F402795

General Info

Members Datasets Scaffolds Average Seq Length
314 198 628 119

Family's Representative Sequence

Representative Sequence 3300041451|Ga0451791_0800471|Ga0451791_0800471_577_1020
Length 147
Sequence MPVSDRALGVRGRGEKRADRPAGPEETEMTRYLMSVYGAAEYNEYGNYPSEEAMQQAMADTDAFNQQLQQDGYWVFADGLAPATTATVVDGQGAETVITDGPYLEAKEYLGGFWIIEAPDLDVALRLAADGSKACRGKVEVRPFGSL

Samples

Sample ID Description Type Environment
1 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
135 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
136 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
140 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
141 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
192 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
193 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 2643221615 Nocardioides sp. Root224 Isolate Unclassified
197 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
198 2996221748 Micromonospora veneta CAP181 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 0.96
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.14
Nodule 0
Rhizoplane 6.69
Rhizosphere 85.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451791_0800471 3300041451 Bacteria 1157
2 JGI25405J52794_10042297 3300003911 Bacteria 965
3 Ga0065712_10719993 3300005290 Bacteria 539
4 Ga0070658_10175214 3300005327 Bacteria 1803
5 Ga0070658_11583653 3300005327 Bacteria 568
6 Ga0070683_100607465 3300005329 Bacteria 1047
7 Ga0070683_100660462 3300005329 Bacteria 1001
8 Ga0070670_101462724 3300005331 Bacteria 627
9 Ga0068869_100295328 3300005334 Bacteria 1307
10 Ga0070682_100328798 3300005337 Bacteria 1132
11 Ga0070682_100655868 3300005337 Bacteria 836
12 Ga0070682_101323471 3300005337 Bacteria 613
13 Ga0070660_100224755 3300005339 Bacteria 1526
14 Ga0070660_100674802 3300005339 Bacteria 866
15 Ga0070661_101179893 3300005344 Bacteria 640
16 Ga0070661_101285311 3300005344 Bacteria 613
17 Ga0070668_101491358 3300005347 Bacteria 618
18 Ga0070669_101198566 3300005353 Bacteria 656
19 Ga0070671_100573224 3300005355 Bacteria 974
20 Ga0070674_100925976 3300005356 Bacteria 761
21 Ga0070674_101976108 3300005356 Bacteria 531
22 Ga0070659_100007020 3300005366 Bacteria 8157
23 Ga0070667_100093517 3300005367 Bacteria 2589
24 Ga0070667_100105086 3300005367 Bacteria 2443
25 Ga0070714_100311849 3300005435 Bacteria 1469
26 Ga0070663_100188838 3300005455 Bacteria 1603
27 Ga0070663_102060476 3300005455 Bacteria 514
28 Ga0070678_100319950 3300005456 Bacteria 1324
29 Ga0070678_100849107 3300005456 Bacteria 832
30 Ga0070662_100354310 3300005457 Bacteria 1203
31 Ga0070685_10022256 3300005466 Bacteria 3453
32 Ga0070685_10156229 3300005466 Bacteria 1450
33 Ga0070685_10587819 3300005466 Bacteria 799
34 Ga0070684_102171164 3300005535 Bacteria 524
35 Ga0068853_100215301 3300005539 Bacteria 1752
36 Ga0068853_101152591 3300005539 Bacteria 748
37 Ga0068853_102224890 3300005539 Bacteria 531
38 Ga0070672_100094174 3300005543 Bacteria 2421
39 Ga0070686_100457184 3300005544 Bacteria 983
40 Ga0070665_100406563 3300005548 Bacteria 1369
