100102980 | Ga0070714_1001029803 | 133 |
| 40 | 3300005458 | Ga0070681_10067305 | Ga0070681_100673052 | 133 |
| 41 | 3300005530 | Ga0070679_101051005 | Ga0070679_1010510051 | 133 |
| 42 | 3300006028 | Ga0070717_10101118 | Ga0070717_101011182 | 133 |
| 43 | 3300009093 | Ga0105240_10045016 | Ga0105240_100450165 | 133 |
| 44 | 3300014497 | Ga0182008_10140438 | Ga0182008_101404382 | 133 |
| 45 | 3300025898 | Ga0207692_10989656 | Ga0207692_109896561 | 133 |
| 46 | 3300025912 | Ga0207707_10373768 | Ga0207707_103737682 | 133 |
| 47 | 3300030760 | Ga0265762_1199848 | Ga0265762_11998481 | 133 |
| 48 | 3300044684 | Ga0466966_0142494 | Ga0466966_0142494_1028_1432 | 133 |
| 49 | 3300044694 | Ga0466963_0015411 | Ga0466963_0015411_3247_3651 | 133 |
| 50 | 3300044842 | Ga0466957_0299435 | Ga0466957_0299435_225_629 | 133 |
| 51 | 3300045049 | Ga0466959_0279419 | Ga0466959_0279419_185_589 | 133 |
| 52 | 3300045836 | Ga0466958_0021877 | Ga0466958_0021877_3066_3470 | 133 |
| 53 | 3300045976 | Ga0466967_0620663 | Ga0466967_0620663_325_729 | 133 |
| 54 | 3300046514 | Ga0495618_0323380 | Ga0495618_0323380_404_808 | 133 |
| 55 | 3300046529 | Ga0495652_0103738 | Ga0495652_0103738_597_1001 | 133 |
| 56 | 3300046533 | Ga0495640_0177405 | Ga0495640_0177405_626_1030 | 133 |
| 57 | 3300046536 | Ga0495587_0192732 | Ga0495587_0192732_566_970 | 133 |
| 58 | 3300046680 | Ga0495646_0488210 | Ga0495646_0488210_91_495 | 133 |
| 59 | 3300053077 | Ga0495601_0127585 | Ga0495601_0127585_328_732 | 133 |
| 60 | 3300005329 | Ga0070683_100166454 | Ga0070683_1001664541 | 134 |
| 61 | 3300005331 | Ga0070670_101892136 | Ga0070670_1018921361 | 134 |
| 62 | 3300005336 | Ga0070680_100667308 | Ga0070680_1006673082 | 134 |
| 63 | 3300005344 | Ga0070661_100109160 | Ga0070661_1001091602 | 134 |
| 64 | 3300005356 | Ga0070674_100313906 | Ga0070674_1003139063 | 134 |
| 65 | 3300005364 | Ga0070673_100237321 | Ga0070673_1002373213 | 134 |
| 66 | 3300005367 | Ga0070667_100588487 | Ga0070667_1005884872 | 134 |
| 67 | 3300005434 | Ga0070709_10371169 | Ga0070709_103711692 | 134 |
| 68 | 3300005435 | Ga0070714_100819965 | Ga0070714_1008199652 | 134 |
| 69 | 3300005435 | Ga0070714_101919103 | Ga0070714_1019191031 | 134 |
| 70 | 3300005437 | Ga0070710_10037047 | Ga0070710_100370472 | 134 |
| 71 | 3300005437 | Ga0070710_10583952 | Ga0070710_105839522 | 134 |
| 72 | 3300005439 | Ga0070711_100157120 | Ga0070711_1001571202 | 134 |
| 73 | 3300005439 | Ga0070711_100673372 | Ga0070711_1006733721 | 134 |
| 74 | 3300005455 | Ga0070663_100806776 | Ga0070663_1008067761 | 134 |
| 75 | 3300005456 | Ga0070678_100762164 | Ga0070678_1007621641 | 134 |
| 76 | 3300005456 | Ga0070678_100852769 | Ga0070678_1008527692 | 134 |
| 77 | 3300005458 | Ga0070681_10041840 | Ga0070681_100418403 | 134 |
