F403087

General Info

Members Datasets Scaffolds Average Seq Length
315 174 630 271

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100011579|Ga0068852_1000115792
Length 310
Sequence MLLAIDIGNTNTVLGLYRLPTGTDPAPASLVADWRVTTSRHITVDEVGIILRDLFTLRQLELGQVTGVVVSSVVPPLDSTVRRAVELYCKVKPVFVEPGTRTGLPILTDNPAEVGADRIVNCVAAIDLVRTQAAAGTATIFAATPDGANKTAGASTPSGTGVPNSGPPIIVVDFGTATTFDCVSRRGEFLGGAIAPGLGISAEALFARAARLPRIDIRKPAKVIGTGTVDNLQIGLYYGYIGLVDGILARMIGELGPDTRTIATGGLAKLIAAGSRYISQVDEFLTLTGLRLIYERNLDHHTRHHAKARN

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
157 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
174 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0
Rhizoplane 0.95
Rhizosphere 94.6
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100011579 3300005616 Bacteria 6651
2 JGI24743J22301_10011386 3300001991 Bacteria 1601
3 rootH2_10063973 3300003320 Bacteria 2290
4 rootL2_10181519 3300003322 Bacteria 4207
5 Ga0070658_10000109 3300005327 Bacteria 73665
6 Ga0070658_10005924 3300005327 Bacteria 9918
7 Ga0070658_10012271 3300005327 Bacteria 6879
8 Ga0070658_10042696 3300005327 Bacteria 3663
9 Ga0070658_10050578 3300005327 Bacteria 3368
10 Ga0070658_10103944 3300005327 Bacteria 2349
11 Ga0070658_10287312 3300005327 Bacteria 1401
12 Ga0070658_10426377 3300005327 Bacteria 1141
13 Ga0070676_10276697 3300005328 Unclassified 1129
14 Ga0070676_10375371 3300005328 Bacteria 983
15 Ga0070670_100000164 3300005331 Bacteria 60394
16 Ga0070670_100387799 3300005331 Unclassified 1231
17 Ga0070677_10010333 3300005333 Bacteria 3190
18 Ga0068869_100261221 3300005334 Bacteria 1386
19 Ga0070666_10024232 3300005335 Bacteria 3952
20 Ga0070682_100000004 3300005337 Bacteria 388780
21 Ga0068868_100000069 3300005338 Bacteria 59364
22 Ga0068868_100002395 3300005338 Bacteria 12978
23 Ga0068868_100347178 3300005338 Bacteria 1270
24 Ga0068868_100475157 3300005338 Bacteria 1091
25 Ga0070660_100025477 3300005339 Bacteria 4396
26 Ga0070660_100060654 3300005339 Bacteria 2936
27 Ga0070660_100088495 3300005339 Bacteria 2439
28 Ga0070661_100019318 3300005344 Bacteria 4857
29 Ga0070661_100048844 3300005344 Bacteria 3098
30 Ga0070671_100004933 3300005355 Bacteria 10614
31 Ga0070671_100070024 3300005355 Unclassified 2926
32 Ga0070659_100000095 3300005366 Bacteria 66495
33 Ga0070659_100342201 3300005366 Bacteria 1253
34 Ga0070667_100461195 3300005367 Bacteria 1162
35 Ga0070713_100003567 3300005436 Bacteria 10278
36 Ga0070708_100044423 3300005445 Bacteria 3907
37 Ga0070708_100097447 3300005445 Unclassified 2688
38 Ga0070681_10022126 3300005458 Bacteria 6380
39 Ga0070681_10195470 3300005458 Bacteria 1942
40 Ga0070706_100375801 3300005467 Bacteria 1324
41 Ga0070679_100000419 3300005530 Bacteria 36101
42 Ga0070679_100020357 3300005530 Bacteria 6467
43 Ga0070679_100094240 3300005530 Bacteria 2981
44 Ga0070679_100361920 3300005530 Bacteria 1398
45 Ga0070684_100000937 3300005535 Bacteria 20751
46 Ga0068853_100000069 3300005539 Bacteria 71526
47 Ga0068853_100035266 3300005539 Bacteria 4248
48 Ga0068853_100138835 3300005539 Bacteria 2181
49 Ga0070665_100014409 3300005548 Bacteria 7935
50 Ga0070665_100119055 3300005548 Bacteria 2643
51 Ga0068855_100014211 3300005563 Bacteria 9590
52 Ga0068855_100018729 3300005563 Bacteria 8324
53 Ga0068855_100129827 3300005563 Bacteria 2879