41 Ga0068855_100000369 3300005563 Bacteria 55783
42 Ga0068855_100285487 3300005563 Bacteria 1831
43 Ga0068855_100772461 3300005563 Bacteria 1023
44 Ga0068854_100101602 3300005578 Bacteria 2156
45 Ga0068854_100110245 3300005578 Bacteria 2075
46 Ga0068856_100204799 3300005614 Bacteria 1988
47 Ga0068856_100371961 3300005614 Bacteria 1448
48 Ga0068856_100433478 3300005614 Bacteria 1334
49 Ga0070702_100609041 3300005615 Bacteria 820
50 Ga0068852_100094717 3300005616 Bacteria 2680
51 Ga0068852_100452545 3300005616 Bacteria 1271
52 Ga0068852_100488541 3300005616 Bacteria 1224
53 Ga0068859_100134152 3300005617 Bacteria 2547
54 Ga0068859_100441859 3300005617 Bacteria 1397
55 Ga0068864_100385653 3300005618 Bacteria 1329
56 Ga0068861_100898772 3300005719 Bacteria 839
57 Ga0068851_10000025 3300005834 Bacteria 123782
58 Ga0068870_10410444 3300005840 Bacteria 883
59 Ga0068863_102110772 3300005841 Bacteria 573
60 Ga0068858_100000080 3300005842 Bacteria 100656
61 Ga0068858_100040020 3300005842 Bacteria 4346
62 Ga0068860_100396536 3300005843 Bacteria 1365
63 Ga0068860_101026288 3300005843 Bacteria 843
64 Ga0081455_10000139 3300005937 Bacteria 85131
65 Ga0081540_1075880 3300005983 Bacteria 1534
66 Ga0075365_10069179 3300006038 Bacteria 2373
67 Ga0075365_10814666 3300006038 Bacteria 659
68 Ga0075365_10901171 3300006038 Bacteria 623
69 Ga0075364_10687698 3300006051 Bacteria 698
70 Ga0075432_10158551 3300006058 Bacteria 874
71 Ga0068871_101354374 3300006358 Bacteria 670
72 Ga0068871_102318422 3300006358 Bacteria 512
73 Ga0075428_100017212 3300006844 Bacteria 7988
74 Ga0075430_100005255 3300006846 Bacteria 10918
75 Ga0075431_100069672 3300006847 Bacteria 3629
76 Ga0075431_100310677 3300006847 Bacteria 1591
77 Ga0075433_10816246 3300006852 Bacteria 815
78 Ga0075434_100144939 3300006871 Bacteria 2395
79 Ga0075429_100003969 3300006880 Bacteria 12654
80 Ga0097620_100134156 3300006931 Bacteria 2547
81 Ga0097620_100441886 3300006931 Bacteria 1397
82 Ga0105240_10059197 3300009093 Bacteria 4782
83 Ga0105240_10327363 3300009093 Bacteria 1745
84 Ga0111539_10065655 3300009094 Bacteria 4287
85 Ga0105245_10316418 3300009098 Bacteria 1536
86 Ga0105245_11459766 3300009098 Bacteria 734
87 Ga0114129_10000074 3300009147 Bacteria 92340
88 Ga0114129_10050296 3300009147 Bacteria 5854
89 Ga0105243_12799270 3300009148 Bacteria 528
90 Ga0105241_10365247 3300009174 Bacteria 1257
91 Ga0105242_10826280 3300009176 Bacteria 920
92 Ga0105242_12068245 3300009176 Bacteria 613
93 Ga0105242_12912513 3300009176 Bacteria 529
94 Ga0105248_10000262 3300009177 Bacteria 61793
95 Ga0105248_11482996 3300009177 Bacteria 768
96 Ga0105237_10000270 3300009545 Bacteria 73136
97 Ga0105237_10196625 3300009545 Bacteria 2016
98 Ga0105237_12633871 3300009545 Bacteria 514
99 Ga0105238_10006367 3300009551 Bacteria 11741
100 Ga0105238_10557173 3300009551 Bacteria 1151
101 Ga0105249_11026666 3300009553 Bacteria 894
102 Ga0105239_10158298 3300010375 Bacteria 2530
103 Ga0105239_10660141 3300010375 Bacteria 1195
104 Ga0105239_10933992 3300010375 Bacteria 996
105 Ga0105239_11107625 3300010375 Bacteria 912