| 78 | 3300005459 | Ga0068867_100068641 | Ga0068867_1000686412 | 134 |
| 79 | 3300005467 | Ga0070706_100335879 | Ga0070706_1003358791 | 134 |
| 80 | 3300005530 | Ga0070679_100471312 | Ga0070679_1004713122 | 134 |
| 81 | 3300005543 | Ga0070672_100255467 | Ga0070672_1002554672 | 134 |
| 82 | 3300005548 | Ga0070665_100760710 | Ga0070665_1007607102 | 134 |
| 83 | 3300005563 | Ga0068855_100108634 | Ga0068855_1001086343 | 134 |
| 84 | 3300005564 | Ga0070664_100736710 | Ga0070664_1007367102 | 134 |
| 85 | 3300005614 | Ga0068856_100231826 | Ga0068856_1002318262 | 134 |
| 86 | 3300005615 | Ga0070702_100481222 | Ga0070702_1004812221 | 134 |
| 87 | 3300005616 | Ga0068852_100836651 | Ga0068852_1008366512 | 134 |
| 88 | 3300005617 | Ga0068859_101466090 | Ga0068859_1014660901 | 134 |
| 89 | 3300005718 | Ga0068866_10682002 | Ga0068866_106820021 | 134 |
| 90 | 3300005719 | Ga0068861_101242102 | Ga0068861_1012421022 | 134 |
| 91 | 3300005719 | Ga0068861_101893530 | Ga0068861_1018935301 | 134 |
| 92 | 3300005842 | Ga0068858_100498578 | Ga0068858_1004985782 | 134 |
| 93 | 3300005843 | Ga0068860_100343255 | Ga0068860_1003432552 | 134 |
| 94 | 3300005843 | Ga0068860_100375555 | Ga0068860_1003755553 | 134 |
| 95 | 3300005843 | Ga0068860_100545629 | Ga0068860_1005456292 | 134 |
| 96 | 3300006028 | Ga0070717_10084825 | Ga0070717_100848253 | 134 |
| 97 | 3300006028 | Ga0070717_11662964 | Ga0070717_116629641 | 134 |
| 98 | 3300006173 | Ga0070716_100311923 | Ga0070716_1003119231 | 134 |
| 99 | 3300006175 | Ga0070712_100060768 | Ga0070712_1000607683 | 134 |
| 100 | 3300006237 | Ga0097621_100263648 | Ga0097621_1002636482 | 134 |
| 101 | 3300006237 | Ga0097621_100589985 | Ga0097621_1005899852 | 134 |
| 102 | 3300006237 | Ga0097621_101508505 | Ga0097621_1015085052 | 134 |
| 103 | 3300006358 | Ga0068871_100135132 | Ga0068871_1001351322 | 134 |
| 104 | 3300006358 | Ga0068871_100162696 | Ga0068871_1001626962 | 134 |
| 105 | 3300006358 | Ga0068871_100170269 | Ga0068871_1001702692 | 134 |
| 106 | 3300006358 | Ga0068871_101586852 | Ga0068871_1015868521 | 134 |
| 107 | 3300006844 | Ga0075428_100113840 | Ga0075428_1001138402 | 134 |
| 108 | 3300006844 | Ga0075428_101220244 | Ga0075428_1012202442 | 134 |
| 109 | 3300006847 | Ga0075431_100396612 | Ga0075431_1003966122 | 134 |
| 110 | 3300006871 | Ga0075434_101384216 | Ga0075434_1013842161 | 134 |
| 111 | 3300006881 | Ga0068865_100660512 | Ga0068865_1006605121 | 134 |
| 112 | 3300006931 | Ga0097620_101466462 | Ga0097620_1014664621 | 134 |
| 113 | 3300009093 | Ga0105240_10377767 | Ga0105240_103777672 | 134 |
| 114 | 3300009094 | Ga0111539_11062516 | Ga0111539_110625162 | 134 |
| 115 | 3300009174 | Ga0105241_10137024 | Ga0105241_101370242 | 134 |