54 Ga0068855_100249422 3300005563 Bacteria 1980
55 Ga0068855_100266715 3300005563 Bacteria 1905
56 Ga0068855_100450518 3300005563 Bacteria 1404
57 Ga0070664_100452975 3300005564 Bacteria 1178
58 Ga0068857_100130334 3300005577 Bacteria 2268
59 Ga0068854_100000015 3300005578 Bacteria 146625
60 Ga0068854_100001640 3300005578 Bacteria 13604
61 Ga0068854_100012736 3300005578 Bacteria 5508
62 Ga0068856_100021554 3300005614 Bacteria 6262
63 Ga0068856_100077993 3300005614 Bacteria 3283
64 Ga0068864_100020931 3300005618 Bacteria 5475
65 Ga0068870_10008460 3300005840 Bacteria 4630
66 Ga0068863_100003784 3300005841 Bacteria 14967
67 Ga0075434_100736759 3300006871 Bacteria 1003
68 Ga0075435_100026739 3300007076 Bacteria 4506
69 Ga0105240_10000001 3300009093 Bacteria 2887840
70 Ga0105240_10011343 3300009093 Bacteria 12413
71 Ga0105240_10018596 3300009093 Bacteria 9320
72 Ga0105240_10030152 3300009093 Bacteria 7054
73 Ga0105240_10162699 3300009093 Bacteria 2649
74 Ga0105245_10000194 3300009098 Bacteria 57715
75 Ga0105245_10249328 3300009098 Bacteria 1724
76 Ga0105241_10125208 3300009174 Bacteria 2074
77 Ga0105248_10017800 3300009177 Bacteria 7841
78 Ga0105248_10378453 3300009177 Bacteria 1594
79 Ga0105237_10217803 3300009545 Bacteria 1909
80 Ga0105238_10000041 3300009551 Bacteria 155330
81 Ga0105238_10005772 3300009551 Bacteria 12248
82 Ga0105238_10035137 3300009551 Bacteria 5097
83 Ga0105238_10211304 3300009551 Bacteria 1916
84 Ga0105238_10415366 3300009551 Bacteria 1340
85 Ga0105238_10878593 3300009551 Bacteria 914
86 Ga0105239_10453450 3300010375 Bacteria 1455
87 Ga0105239_10722132 3300010375 Bacteria 1140
88 Ga0157371_10170154 3300013102 Bacteria 1557
89 Ga0157370_10048862 3300013104 Bacteria 4052
90 Ga0157370_10054350 3300013104 Bacteria 3817
91 Ga0157370_10062129 3300013104 Unclassified 3543
92 Ga0157370_10119014 3300013104 Bacteria 2466
93 Ga0157370_10119488 3300013104 Bacteria 2461
94 Ga0157370_10120662 3300013104 Bacteria 2447
95 Ga0157370_10128472 3300013104 Bacteria 2365
96 Ga0157369_10000242 3300013105 Bacteria 75791
97 Ga0157369_10027420 3300013105 Bacteria 6314
98 Ga0157369_10039879 3300013105 Bacteria 5131
99 Ga0157369_10045330 3300013105 Bacteria 4783
100 Ga0157369_10050092 3300013105 Bacteria 4525
101 Ga0157369_10062829 3300013105 Bacteria 4001
102 Ga0157369_10087621 3300013105 Unclassified 3324
103 Ga0157374_10000006 3300013296 Bacteria 640284
104 Ga0157374_10003880 3300013296 Bacteria 12557
105 Ga0157374_10057455 3300013296 Bacteria 3634
106 Ga0157374_10124745 3300013296 Bacteria 2488
107 Ga0157374_10552927 3300013296 Bacteria 1159
108 Ga0157378_10000942 3300013297 Bacteria 26720
109 Ga0157378_10001630 3300013297 Bacteria 20284
110 Ga0157378_10020498 3300013297 Bacteria 5813
111 Ga0157378_10474560 3300013297 Bacteria 1245
112 Ga0163162_10543875 3300013306 Bacteria 1290
113 Ga0157372_10014272 3300013307 Bacteria 8493
114 Ga0157372_10048940 3300013307 Bacteria 4699
115 Ga0157372_10063372 3300013307 Bacteria 4144
116 Ga0157372_10083566 3300013307 Bacteria 3617
117 Ga0157372_10264434 3300013307 Bacteria 1998
118 Ga0157372_10365163 3300013307 Bacteria 1682
119 Ga0157372_10748989 3300013307 Bacteria 1136
120 Ga0157375_10000010 3300013308 Bacteria 361011
121 Ga0157375_10000079 3300013308 Bacteria 97385
122 Ga0157375_10061551 3300013308 Bacteria 3727