106 Ga0105239_11412426 3300010375 Bacteria 804
107 Ga0105239_11539048 3300010375 Bacteria 769
108 Ga0105239_11878445 3300010375 Bacteria 694
109 Ga0105246_10023869 3300011119 Bacteria 3964
110 Ga0105246_10218179 3300011119 Bacteria 1493
111 Ga0157314_1032330 3300012500 Bacteria 594
112 Ga0157371_10364568 3300013102 Bacteria 1053
113 Ga0157370_10810361 3300013104 Bacteria 852
114 Ga0157369_11262370 3300013105 Bacteria 753
115 Ga0157374_10072461 3300013296 Bacteria 3250
116 Ga0157374_11184060 3300013296 Bacteria 785
117 Ga0157374_11590031 3300013296 Bacteria 678
118 Ga0157378_11543998 3300013297 Bacteria 709
119 Ga0163162_10531617 3300013306 Bacteria 1305
120 Ga0163162_10753660 3300013306 Bacteria 1093
121 Ga0157372_10693483 3300013307 Bacteria 1185
122 Ga0157375_11738594 3300013308 Bacteria 739
123 Ga0157377_10299806 3300014745 Bacteria 1060
124 Ga0157379_10039832 3300014968 Bacteria 4193
125 Ga0157379_10103060 3300014968 Bacteria 2560
126 Ga0157379_10692552 3300014968 Bacteria 956
127 Ga0157376_10348981 3300014969 Bacteria 1415
128 Ga0157376_11993502 3300014969 Bacteria 618
129 Ga0206354_10261383 3300020081 Bacteria 881
130 Ga0206353_11933972 3300020082 Bacteria 957
131 Ga0224712_10091548 3300022467 Bacteria 1275
132 Ga0207656_10000001 3300025321 Bacteria 1323684
133 Ga0207710_10058938 3300025900 Bacteria 1737
134 Ga0207688_10012871 3300025901 Bacteria 4548
135 Ga0207688_10116559 3300025901 Bacteria 1555
136 Ga0207645_10568882 3300025907 Bacteria 769
137 Ga0207643_10038127 3300025908 Bacteria 2699
138 Ga0207705_10076660 3300025909 Bacteria 2431
139 Ga0207705_10104725 3300025909 Bacteria 2084
140 Ga0207705_10191218 3300025909 Bacteria 1548
141 Ga0207695_10000617 3300025913 Bacteria 71447
142 Ga0207695_10001517 3300025913 Bacteria 38540
143 Ga0207695_10283180 3300025913 Bacteria 1551
144 Ga0207671_10000001 3300025914 Bacteria 1318881
145 Ga0207662_11113190 3300025918 Bacteria 561
146 Ga0207657_10127015 3300025919 Bacteria 2093
147 Ga0207657_10253166 3300025919 Bacteria 1403
148 Ga0207649_10826479 3300025920 Bacteria 724
149 Ga0207652_10671657 3300025921 Bacteria 926
150 Ga0207681_10980935 3300025923 Bacteria 709
151 Ga0207694_10000047 3300025924 Bacteria 163953
152 Ga0207694_10000265 3300025924 Bacteria 49883
153 Ga0207659_10571125 3300025926 Bacteria 962
154 Ga0207687_10029982 3300025927 Bacteria 3664
155 Ga0207687_10233842 3300025927 Bacteria 1453
156 Ga0207644_10450493 3300025931 Bacteria 1057
157 Ga0207644_11095341 3300025931 Bacteria 669
158 Ga0207690_10000945 3300025932 Bacteria 18591
159 Ga0207690_10141932 3300025932 Bacteria 1771
160 Ga0207706_10595182 3300025933 Bacteria 950
161 Ga0207709_10145509 3300025935 Bacteria 1635
162 Ga0207669_10519382 3300025937 Bacteria 956
163 Ga0207669_10994216 3300025937 Bacteria 705
164 Ga0207691_10112654 3300025940 Bacteria 2418
165 Ga0207691_10229266 3300025940 Bacteria 1609
166 Ga0207711_10003086 3300025941 Bacteria 14524
167 Ga0207711_10761641 3300025941 Bacteria 902
168 Ga0207711_10816324 3300025941 Bacteria 868
169 Ga0207689_10239622 3300025942 Bacteria 1499
170 Ga0207661_11202818 3300025944 Bacteria 697