| 116 | 3300009176 | Ga0105242_10013601 | Ga0105242_100136012 | 134 |
| 117 | 3300009176 | Ga0105242_10115356 | Ga0105242_101153563 | 134 |
| 118 | 3300009176 | Ga0105242_10403284 | Ga0105242_104032842 | 134 |
| 119 | 3300009177 | Ga0105248_10495704 | Ga0105248_104957042 | 134 |
| 120 | 3300009553 | Ga0105249_10767963 | Ga0105249_107679631 | 134 |
| 121 | 3300010375 | Ga0105239_10310971 | Ga0105239_103109712 | 134 |
| 122 | 3300011119 | Ga0105246_10117470 | Ga0105246_101174703 | 134 |
| 123 | 3300013105 | Ga0157369_10007235 | Ga0157369_100072353 | 134 |
| 124 | 3300013296 | Ga0157374_10191078 | Ga0157374_101910781 | 134 |
| 125 | 3300013306 | Ga0163162_10115275 | Ga0163162_101152753 | 134 |
| 126 | 3300013306 | Ga0163162_10220421 | Ga0163162_102204212 | 134 |
| 127 | 3300013306 | Ga0163162_10277154 | Ga0163162_102771542 | 134 |
| 128 | 3300013306 | Ga0163162_12056115 | Ga0163162_120561152 | 134 |
| 129 | 3300013307 | Ga0157372_11570178 | Ga0157372_115701781 | 134 |
| 130 | 3300013308 | Ga0157375_10036433 | Ga0157375_100364333 | 134 |
| 131 | 3300013308 | Ga0157375_10558286 | Ga0157375_105582862 | 134 |
| 132 | 3300014325 | Ga0163163_11106508 | Ga0163163_111065081 | 134 |
| 133 | 3300014325 | Ga0163163_11573650 | Ga0163163_115736502 | 134 |
| 134 | 3300014968 | Ga0157379_10685687 | Ga0157379_106856872 | 134 |
| 135 | 3300017792 | Ga0163161_10156186 | Ga0163161_101561863 | 134 |
| 136 | 3300021377 | Ga0213874_10451160 | Ga0213874_104511601 | 134 |
| 137 | 3300021388 | Ga0213875_10000642 | Ga0213875_100006425 | 134 |
| 138 | 3300021388 | Ga0213875_10047589 | Ga0213875_100475893 | 134 |
| 139 | 3300024227 | Ga0228598_1005032 | Ga0228598_10050322 | 134 |
| 140 | 3300025899 | Ga0207642_10048724 | Ga0207642_100487243 | 134 |
| 141 | 3300025899 | Ga0207642_10608353 | Ga0207642_106083532 | 134 |
| 142 | 3300025904 | Ga0207647_10042807 | Ga0207647_100428073 | 134 |
| 143 | 3300025905 | Ga0207685_10031098 | Ga0207685_100310983 | 134 |
| 144 | 3300025906 | Ga0207699_10365494 | Ga0207699_103654942 | 134 |
| 145 | 3300025907 | Ga0207645_10763620 | Ga0207645_107636201 | 134 |
| 146 | 3300025911 | Ga0207654_10048012 | Ga0207654_100480123 | 134 |
| 147 | 3300025912 | Ga0207707_10855515 | Ga0207707_108555152 | 134 |
| 148 | 3300025913 | Ga0207695_10102772 | Ga0207695_101027722 | 134 |
| 149 | 3300025914 | Ga0207671_10425072 | Ga0207671_104250722 | 134 |
| 150 | 3300025915 | Ga0207693_10562673 | Ga0207693_105626732 | 134 |
| 151 | 3300025916 | Ga0207663_10081576 | Ga0207663_100815764 | 134 |
| 152 | 3300025917 | Ga0207660_10891286 | Ga0207660_108912862 | 134 |
| 153 | 3300025919 | Ga0207657_11486369 | Ga0207657_114863691 | 134 |
| 154 | 3300025920 | Ga0207649_10320032 | Ga0207649_103200321 | 134 |