123 Ga0163163_10002432 3300014325 Bacteria 15753
124 Ga0163163_10125362 3300014325 Bacteria 2606
125 Ga0157377_10000011 3300014745 Bacteria 305350
126 Ga0157379_10006665 3300014968 Bacteria 9969
127 Ga0157379_10025645 3300014968 Bacteria 5239
128 Ga0157379_10466584 3300014968 Bacteria 1167
129 Ga0213876_10000291 3300021384 Bacteria 45588
130 Ga0228598_1007798 3300024227 Bacteria 2173
131 Ga0207426_1011538 3300025302 Bacteria 3359
132 Ga0207680_10137702 3300025903 Bacteria 1615
133 Ga0207680_10221679 3300025903 Bacteria 1297
134 Ga0207647_10049419 3300025904 Bacteria 2609
135 Ga0207645_10366884 3300025907 Bacteria 965
136 Ga0207643_10011209 3300025908 Bacteria 4841
137 Ga0207705_10000021 3300025909 Bacteria 309436
138 Ga0207705_10003093 3300025909 Bacteria 12690
139 Ga0207705_10017174 3300025909 Bacteria 5183
140 Ga0207705_10022761 3300025909 Bacteria 4469
141 Ga0207705_10042487 3300025909 Bacteria 3263
142 Ga0207705_10053188 3300025909 Bacteria 2916
143 Ga0207705_10200755 3300025909 Bacteria 1511
144 Ga0207695_10000001 3300025913 Bacteria 2888630
145 Ga0207695_10000242 3300025913 Bacteria 142011
146 Ga0207695_10016187 3300025913 Bacteria 8742
147 Ga0207695_10058975 3300025913 Bacteria 3983
148 Ga0207695_10226654 3300025913 Bacteria 1775
149 Ga0207671_10019143 3300025914 Bacteria 5240
150 Ga0207657_10003332 3300025919 Bacteria 17174
151 Ga0207657_10006313 3300025919 Bacteria 12314
152 Ga0207649_10008976 3300025920 Bacteria 5462
153 Ga0207652_10004112 3300025921 Bacteria 11877
154 Ga0207652_10040175 3300025921 Bacteria 3972
155 Ga0207694_10000001 3300025924 Bacteria 4078485
156 Ga0207694_10116352 3300025924 Bacteria 2131
157 Ga0207694_10120518 3300025924 Bacteria 2094
158 Ga0207650_10000141 3300025925 Bacteria 87777
159 Ga0207650_10156263 3300025925 Bacteria 1804
160 Ga0207700_10167409 3300025928 Bacteria 1830
161 Ga0207664_10074059 3300025929 Bacteria 2750
162 Ga0207664_10536174 3300025929 Bacteria 1049
163 Ga0207644_10088095 3300025931 Bacteria 2308
164 Ga0207690_10000687 3300025932 Bacteria 21713
165 Ga0207709_10428652 3300025935 Bacteria 1017
166 Ga0207711_10134938 3300025941 Bacteria 2216
167 Ga0207689_10011897 3300025942 Bacteria 7456
168 Ga0207661_10000002 3300025944 Bacteria 816104
169 Ga0207661_10031703 3300025944 Bacteria 4087
170 Ga0207667_10005468 3300025949 Bacteria 15486
171 Ga0207667_10035508 3300025949 Bacteria 5347
172 Ga0207667_10051426 3300025949 Bacteria 4344
173 Ga0207667_10055544 3300025949 Bacteria 4162
174 Ga0207712_10006224 3300025961 Bacteria 7520
175 Ga0207640_10000020 3300025981 Bacteria 175035
176 Ga0207640_10004630 3300025981 Bacteria 7464
177 Ga0207640_10020909 3300025981 Bacteria 3891
178 Ga0207640_10063206 3300025981 Bacteria 2459
179 Ga0207677_10000020 3300026023 Bacteria 137014
180 Ga0207677_10000216 3300026023 Bacteria 45897
181 Ga0207677_10322255 3300026023 Bacteria 1285
182 Ga0207677_10332982 3300026023 Bacteria 1266
183 Ga0207639_10000150 3300026041 Bacteria 52476
184 Ga0207639_10051897 3300026041 Bacteria 3122
185 Ga0207639_10226717 3300026041 Bacteria 1617
186 Ga0207678_10000769 3300026067 Bacteria 29267
187 Ga0207678_10001960 3300026067 Bacteria 18747
188 Ga0207678_10004492 3300026067 Bacteria 12545
189 Ga0207678_10278462 3300026067 Bacteria 1435
190 Ga0207702_10272649 3300026078 Bacteria 1596