171 Ga0207667_10000462 3300025949 Bacteria 54635
172 Ga0207667_10001083 3300025949 Bacteria 34556
173 Ga0207667_10557266 3300025949 Bacteria 1159
174 Ga0207712_10727121 3300025961 Bacteria 868
175 Ga0207712_11565763 3300025961 Bacteria 591
176 Ga0207658_10192246 3300025986 Bacteria 1697
177 Ga0207658_10439622 3300025986 Bacteria 1153
178 Ga0207677_10215440 3300026023 Bacteria 1536
179 Ga0207703_10000033 3300026035 Bacteria 187752
180 Ga0207703_10044986 3300026035 Bacteria 3550
181 Ga0207703_10879696 3300026035 Bacteria 857
182 Ga0207639_10112368 3300026041 Bacteria 2223
183 Ga0207639_10953341 3300026041 Bacteria 803
184 Ga0207678_10194742 3300026067 Bacteria 1732
185 Ga0207678_10370276 3300026067 Bacteria 1237
186 Ga0207702_10064183 3300026078 Bacteria 3142
187 Ga0207702_10064759 3300026078 Bacteria 3129
188 Ga0207702_10543252 3300026078 Bacteria 1136
189 Ga0207702_11634947 3300026078 Bacteria 637
190 Ga0207676_10835065 3300026095 Bacteria 900
191 Ga0207676_11300264 3300026095 Bacteria 722
192 Ga0207674_10000552 3300026116 Bacteria 49121
193 Ga0207674_10578758 3300026116 Bacteria 1085
194 Ga0207675_100690489 3300026118 Bacteria 1029
195 Ga0207683_10477952 3300026121 Bacteria 1150
196 Ga0207698_10000167 3300026142 Bacteria 41351
197 Ga0207698_10000981 3300026142 Bacteria 16612
198 Ga0207698_12521851 3300026142 Bacteria 524
199 Ga0207428_10027156 3300027907 Bacteria 4767
200 Ga0207428_10447420 3300027907 Bacteria 942
201 Ga0268264_10200807 3300028381 Bacteria 1824
202 Ga0268264_11769846 3300028381 Bacteria 628
203 Ga0307408_101170432 3300031548 Bacteria 716
204 Ga0307405_10214616 3300031731 Bacteria 1407
205 Ga0307413_10801945 3300031824 Bacteria 791
206 Ga0307410_10016217 3300031852 Bacteria 4438
207 Ga0307410_10805063 3300031852 Bacteria 799
208 Ga0307406_10238948 3300031901 Bacteria 1361
209 Ga0307406_10845836 3300031901 Bacteria 775
210 Ga0307406_11911941 3300031901 Bacteria 529
211 Ga0307406_11976512 3300031901 Bacteria 521
212 Ga0307407_10009212 3300031903 Bacteria 4585
213 Ga0307412_10005868 3300031911 Bacteria 6916
214 Ga0307412_10282146 3300031911 Bacteria 1305
215 Ga0307412_10907589 3300031911 Bacteria 772
216 Ga0307412_10948952 3300031911 Bacteria 757
217 Ga0307409_100001310 3300031995 Bacteria 12074
218 Ga0307409_100289739 3300031995 Bacteria 1518
219 Ga0307409_100360295 3300031995 Bacteria 1375
220 Ga0307416_100001106 3300032002 Bacteria 14460
221 Ga0307416_100699910 3300032002 Bacteria 1102
222 Ga0307416_101707322 3300032002 Bacteria 734
223 Ga0307411_10583401 3300032005 Bacteria 959
224 Ga0307415_100000038 3300032126 Bacteria 57023
225 Ga0307415_100242488 3300032126 Bacteria 1459
226 Ga0395900_0170268 3300037418 Bacteria 2218
227 Ga0436365_0686262 3300039437 Bacteria 613
228 Ga0451789_0703502 3300041443 Bacteria 541
229 Ga0451791_0486201 3300041451 Bacteria 5667
230 Ga0451793_1210644 3300041452 Bacteria 3599
231 Ga0451797_0369267 3300041453 Bacteria 4117
232 Ga0451802_0492794 3300041460 Bacteria 565
233 Ga0451807_1366388 3300041486 Bacteria 650
234 Ga0451841_0873495 3300041498 Bacteria 1564