| 155 | 3300025924 | Ga0207694_10190701 | Ga0207694_101907012 | 134 |
| 156 | 3300025925 | Ga0207650_10754227 | Ga0207650_107542272 | 134 |
| 157 | 3300025925 | Ga0207650_11701505 | Ga0207650_117015051 | 134 |
| 158 | 3300025928 | Ga0207700_10559886 | Ga0207700_105598862 | 134 |
| 159 | 3300025933 | Ga0207706_10130181 | Ga0207706_101301813 | 134 |
| 160 | 3300025934 | Ga0207686_10180293 | Ga0207686_101802932 | 134 |
| 161 | 3300025934 | Ga0207686_10481854 | Ga0207686_104818542 | 134 |
| 162 | 3300025937 | Ga0207669_10663956 | Ga0207669_106639561 | 134 |
| 163 | 3300025940 | Ga0207691_10902069 | Ga0207691_109020692 | 134 |
| 164 | 3300025942 | Ga0207689_10582567 | Ga0207689_105825672 | 134 |
| 165 | 3300025944 | Ga0207661_10382754 | Ga0207661_103827542 | 134 |
| 166 | 3300025945 | Ga0207679_10385622 | Ga0207679_103856222 | 134 |
| 167 | 3300025949 | Ga0207667_10196656 | Ga0207667_101966562 | 134 |
| 168 | 3300025960 | Ga0207651_10206555 | Ga0207651_102065553 | 134 |
| 169 | 3300025986 | Ga0207658_10720368 | Ga0207658_107203682 | 134 |
| 170 | 3300026023 | Ga0207677_10164935 | Ga0207677_101649352 | 134 |
| 171 | 3300026035 | Ga0207703_12046309 | Ga0207703_120463091 | 134 |
| 172 | 3300026078 | Ga0207702_10066447 | Ga0207702_100664473 | 134 |
| 173 | 3300026078 | Ga0207702_10180071 | Ga0207702_101800712 | 134 |
| 174 | 3300026078 | Ga0207702_11312170 | Ga0207702_113121702 | 134 |
| 175 | 3300026089 | Ga0207648_10014388 | Ga0207648_100143883 | 134 |
| 176 | 3300026121 | Ga0207683_10012819 | Ga0207683_100128192 | 134 |
| 177 | 3300026121 | Ga0207683_10365600 | Ga0207683_103656001 | 134 |
| 178 | 3300028381 | Ga0268264_10192104 | Ga0268264_101921042 | 134 |
| 179 | 3300028556 | Ga0265337_1000550 | Ga0265337_10005505 | 134 |
| 180 | 3300028573 | Ga0265334_10000841 | Ga0265334_100008416 | 134 |
| 181 | 3300028666 | Ga0265336_10244478 | Ga0265336_102444781 | 134 |
| 182 | 3300028800 | Ga0265338_10037842 | Ga0265338_100378422 | 134 |
| 183 | 3300028800 | Ga0265338_10041127 | Ga0265338_100411274 | 134 |
| 184 | 3300028800 | Ga0265338_10975281 | Ga0265338_109752811 | 134 |
| 185 | 3300030760 | Ga0265762_1041721 | Ga0265762_10417212 | 134 |
| 186 | 3300030763 | Ga0265763_1002186 | Ga0265763_10021862 | 134 |
| 187 | 3300030879 | Ga0265765_1020147 | Ga0265765_10201471 | 134 |
| 188 | 3300031090 | Ga0265760_10139410 | Ga0265760_101394102 | 134 |
| 189 | 3300031235 | Ga0265330_10314726 | Ga0265330_103147261 | 134 |
| 190 | 3300031241 | Ga0265325_10316232 | Ga0265325_103162321 | 134 |
| 191 | 3300031242 | Ga0265329_10137903 | Ga0265329_101379032 | 134 |
| 192 | 3300031249 | Ga0265339_10001185 | Ga0265339_100011856 | 134 |
| 193 | 3300031249 | Ga0265339_10279259 | Ga0265339_102792592 | 134 |