191 Ga0207702_10617878 3300026078 Bacteria 1064
192 Ga0207641_10203322 3300026088 Bacteria 1827
193 Ga0207676_10032533 3300026095 Bacteria 3931
194 Ga0207674_10000741 3300026116 Bacteria 42733
195 Ga0207674_10005317 3300026116 Bacteria 15318
196 Ga0207698_10030304 3300026142 Bacteria 3888
197 Ga0207698_10148547 3300026142 Bacteria 2030
198 Ga0268266_10077623 3300028379 Bacteria 2888
199 Ga0268266_10178559 3300028379 Unclassified 1932
200 Ga0265338_10120552 3300028800 Bacteria 2091
201 Ga0265325_10006860 3300031241 Bacteria 6883
202 Ga0265313_10128830 3300031595 Bacteria 1098
203 Ga0307416_100220402 3300032002 Unclassified 1819
204 Ga0307510_10285504 3300033180 Bacteria 1119
205 Ga0373941_0104760 3300035115 Bacteria 989
206 Ga0316574_0016874 3300035398 Bacteria 4262
207 Ga0373935_0001124 3300035692 Bacteria 14590
208 Ga0373927_0022489 3300035695 Bacteria 4131
209 Ga0373937_0313083 3300036401 Unclassified 1485
210 Ga0373925_0006738 3300037068 Bacteria 8421
211 Ga0436365_0361745 3300039437 Bacteria 58579
212 Ga0436362_0909741 3300039453 Bacteria 8938
213 Ga0436362_1283960 3300039453 Bacteria 1417
214 Ga0466959_0108949 3300045049 Bacteria 1978
215 Ga0466959_0487531 3300045049 Unclassified 834
216 Ga0495592_0020453 3300046454 Bacteria 5034
217 Ga0495603_0001279 3300046455 Bacteria 14649
218 Ga0495629_0010568 3300046459 Bacteria 6717
219 Ga0495629_0014000 3300046459 Bacteria 5781
220 Ga0495651_0011200 3300046462 Bacteria 6893
221 Ga0495651_0142100 3300046462 Bacteria 1739
222 Ga0495653_0008101 3300046463 Bacteria 8609
223 Ga0495650_0000038 3300046471 Bacteria 377530
224 Ga0495580_0001974 3300046472 Bacteria 18020
225 Ga0495580_0016826 3300046472 Bacteria 5486
226 Ga0495580_0017305 3300046472 Bacteria 5394
227 Ga0495580_0032524 3300046472 Bacteria 3765
228 Ga0495580_0403342 3300046472 Bacteria 922
229 Ga0495582_0005502 3300046473 Bacteria 7054
230 Ga0495582_0040966 3300046473 Bacteria 2552
231 Ga0495605_0197813 3300046474 Unclassified 877
232 Ga0495639_0006217 3300046475 Bacteria 5130
233 Ga0495662_0000842 3300046476 Bacteria 14910
234 Ga0495664_0079433 3300046477 Bacteria 1966
235 Ga0495664_0093072 3300046477 Bacteria 1813
236 Ga0495585_0003605 3300046492 Bacteria 10379
237 Ga0495594_0000652 3300046499 Bacteria 17917
238 Ga0495594_0003851 3300046499 Bacteria 7709
239 Ga0495606_0067889 3300046507 Bacteria 2257
240 Ga0495606_0123797 3300046507 Bacteria 1544
241 Ga0495608_0240052 3300046511 Bacteria 1132
242 Ga0495628_0002896 3300046516 Bacteria 15363
243 Ga0495628_0616530 3300046516 Bacteria 774
244 Ga0495630_0071446 3300046517 Bacteria 2612
245 Ga0495631_0053327 3300046518 Unclassified 1765
246 Ga0495643_0193929 3300046522 Bacteria 979
247 Ga0495644_0000015 3300046523 Bacteria 89336
248 Ga0495666_0001184 3300046526 Bacteria 12553
249 Ga0495652_0061372 3300046529 Bacteria 3174
250 Ga0495652_0061602 3300046529 Bacteria 3166
251 Ga0495665_0003566 3300046531 Bacteria 8452
252 Ga0495586_0003345 3300046535 Bacteria 8600
253 Ga0495587_0018582 3300046536 Bacteria 4311
254 Ga0495587_0172299 3300046536 Bacteria 1229
255 Ga0495645_0021882 3300046543 Bacteria 4624
256 Ga0495645_0027744 3300046543 Bacteria 4113
257 Ga0495633_0017694 3300046558 Bacteria 3637
258 Ga0495667_0031316 3300046559 Bacteria 3570
259 Ga0495668_0123436 3300046616 Bacteria 1417