235 Ga0451851_1201204 3300041507 Bacteria 569
236 Ga0451843_0067071 3300041509 Bacteria 784
237 Ga0451853_2195152 3300041512 Bacteria 4000
238 Ga0439464_0264899 3300042439 Bacteria 557
239 Ga0466961_0035014 3300044693 Bacteria 3224
240 Ga0466968_0007759 3300044735 Bacteria 4089
241 Ga0466970_0118532 3300044765 Bacteria 1449
242 Ga0466960_0152384 3300044901 Bacteria 1236
243 Ga0466958_0453986 3300045836 Bacteria 830
244 Ga0466967_0398432 3300045976 Bacteria 1339
245 Ga0466967_0862285 3300045976 Bacteria 900
246 Ga0495620_0418657 3300046515 Bacteria 507
247 Ga0496103_0353969 3300048906 Bacteria 944
248 Ga0496103_0751356 3300048906 Bacteria 617
249 Ga0496104_0371290 3300048907 Bacteria 1343
250 Ga0496107_0812497 3300048910 Bacteria 684
251 Ga0496108_0024545 3300048911 Bacteria 4965
252 Ga0496108_0180480 3300048911 Bacteria 1828
253 Ga0496108_0314557 3300048911 Bacteria 1365
254 Ga0496109_0903523 3300048912 Bacteria 821
255 Ga0496110_0247816 3300048913 Bacteria 1621
256 Ga0496110_1725921 3300048913 Bacteria 536
257 Ga0496111_0973866 3300048914 Bacteria 609
258 Ga0496113_0909437 3300048916 Bacteria 696
259 Ga0496114_0152651 3300048917 Bacteria 2004
260 Ga0496114_0815085 3300048917 Bacteria 813
261 Ga0496120_0053477 3300048923 Bacteria 2294
262 Ga0496126_0000026 3300048929 Bacteria 422310
263 Ga0501032_0002897 3300049569 Bacteria 13339
264 Ga0501033_0320217 3300049570 Bacteria 1089
265 Ga0501034_0155124 3300049571 Bacteria 2264
266 Ga0501034_1709274 3300049571 Bacteria 502
267 Ga0501037_0077098 3300049573 Bacteria 2419
268 Ga0501037_0217036 3300049573 Bacteria 1347
269 Ga0501038_0001730 3300049574 Bacteria 20309
270 Ga0501038_0010364 3300049574 Bacteria 8528
271 Ga0501039_0136140 3300049575 Bacteria 1929
272 Ga0501042_0458080 3300049578 Bacteria 925
273 Ga0501043_0089644 3300049579 Bacteria 2417
274 Ga0501043_0570291 3300049579 Bacteria 839
275 Ga0501043_0965075 3300049579 Bacteria 608
276 Ga0501046_0020452 3300049580 Bacteria 5472
277 Ga0501047_0008696 3300049581 Bacteria 9585
278 Ga0501047_0441111 3300049581 Bacteria 1132
279 Ga0501067_0329388 3300049583 Bacteria 850
280 Ga0501068_1193547 3300049584 Bacteria 504
281 Ga0501070_0084928 3300049586 Bacteria 2621
282 Ga0501070_0672856 3300049586 Bacteria 820
283 Ga0501073_0028774 3300049589 Bacteria 3970
284 Ga0501074_0158026 3300049590 Bacteria 1619
285 Ga0501083_0004633 3300049744 Bacteria 9710
286 Ga0501035_0220036 3300049822 Bacteria 1621
287 Ga0501044_0021317 3300049823 Bacteria 6915
288 Ga0501044_0058446 3300049823 Bacteria 3954
289 nmdc:mga00v17_423229_c1 3300050491 Bacteria 865
290 nmdc:mga0yw44_126762_c1 3300050492 Bacteria 1649
291 nmdc:mga0yw44_612298_c1 3300050492 Bacteria 740
292 nmdc:mga05p37_448_c1 3300050507 Bacteria 44738
293 nmdc:mga05p37_9214_c1 3300050507 Bacteria 11666
294 nmdc:mga09592_13_c1 3300050508 Bacteria 101979
295 nmdc:mga09592_6427_c1 3300050508 Bacteria 9575
296 nmdc:mga0qj67_1442_c1 3300050509 Bacteria 16658
297 nmdc:mga0qj67_271_c1 3300050509 Bacteria 35837
298 nmdc:mga06r32_106971_c1 3300050510 Bacteria 2749
299 nmdc:mga06r32_24_c1 3300050510 Bacteria 92238