| 194 | 3300031344 | Ga0265316_10079555 | Ga0265316_100795552 | 134 |
| 195 | 3300031595 | Ga0265313_10003372 | Ga0265313_1000337213 | 134 |
| 196 | 3300031595 | Ga0265313_10005442 | Ga0265313_100054423 | 134 |
| 197 | 3300031595 | Ga0265313_10033982 | Ga0265313_100339823 | 134 |
| 198 | 3300031711 | Ga0265314_10045210 | Ga0265314_100452102 | 134 |
| 199 | 3300031711 | Ga0265314_10111555 | Ga0265314_101115552 | 134 |
| 200 | 3300031712 | Ga0265342_10009324 | Ga0265342_100093247 | 134 |
| 201 | 3300031712 | Ga0265342_10034393 | Ga0265342_100343932 | 134 |
| 202 | 3300035089 | Ga0373944_0084469 | Ga0373944_0084469_247_654 | 134 |
| 203 | 3300035111 | Ga0373923_0119702 | Ga0373923_0119702_30_437 | 134 |
| 204 | 3300035116 | Ga0373945_0051757 | Ga0373945_0051757_238_669 | 134 |
| 205 | 3300035116 | Ga0373945_0154363 | Ga0373945_0154363_150_557 | 134 |
| 206 | 3300035117 | Ga0373953_0051566 | Ga0373953_0051566_1170_1574 | 134 |
| 207 | 3300035117 | Ga0373953_0453347 | Ga0373953_0453347_78_485 | 134 |
| 208 | 3300035118 | Ga0373954_0699387 | Ga0373954_0699387_20_451 | 134 |
| 209 | 3300035119 | Ga0373956_0192239 | Ga0373956_0192239_503_907 | 134 |
| 210 | 3300035119 | Ga0373956_0313678 | Ga0373956_0313678_165_572 | 134 |
| 211 | 3300035120 | Ga0373957_0044113 | Ga0373957_0044113_436_840 | 134 |
| 212 | 3300035120 | Ga0373957_0118445 | Ga0373957_0118445_631_1038 | 134 |
| 213 | 3300035170 | Ga0373943_0000447 | Ga0373943_0000447_9377_9784 | 134 |
| 214 | 3300035171 | Ga0373946_0001610 | Ga0373946_0001610_4885_5292 | 134 |
| 215 | 3300035171 | Ga0373946_0261557 | Ga0373946_0261557_297_701 | 134 |
| 216 | 3300035692 | Ga0373935_0035097 | Ga0373935_0035097_1298_1705 | 134 |
| 217 | 3300035695 | Ga0373927_0001766 | Ga0373927_0001766_3604_4011 | 134 |
| 218 | 3300035695 | Ga0373927_0206577 | Ga0373927_0206577_689_1096 | 134 |
| 219 | 3300035695 | Ga0373927_0598485 | Ga0373927_0598485_23_430 | 134 |
| 220 | 3300035725 | Ga0373947_0002871 | Ga0373947_0002871_1712_2119 | 134 |
| 221 | 3300035725 | Ga0373947_0071892 | Ga0373947_0071892_497_904 | 134 |
| 222 | 3300035725 | Ga0373947_0133032 | Ga0373947_0133032_1018_1425 | 134 |
| 223 | 3300035725 | Ga0373947_0478335 | Ga0373947_0478335_336_767 | 134 |
| 224 | 3300036401 | Ga0373937_0063946 | Ga0373937_0063946_2225_2629 | 134 |
| 225 | 3300036401 | Ga0373937_0095703 | Ga0373937_0095703_782_1189 | 134 |
| 226 | 3300036401 | Ga0373937_0588431 | Ga0373937_0588431_555_959 | 134 |
| 227 | 3300036401 | Ga0373937_0692448 | Ga0373937_0692448_12_416 | 134 |
| 228 | 3300036401 | Ga0373937_1117144 | Ga0373937_1117144_301_705 | 134 |
| 229 | 3300037068 | Ga0373925_0017310 | Ga0373925_0017310_3340_3747 | 134 |
| 230 | 3300037068 | Ga0373925_0080673 | Ga0373925_0080673_896_1303 | 134 |