260 Ga0495634_0003232 3300046642 Bacteria 13163
261 Ga0495625_0013993 3300046660 Bacteria 6426
262 Ga0495625_0037841 3300046660 Bacteria 3535
263 Ga0495625_0051492 3300046660 Bacteria 2952
264 Ga0495625_0102166 3300046660 Bacteria 1968
265 Ga0495635_0035720 3300046663 Bacteria 3445
266 Ga0495661_0011281 3300046665 Bacteria 6064
267 Ga0495588_0012696 3300046674 Bacteria 3990
268 Ga0495599_0127759 3300046678 Bacteria 1579
269 Ga0495623_0017034 3300046679 Bacteria 4694
270 Ga0495658_0267422 3300046683 Bacteria 1077
271 Ga0495669_0014377 3300046684 Unclassified 3383
272 Ga0495613_0039828 3300046689 Bacteria 3482
273 Ga0495624_0003587 3300046690 Bacteria 11490
274 Ga0495671_0140446 3300046692 Unclassified 1177
275 Ga0495649_0038620 3300046694 Bacteria 2619
276 Ga0495600_0009647 3300046809 Bacteria 5967
277 Ga0495581_0002292 3300047315 Bacteria 10773
278 Ga0495581_0154009 3300047315 Bacteria 1343
279 Ga0495604_0023162 3300047317 Bacteria 4956
280 Ga0495604_0060333 3300047317 Bacteria 2905
281 Ga0495604_0232109 3300047317 Bacteria 1265
282 Ga0495674_0119368 3300047319 Bacteria 2229
283 Ga0495674_0153987 3300047319 Bacteria 1926
284 Ga0495676_0049673 3300047321 Bacteria 3370
285 Ga0495680_0037035 3300047322 Bacteria 3910
286 Ga0495683_0024663 3300047323 Bacteria 3086
287 Ga0495687_021563 3300047443 Bacteria 3113
288 Ga0495675_0001744 3300047444 Bacteria 13017
289 Ga0495677_0014204 3300047445 Bacteria 2900
290 Ga0495679_020775 3300047446 Bacteria 2281
291 Ga0495673_0097994 3300047469 Bacteria 1189
292 Ga0495684_0014826 3300047471 Bacteria 6002
293 Ga0495686_0000027 3300047472 Bacteria 382657
294 Ga0495686_0003815 3300047472 Bacteria 12782
295 Ga0495686_0016375 3300047472 Bacteria 5028
296 Ga0495686_0017354 3300047472 Bacteria 4853
297 Ga0495593_0032919 3300047673 Bacteria 2824
298 Ga0495614_0000242 3300048089 Bacteria 21295
299 Ga0495614_0050582 3300048089 Bacteria 1780
300 Ga0496104_0000054 3300048907 Bacteria 132314
301 Ga0496105_0016161 3300048908 Bacteria 5953
302 Ga0496112_0147126 3300048915 Bacteria 2324
303 Ga0496126_0000014 3300048929 Bacteria 686881
304 Ga0496126_0000100 3300048929 Bacteria 203706
305 Ga0496126_0000154 3300048929 Bacteria 159983
306 Ga0495682_0014927 3300049460 Bacteria 2943
307 Ga0501047_0020102 3300049581 Bacteria 6412
308 Ga0501073_0033781 3300049589 Bacteria 3640
309 Ga0501044_0140500 3300049823 Unclassified 2404
310 nmdc:mga0rr50_23209_c1 3300050513 Bacteria 4273
311 Ga0500643_022298 3300053087 Bacteria 2040
312 Ga0500651_0000005 3300053093 Bacteria 384761
313 Ga0500595_000004 3300053119 Bacteria 410922
314 Ga0500595_007581 3300053119 Bacteria 4494
315 Ga0500661_003653 3300055283 Bacteria 2889
316 Ga0068852_100011579
317 JGI24743J22301_10011386
318 rootH2_10063973
319 rootL2_10181519
320 Ga0070658_10000109
321 Ga0070658_10005924
322 Ga0070658_10012271
323 Ga0070658_10042696
324 Ga0070658_10050578
325 Ga0070658_10103944
326 Ga0070658_10287312
327 Ga0070658_10426377
328 Ga0070676_10276697
329 Ga0070676_10375371
330 Ga0070670_100000164
331 Ga0070670_100387799
332 Ga0070677_10010333
333 Ga0068869_100261221
334 Ga0070666_10024232
335 Ga0070682_100000004
336 Ga0068868_100000069
337 Ga0068868_100002395
338 Ga0068868_100347178
339 Ga0068868_100475157
340 Ga0070660_100025477
341 Ga0070660_100060654
342 Ga0070660_100088495
343 Ga0070661_100019318