300 nmdc:mga08y16_2050_c1 3300050511 Bacteria 20653
301 nmdc:mga08y16_315664_c1 3300050511 Bacteria 1609
302 nmdc:mga0n895_343798_c1 3300050512 Bacteria 1511
303 nmdc:mga0a205_808411_c1 3300050515 Bacteria 785
304 Ga0500651_0001835 3300053093 Bacteria 10905
305 Ga0500559_0108125 3300053136 Bacteria 1287
306 Ga0500559_0244044 3300053136 Bacteria 846
307 Ga0500573_0014753 3300053140 Bacteria 4425
308 Ga0500590_008339 3300053148 Bacteria 5166
309 Ga0500633_0223994 3300053160 Bacteria 702
310 Ga0501084_0219287 3300054114 Bacteria 1605
311 Ga0501082_0082235 3300060353 Bacteria 2778
312 2644092596 2643221615 Bacteria 5487866
313 2644322209 2643221657 Bacteria 5490246
314 2996226409 2996221748 Bacteria 6799777
315 Ga0451791_0800471
316 JGI25405J52794_10042297
317 Ga0065712_10719993
318 Ga0070658_10175214
319 Ga0070658_11583653
320 Ga0070683_100607465
321 Ga0070683_100660462
322 Ga0070670_101462724
323 Ga0068869_100295328
324 Ga0070682_100328798
325 Ga0070682_100655868
326 Ga0070682_101323471
327 Ga0070660_100224755
328 Ga0070660_100674802
329 Ga0070661_101179893
330 Ga0070661_101285311
331 Ga0070668_101491358
332 Ga0070669_101198566
333 Ga0070671_100573224
334 Ga0070674_100925976
335 Ga0070674_101976108
336 Ga0070659_100007020
337 Ga0070667_100093517
338 Ga0070667_100105086
339 Ga0070714_100311849
340 Ga0070663_100188838
341 Ga0070663_102060476
342 Ga0070678_100319950
343 Ga0070678_100849107
344 Ga0070662_100354310
345 Ga0070685_10022256
346 Ga0070685_10156229
347 Ga0070685_10587819
348 Ga0070684_102171164
349 Ga0068853_100215301
350 Ga0068853_101152591
351 Ga0068853_102224890
352 Ga0070672_100094174
353 Ga0070686_100457184
354 Ga0070665_100406563
355 Ga0068855_100000369
356 Ga0068855_100285487
357 Ga0068855_100772461
358 Ga0068854_100101602
359 Ga0068854_100110245
360 Ga0068856_100204799
361 Ga0068856_100371961
362 Ga0068856_100433478
363 Ga0070702_100609041
364 Ga0068852_100094717
365 Ga0068852_100452545
366 Ga0068852_100488541
367 Ga0068859_100134152
368 Ga0068859_100441859
369 Ga0068864_100385653
370 Ga0068861_100898772
371 Ga0068851_10000025
372 Ga0068870_10410444
373 Ga0068863_102110772
374 Ga0068858_100000080
375 Ga0068858_100040020
376 Ga0068860_100396536
377 Ga0068860_101026288
378 Ga0081455_10000139
379 Ga0081540_1075880
380 Ga0075365_10069179
381 Ga0075365_10814666
382 Ga0075365_10901171
383 Ga0075364_10687698
384 Ga0075432_10158551
385 Ga0068871_101354374
386 Ga0068871_102318422
387 Ga0075428_100017212
388 Ga0075430_100005255
389 Ga0075431_100069672
390 Ga0075431_100310677
391 Ga0075433_10816246
392 Ga0075434_100144939
393 Ga0075429_100003969
394 Ga0097620_100134156
395 Ga0097620_100441886
396 Ga0105240_10059197
397 Ga0105240_10327363
398 Ga0111539_10065655
399 Ga0105245_10316418
400 Ga0105245_11459766
401 Ga0114129_10000074
402 Ga0114129_10050296
403 Ga0105243_12799270
404 Ga0105241_10365247
405 Ga0105242_10826280
406 Ga0105242_12068245
407 Ga0105242_12912513
408 Ga0105248_10000262
409 Ga0105248_11482996
410 Ga0105237_10000270
411 Ga0105237_10196625
412 Ga0105237_12633871
413 Ga0105238_10006367
414 Ga0105238_10557173