| 231 | 3300037068 | Ga0373925_0242607 | Ga0373925_0242607_131_538 | 134 |
| 232 | 3300037466 | Ga0395898_0316152 | Ga0395898_0316152_504_911 | 134 |
| 233 | 3300037853 | Ga0436364_0594358 | Ga0436364_0594358_358_762 | 134 |
| 234 | 3300037853 | Ga0436364_1360907 | Ga0436364_1360907_58_462 | 134 |
| 235 | 3300039437 | Ga0436365_0476333 | Ga0436365_0476333_658_1065 | 134 |
| 236 | 3300039437 | Ga0436365_1210337 | Ga0436365_1210337_298_711 | 134 |
| 237 | 3300039438 | Ga0436360_0545165 | Ga0436360_0545165_459_872 | 134 |
| 238 | 3300039438 | Ga0436360_1233965 | Ga0436360_1233965_703_1134 | 134 |
| 239 | 3300039450 | Ga0436363_0793788 | Ga0436363_0793788_188_595 | 134 |
| 240 | 3300046454 | Ga0495592_0095818 | Ga0495592_0095818_367_774 | 134 |
| 241 | 3300046454 | Ga0495592_0600051 | Ga0495592_0600051_99_506 | 134 |
| 242 | 3300046455 | Ga0495603_0220725 | Ga0495603_0220725_229_636 | 134 |
| 243 | 3300046459 | Ga0495629_0093697 | Ga0495629_0093697_387_794 | 134 |
| 244 | 3300046459 | Ga0495629_0373456 | Ga0495629_0373456_219_626 | 134 |
| 245 | 3300046459 | Ga0495629_0606838 | Ga0495629_0606838_24_431 | 134 |
| 246 | 3300046462 | Ga0495651_0015400 | Ga0495651_0015400_282_689 | 134 |
| 247 | 3300046463 | Ga0495653_0305642 | Ga0495653_0305642_59_466 | 134 |
| 248 | 3300046463 | Ga0495653_0779275 | Ga0495653_0779275_72_479 | 134 |
| 249 | 3300046472 | Ga0495580_0038317 | Ga0495580_0038317_2114_2521 | 134 |
| 250 | 3300046472 | Ga0495580_0053242 | Ga0495580_0053242_784_1188 | 134 |
| 251 | 3300046472 | Ga0495580_1072733 | Ga0495580_1072733_61_468 | 134 |
| 252 | 3300046473 | Ga0495582_0382519 | Ga0495582_0382519_306_713 | 134 |
| 253 | 3300046475 | Ga0495639_0029572 | Ga0495639_0029572_1682_2089 | 134 |
| 254 | 3300046475 | Ga0495639_0085685 | Ga0495639_0085685_593_1000 | 134 |
| 255 | 3300046476 | Ga0495662_0016225 | Ga0495662_0016225_1556_1963 | 134 |
| 256 | 3300046476 | Ga0495662_0038210 | Ga0495662_0038210_519_926 | 134 |
| 257 | 3300046477 | Ga0495664_0069671 | Ga0495664_0069671_289_696 | 134 |
| 258 | 3300046477 | Ga0495664_0306346 | Ga0495664_0306346_318_725 | 134 |
| 259 | 3300046491 | Ga0495584_0100714 | Ga0495584_0100714_491_898 | 134 |
| 260 | 3300046492 | Ga0495585_0152891 | Ga0495585_0152891_473_880 | 134 |
| 261 | 3300046511 | Ga0495608_0043324 | Ga0495608_0043324_665_1072 | 134 |
| 262 | 3300046514 | Ga0495618_0116511 | Ga0495618_0116511_187_591 | 134 |
| 263 | 3300046516 | Ga0495628_0099373 | Ga0495628_0099373_1376_1783 | 134 |
| 264 | 3300046516 | Ga0495628_0346525 | Ga0495628_0346525_273_680 | 134 |
| 265 | 3300046517 | Ga0495630_0002779 | Ga0495630_0002779_10121_10528 | 134 |
| 266 | 3300046526 | Ga0495666_0039494 | Ga0495666_0039494_609_1016 | 134 |