344 Ga0070661_100048844
345 Ga0070671_100004933
346 Ga0070671_100070024
347 Ga0070659_100000095
348 Ga0070659_100342201
349 Ga0070667_100461195
350 Ga0070713_100003567
351 Ga0070708_100044423
352 Ga0070708_100097447
353 Ga0070681_10022126
354 Ga0070681_10195470
355 Ga0070706_100375801
356 Ga0070679_100000419
357 Ga0070679_100020357
358 Ga0070679_100094240
359 Ga0070679_100361920
360 Ga0070684_100000937
361 Ga0068853_100000069
362 Ga0068853_100035266
363 Ga0068853_100138835
364 Ga0070665_100014409
365 Ga0070665_100119055
366 Ga0068855_100014211
367 Ga0068855_100018729
368 Ga0068855_100129827
369 Ga0068855_100249422
370 Ga0068855_100266715
371 Ga0068855_100450518
372 Ga0070664_100452975
373 Ga0068857_100130334
374 Ga0068854_100000015
375 Ga0068854_100001640
376 Ga0068854_100012736
377 Ga0068856_100021554
378 Ga0068856_100077993
379 Ga0068864_100020931
380 Ga0068870_10008460
381 Ga0068863_100003784
382 Ga0075434_100736759
383 Ga0075435_100026739
384 Ga0105240_10000001
385 Ga0105240_10011343
386 Ga0105240_10018596
387 Ga0105240_10030152
388 Ga0105240_10162699
389 Ga0105245_10000194
390 Ga0105245_10249328
391 Ga0105241_10125208
392 Ga0105248_10017800
393 Ga0105248_10378453
394 Ga0105237_10217803
395 Ga0105238_10000041
396 Ga0105238_10005772
397 Ga0105238_10035137
398 Ga0105238_10211304
399 Ga0105238_10415366
400 Ga0105238_10878593
401 Ga0105239_10453450
402 Ga0105239_10722132
403 Ga0157371_10170154
404 Ga0157370_10048862
405 Ga0157370_10054350
406 Ga0157370_10062129
407 Ga0157370_10119014
408 Ga0157370_10119488
409 Ga0157370_10120662
410 Ga0157370_10128472
411 Ga0157369_10000242
412 Ga0157369_10027420
413 Ga0157369_10039879
414 Ga0157369_10045330
415 Ga0157369_10050092
416 Ga0157369_10062829
417 Ga0157369_10087621
418 Ga0157374_10000006
419 Ga0157374_10003880
420 Ga0157374_10057455
421 Ga0157374_10124745
422 Ga0157374_10552927
423 Ga0157378_10000942
424 Ga0157378_10001630
425 Ga0157378_10020498
426 Ga0157378_10474560
427 Ga0163162_10543875
428 Ga0157372_10014272
429 Ga0157372_10048940
430 Ga0157372_10063372
431 Ga0157372_10083566
432 Ga0157372_10264434
433 Ga0157372_10365163
434 Ga0157372_10748989
435 Ga0157375_10000010
436 Ga0157375_10000079
437 Ga0157375_10061551
438 Ga0163163_10002432
439 Ga0163163_10125362
440 Ga0157377_10000011
441 Ga0157379_10006665
442 Ga0157379_10025645
443 Ga0157379_10466584
444 Ga0213876_10000291
445 Ga0228598_1007798
446 Ga0207426_1011538
447 Ga0207680_10137702
448 Ga0207680_10221679
449 Ga0207647_10049419
450 Ga0207645_10366884
451 Ga0207643_10011209
452 Ga0207705_10000021
453 Ga0207705_10003093
454 Ga0207705_10017174
455 Ga0207705_10022761
456 Ga0207705_10042487
457 Ga0207705_10053188
458 Ga0207705_10200755
459 Ga0207695_10000001
460 Ga0207695_10000242
461 Ga0207695_10016187
462 Ga0207695_10058975
463 Ga0207695_10226654
464 Ga0207671_10019143
465 Ga0207657_10003332
466 Ga0207657_10006313
467 Ga0207649_10008976
468 Ga0207652_10004112
469 Ga0207652_10040175
470 Ga0207694_10000001
471 Ga0207694_10116352
472 Ga0207694_10120518
473 Ga0207650_10000141
474 Ga0207650_10156263
475 Ga0207700_10167409
476 Ga0207664_10074059
477 Ga0207664_10536174
478 Ga0207644_10088095
479 Ga0207690_10000687
480 Ga0207709_10428652
481 Ga0207711_10134938
482 Ga0207689_10011897
483 Ga0207661_10000002
484 Ga0207661_10031703