415 Ga0105249_11026666
416 Ga0105239_10158298
417 Ga0105239_10660141
418 Ga0105239_10933992
419 Ga0105239_11107625
420 Ga0105239_11412426
421 Ga0105239_11539048
422 Ga0105239_11878445
423 Ga0105246_10023869
424 Ga0105246_10218179
425 Ga0157314_1032330
426 Ga0157371_10364568
427 Ga0157370_10810361
428 Ga0157369_11262370
429 Ga0157374_10072461
430 Ga0157374_11184060
431 Ga0157374_11590031
432 Ga0157378_11543998
433 Ga0163162_10531617
434 Ga0163162_10753660
435 Ga0157372_10693483
436 Ga0157375_11738594
437 Ga0157377_10299806
438 Ga0157379_10039832
439 Ga0157379_10103060
440 Ga0157379_10692552
441 Ga0157376_10348981
442 Ga0157376_11993502
443 Ga0206354_10261383
444 Ga0206353_11933972
445 Ga0224712_10091548
446 Ga0207656_10000001
447 Ga0207710_10058938
448 Ga0207688_10012871
449 Ga0207688_10116559
450 Ga0207645_10568882
451 Ga0207643_10038127
452 Ga0207705_10076660
453 Ga0207705_10104725
454 Ga0207705_10191218
455 Ga0207695_10000617
456 Ga0207695_10001517
457 Ga0207695_10283180
458 Ga0207671_10000001
459 Ga0207662_11113190
460 Ga0207657_10127015
461 Ga0207657_10253166
462 Ga0207649_10826479
463 Ga0207652_10671657
464 Ga0207681_10980935
465 Ga0207694_10000047
466 Ga0207694_10000265
467 Ga0207659_10571125
468 Ga0207687_10029982
469 Ga0207687_10233842
470 Ga0207644_10450493
471 Ga0207644_11095341
472 Ga0207690_10000945
473 Ga0207690_10141932
474 Ga0207706_10595182
475 Ga0207709_10145509
476 Ga0207669_10519382
477 Ga0207669_10994216
478 Ga0207691_10112654
479 Ga0207691_10229266
480 Ga0207711_10003086
481 Ga0207711_10761641
482 Ga0207711_10816324
483 Ga0207689_10239622
484 Ga0207661_11202818
485 Ga0207667_10000462
486 Ga0207667_10001083
487 Ga0207667_10557266
488 Ga0207712_10727121
489 Ga0207712_11565763
490 Ga0207658_10192246
491 Ga0207658_10439622
492 Ga0207677_10215440
493 Ga0207703_10000033
494 Ga0207703_10044986
495 Ga0207703_10879696
496 Ga0207639_10112368
497 Ga0207639_10953341
498 Ga0207678_10194742
499 Ga0207678_10370276
500 Ga0207702_10064183
501 Ga0207702_10064759
502 Ga0207702_10543252
503 Ga0207702_11634947
504 Ga0207676_10835065
505 Ga0207676_11300264
506 Ga0207674_10000552
507 Ga0207674_10578758
508 Ga0207675_100690489
509 Ga0207683_10477952
510 Ga0207698_10000167
511 Ga0207698_10000981
512 Ga0207698_12521851
513 Ga0207428_10027156
514 Ga0207428_10447420
515 Ga0268264_10200807
516 Ga0268264_11769846
517 Ga0307408_101170432
518 Ga0307405_10214616
519 Ga0307413_10801945
520 Ga0307410_10016217
521 Ga0307410_10805063
522 Ga0307406_10238948
523 Ga0307406_10845836
524 Ga0307406_11911941
525 Ga0307406_11976512
526 Ga0307407_10009212
527 Ga0307412_10005868
528 Ga0307412_10282146
529 Ga0307412_10907589
530 Ga0307412_10948952
531 Ga0307409_100001310
532 Ga0307409_100289739
533 Ga0307409_100360295
534 Ga0307416_100001106
535 Ga0307416_100699910
536 Ga0307416_101707322
537 Ga0307411_10583401
538 Ga0307415_100000038
539 Ga0307415_100242488
540 Ga0395900_0170268
541 Ga0436365_0686262
542 Ga0451789_0703502
543 Ga0451791_0486201
544 Ga0451793_1210644
545 Ga0451797_0369267
546 Ga0451802_0492794
547 Ga0451807_1366388
548 Ga0451841_0873495