| 267 | 3300046529 | Ga0495652_0122315 | Ga0495652_0122315_262_669 | 134 |
| 268 | 3300046531 | Ga0495665_0076905 | Ga0495665_0076905_61_468 | 134 |
| 269 | 3300046533 | Ga0495640_0045019 | Ga0495640_0045019_1997_2404 | 134 |
| 270 | 3300046533 | Ga0495640_0131478 | Ga0495640_0131478_766_1197 | 134 |
| 271 | 3300046533 | Ga0495640_0261034 | Ga0495640_0261034_398_805 | 134 |
| 272 | 3300046533 | Ga0495640_0267447 | Ga0495640_0267447_197_604 | 134 |
| 273 | 3300046535 | Ga0495586_0095461 | Ga0495586_0095461_1206_1610 | 134 |
| 274 | 3300046543 | Ga0495645_0053192 | Ga0495645_0053192_1756_2163 | 134 |
| 275 | 3300046543 | Ga0495645_0528481 | Ga0495645_0528481_218_649 | 134 |
| 276 | 3300046642 | Ga0495634_0013848 | Ga0495634_0013848_4862_5269 | 134 |
| 277 | 3300046642 | Ga0495634_0095873 | Ga0495634_0095873_1080_1487 | 134 |
| 278 | 3300046675 | Ga0495657_0197668 | Ga0495657_0197668_561_968 | 134 |
| 279 | 3300046679 | Ga0495623_0033947 | Ga0495623_0033947_804_1211 | 134 |
| 280 | 3300046681 | Ga0495647_0141836 | Ga0495647_0141836_23_430 | 134 |
| 281 | 3300046689 | Ga0495613_0018442 | Ga0495613_0018442_1625_2032 | 134 |
| 282 | 3300046689 | Ga0495613_0308936 | Ga0495613_0308936_86_493 | 134 |
| 283 | 3300046689 | Ga0495613_0364099 | Ga0495613_0364099_244_651 | 134 |
| 284 | 3300046690 | Ga0495624_0002686 | Ga0495624_0002686_2315_2722 | 134 |
| 285 | 3300046690 | Ga0495624_0137081 | Ga0495624_0137081_418_825 | 134 |
| 286 | 3300047315 | Ga0495581_0005861 | Ga0495581_0005861_3024_3431 | 134 |
| 287 | 3300047317 | Ga0495604_0137507 | Ga0495604_0137507_710_1117 | 134 |
| 288 | 3300047319 | Ga0495674_0123837 | Ga0495674_0123837_1661_2092 | 134 |
| 289 | 3300047319 | Ga0495674_0427347 | Ga0495674_0427347_464_871 | 134 |
| 290 | 3300047321 | Ga0495676_0064315 | Ga0495676_0064315_1285_1692 | 134 |
| 291 | 3300047322 | Ga0495680_0235281 | Ga0495680_0235281_209_616 | 134 |
| 292 | 3300047444 | Ga0495675_0011220 | Ga0495675_0011220_2897_3304 | 134 |
| 293 | 3300047444 | Ga0495675_0505223 | Ga0495675_0505223_247_651 | 134 |
| 294 | 3300047444 | Ga0495675_0593720 | Ga0495675_0593720_214_618 | 134 |
| 295 | 3300047471 | Ga0495684_0005055 | Ga0495684_0005055_6398_6805 | 134 |
| 296 | 3300047673 | Ga0495593_0014818 | Ga0495593_0014818_2498_2905 | 134 |
| 297 | 3300048088 | Ga0495602_0004414 | Ga0495602_0004414_2048_2455 | 134 |
| 298 | 3300048088 | Ga0495602_0341172 | Ga0495602_0341172_184_591 | 134 |
| 299 | 3300048905 | Ga0496102_1246423 | Ga0496102_1246423_187_594 | 134 |
| 300 | 3300048907 | Ga0496104_0574699 | Ga0496104_0574699_403_834 | 134 |
| 301 | 3300048914 | Ga0496111_1251315 | Ga0496111_1251315_29_436 | 134 |
| 302 | 3300050507 | nmdc:mga05p37_94846_c1 | nmdc:mga05p37_94846_c1_1420_1827 | 134 |