485 Ga0207667_10005468
486 Ga0207667_10035508
487 Ga0207667_10051426
488 Ga0207667_10055544
489 Ga0207712_10006224
490 Ga0207640_10000020
491 Ga0207640_10004630
492 Ga0207640_10020909
493 Ga0207640_10063206
494 Ga0207677_10000020
495 Ga0207677_10000216
496 Ga0207677_10322255
497 Ga0207677_10332982
498 Ga0207639_10000150
499 Ga0207639_10051897
500 Ga0207639_10226717
501 Ga0207678_10000769
502 Ga0207678_10001960
503 Ga0207678_10004492
504 Ga0207678_10278462
505 Ga0207702_10272649
506 Ga0207702_10617878
507 Ga0207641_10203322
508 Ga0207676_10032533
509 Ga0207674_10000741
510 Ga0207674_10005317
511 Ga0207698_10030304
512 Ga0207698_10148547
513 Ga0268266_10077623
514 Ga0268266_10178559
515 Ga0265338_10120552
516 Ga0265325_10006860
517 Ga0265313_10128830
518 Ga0307416_100220402
519 Ga0307510_10285504
520 Ga0373941_0104760
521 Ga0316574_0016874
522 Ga0373935_0001124
523 Ga0373927_0022489
524 Ga0373937_0313083
525 Ga0373925_0006738
526 Ga0436365_0361745
527 Ga0436362_0909741
528 Ga0436362_1283960
529 Ga0466959_0108949
530 Ga0466959_0487531
531 Ga0495592_0020453
532 Ga0495603_0001279
533 Ga0495629_0010568
534 Ga0495629_0014000
535 Ga0495651_0011200
536 Ga0495651_0142100
537 Ga0495653_0008101
538 Ga0495650_0000038
539 Ga0495580_0001974
540 Ga0495580_0016826
541 Ga0495580_0017305
542 Ga0495580_0032524
543 Ga0495580_0403342
544 Ga0495582_0005502
545 Ga0495582_0040966
546 Ga0495605_0197813
547 Ga0495639_0006217
548 Ga0495662_0000842
549 Ga0495664_0079433
550 Ga0495664_0093072
551 Ga0495585_0003605
552 Ga0495594_0000652
553 Ga0495594_0003851
554 Ga0495606_0067889
555 Ga0495606_0123797
556 Ga0495608_0240052
557 Ga0495628_0002896
558 Ga0495628_0616530
559 Ga0495630_0071446
560 Ga0495631_0053327
561 Ga0495643_0193929
562 Ga0495644_0000015
563 Ga0495666_0001184
564 Ga0495652_0061372
565 Ga0495652_0061602
566 Ga0495665_0003566
567 Ga0495586_0003345
568 Ga0495587_0018582
569 Ga0495587_0172299
570 Ga0495645_0021882
571 Ga0495645_0027744
572 Ga0495633_0017694
573 Ga0495667_0031316
574 Ga0495668_0123436
575 Ga0495634_0003232
576 Ga0495625_0013993
577 Ga0495625_0037841
578 Ga0495625_0051492
579 Ga0495625_0102166
580 Ga0495635_0035720
581 Ga0495661_0011281
582 Ga0495588_0012696
583 Ga0495599_0127759
584 Ga0495623_0017034
585 Ga0495658_0267422
586 Ga0495669_0014377
587 Ga0495613_0039828
588 Ga0495624_0003587
589 Ga0495671_0140446
590 Ga0495649_0038620
591 Ga0495600_0009647
592 Ga0495581_0002292
593 Ga0495581_0154009
594 Ga0495604_0023162
595 Ga0495604_0060333
596 Ga0495604_0232109
597 Ga0495674_0119368
598 Ga0495674_0153987
599 Ga0495676_0049673
600 Ga0495680_0037035
601 Ga0495683_0024663
602 Ga0495687_021563
603 Ga0495675_0001744
604 Ga0495677_0014204
605 Ga0495679_020775
606 Ga0495673_0097994
607 Ga0495684_0014826
608 Ga0495686_0000027
609 Ga0495686_0003815
610 Ga0495686_0016375
611 Ga0495686_0017354
612 Ga0495593_0032919
613 Ga0495614_0000242
614 Ga0495614_0050582
615 Ga0496104_0000054
616 Ga0496105_0016161
617 Ga0496112_0147126
618 Ga0496126_0000014
619 Ga0496126_0000100
620 Ga0496126_0000154
621 Ga0495682_0014927
622 Ga0501047_0020102
623 Ga0501073_0033781
624 Ga0501044_0140500
625 nmdc:mga0rr50_23209_c1
626 Ga0500643_022298
627 Ga0500651_0000005
628 Ga0500595_000004
629 Ga0500595_007581
630 Ga0500661_003653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03309

Pan_kinase

Type III pantothenate kinase

160

250

0.96

PF03309

Pan_kinase

Type III pantothenate kinase

2

157

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h3g-assembly1.cif.gz_X-2 structure of the type iii pantothenate kinase (coax) from bacillus anthracis 0.946 4 253
2h3g-assembly1.cif.gz_X-2 structure of the type iii pantothenate kinase (coax) from bacillus anthracis 0.9349 4 253
3djc-assembly1.cif.gz_L crystal structure of pantothenate kinase from legionella pneumophila 0.9303 4 254
3djc-assembly2.cif.gz_A crystal structure of pantothenate kinase from legionella pneumophila 0.9279 4 254
3djc-assembly2.cif.gz_D crystal structure of pantothenate kinase from legionella pneumophila 0.9258 2 255
ID Description Score Start End Superfamily
2h3gX02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9631 90 253 3.30.420.40
2h3gX02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9455 90 253 3.30.420.40
af_P9WPA1_91_271_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9371 89 253 3.30.420.40
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9364 4 88 3.30.420.40
3djcB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9224 2 87 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2T5G538-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9644 3 254 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872
AF-A0A316L7U0-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9636 4 253 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872
AF-A0A6I1Z3F4-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9634 4 254 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872
AF-A0A2D6CUD0-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9628 4 252 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872
AF-A0A0S7B9W4-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9622 4 254 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872

Map