549 Ga0451851_1201204
550 Ga0451843_0067071
551 Ga0451853_2195152
552 Ga0439464_0264899
553 Ga0466961_0035014
554 Ga0466968_0007759
555 Ga0466970_0118532
556 Ga0466960_0152384
557 Ga0466958_0453986
558 Ga0466967_0398432
559 Ga0466967_0862285
560 Ga0495620_0418657
561 Ga0496103_0353969
562 Ga0496103_0751356
563 Ga0496104_0371290
564 Ga0496107_0812497
565 Ga0496108_0024545
566 Ga0496108_0180480
567 Ga0496108_0314557
568 Ga0496109_0903523
569 Ga0496110_0247816
570 Ga0496110_1725921
571 Ga0496111_0973866
572 Ga0496113_0909437
573 Ga0496114_0152651
574 Ga0496114_0815085
575 Ga0496120_0053477
576 Ga0496126_0000026
577 Ga0501032_0002897
578 Ga0501033_0320217
579 Ga0501034_0155124
580 Ga0501034_1709274
581 Ga0501037_0077098
582 Ga0501037_0217036
583 Ga0501038_0001730
584 Ga0501038_0010364
585 Ga0501039_0136140
586 Ga0501042_0458080
587 Ga0501043_0089644
588 Ga0501043_0570291
589 Ga0501043_0965075
590 Ga0501046_0020452
591 Ga0501047_0008696
592 Ga0501047_0441111
593 Ga0501067_0329388
594 Ga0501068_1193547
595 Ga0501070_0084928
596 Ga0501070_0672856
597 Ga0501073_0028774
598 Ga0501074_0158026
599 Ga0501083_0004633
600 Ga0501035_0220036
601 Ga0501044_0021317
602 Ga0501044_0058446
603 nmdc:mga00v17_423229_c1
604 nmdc:mga0yw44_126762_c1
605 nmdc:mga0yw44_612298_c1
606 nmdc:mga05p37_448_c1
607 nmdc:mga05p37_9214_c1
608 nmdc:mga09592_13_c1
609 nmdc:mga09592_6427_c1
610 nmdc:mga0qj67_1442_c1
611 nmdc:mga0qj67_271_c1
612 nmdc:mga06r32_106971_c1
613 nmdc:mga06r32_24_c1
614 nmdc:mga08y16_2050_c1
615 nmdc:mga08y16_315664_c1
616 nmdc:mga0n895_343798_c1
617 nmdc:mga0a205_808411_c1
618 Ga0500651_0001835
619 Ga0500559_0108125
620 Ga0500559_0244044
621 Ga0500573_0014753
622 Ga0500590_008339
623 Ga0500633_0223994
624 Ga0501084_0219287
625 Ga0501082_0082235
626 2644092596
627 2644322209
628 2996226409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

31

145

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3znu-assembly1.cif.gz_I crystal structure of clcf in crystal form 2 0.6644 1 119
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6527 1 119
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6466 2 118
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6389 1 119
4fpi-assembly1.cif.gz_C crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6376 1 119
ID Description Score Start End Superfamily
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6506 1 119 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6466 2 118 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6436 2 119 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6165 2 118 3.30.70.1060
2w24A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6071 1 116 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A4Q7TVH6-F1-model_v4 YCII-related domain-containing protein 0.867 47 118
AF-A0A4Q7TVH6-F1-model_v4 YCII-related domain-containing protein 0.7866 47 118
AF-A0A2W5U2H3-F1-model_v4 YCII-related domain-containing protein 0.7256 52 116
AF-A0A1C4UWN6-F1-model_v4 Uncharacterized conserved protein 0.7246 1 118
AF-A0A6J4MWR9-F1-model_v4 DGPFAETKE family protein 0.7167 2 118

Map