| 303 | 3300050510 | nmdc:mga06r32_327591_c1 | nmdc:mga06r32_327591_c1_924_1331 | 134 |
| 304 | 3300050512 | nmdc:mga0n895_1497072_c1 | nmdc:mga0n895_1497072_c1_218_622 | 134 |
| 305 | 3300053077 | Ga0495601_0249803 | Ga0495601_0249803_495_902 | 134 |
| 306 | 3300053077 | Ga0495601_0366750 | Ga0495601_0366750_244_651 | 134 |
| 307 | 3300053077 | Ga0495601_0368687 | Ga0495601_0368687_477_908 | 134 |
| 308 | 3300053078 | Ga0495612_0067505 | Ga0495612_0067505_510_917 | 134 |
| 309 | 3300053078 | Ga0495612_0098214 | Ga0495612_0098214_241_648 | 134 |
| 310 | 3300053084 | Ga0495595_0105255 | Ga0495595_0105255_559_966 | 134 |
| 311 | 3300053084 | Ga0495595_0184505 | Ga0495595_0184505_554_961 | 134 |
| 312 | 3300053084 | Ga0495595_0254527 | Ga0495595_0254527_234_665 | 134 |
| 313 | 3300053085 | Ga0495619_0087367 | Ga0495619_0087367_617_1024 | 134 |
| 314 | 3300053085 | Ga0495619_0446786 | Ga0495619_0446786_255_662 | 134 |
| 315 | 3300053085 | Ga0495619_0465118 | Ga0495619_0465118_450_857 | 134 |
| 316 | 3300053133 | Ga0500655_011400 | Ga0500655_011400_304_708 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ush-assembly1.cif.gz_A | crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 | 0.9367 | 15 | 132 |
| 3ush-assembly1.cif.gz_A | crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 | 0.9291 | 15 | 132 |
| 4ioh-assembly1.cif.gz_A-2 | crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 | 0.8391 | 15 | 131 |
| 4ioh-assembly1.cif.gz_A-2 | crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 | 0.8124 | 15 | 131 |
| 5ghr-assembly2.cif.gz_D | dna replication protein | 0.5314 | 51 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ushA00 | Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 | 0.9314 | 15 | 132 | 3.30.56.110 |
| 3ushA00 | Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 | 0.9236 | 15 | 132 | 3.30.56.110 |
| 4iohA00 | Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 | 0.8516 | 17 | 131 | 3.30.56.110 |
| 4iohA00 | Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 | 0.8239 | 17 | 131 | 3.30.56.110 |
| af_K7LRE8_220_319_1.10.245.10 | Mainly Alpha;Orthogonal Bundle;MDM2;SWIB/MDM2 domain | 0.5748 | 55 | 78 | 1.10.245.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A8JYT9-F1-model_v4 | DUF2237 domain-containing protein | 1.005 | 56 | 134 |
|
| AF-A0A348WHA5-F1-model_v4 | DUF2237 domain-containing protein | 1.002 | 82 | 130 |
|
| AF-A0A160TU93-F1-model_v4 | DUF2237 domain-containing protein | 0.9963 | 52 | 134 |
|
| AF-Q0FK62-F1-model_v4 | DUF2237 domain-containing protein | 0.9962 | 59 | 130 |
|
| AF-A0A817Q9G5-F1-model_v4 | Uncharacterized protein | 0.9958 | 56 | 103 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar