F402700

General Info

Members Datasets Scaffolds Average Seq Length
314 172 628 312

Family's Representative Sequence

Representative Sequence 3300024227|Ga0228598_1001779|Ga0228598_10017792
Length 358
Sequence MDGGSVQSVRRSSRFARIFCPAILAALIIWLAAATAFPADEMTSTIVIGNSRIDVNIESGSMQASKEDLMKWVRWAAESVSAYYGRFPVPQLLLRIVPSDGKGVRGGRTFGRDNGGFITIHVGKDAQFSDLARDWMLTHEMVHLSFPSVAENHHWIEEGIATYVEPIARVRAGHFDANQMWFEVVRDLHQGLPAEGDEGLDHTHTWGRTYWGGALFCFLADIEIHRETGNKKGLEDALRGILNAGGDIRQDWALEKALTIGDQATGVPVLQNLYAKMKNQPYNVDLPALWTELGIERDGNAVKFLDTTPLAKTRDAITYGSAGPTLKPAASAPHNSAIFAGRTTTRFPPDRSNDKSGD

Samples

Sample ID Description Type Environment
1 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
129 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
172 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 1.27
Rhizosphere 96.82
Stem 0
Stem Tuber 0
Unclassified 8.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0228598_1001779 3300024227 Bacteria 4705
2 MBSR1b_contig_7691107 2162886012 Bacteria 2106
3 Ga0065712_10068367 3300005290 Bacteria 11268
4 Ga0065715_10123353 3300005293 Bacteria 2180
5 Ga0070658_10155066 3300005327 Bacteria 1919
6 Ga0070676_10087527 3300005328 Bacteria 1902
7 Ga0070683_100001978 3300005329 Bacteria 16048
8 Ga0070683_100008214 3300005329 Bacteria 8866
9 Ga0070683_100050035 3300005329 Bacteria 3867
10 Ga0070683_100106936 3300005329 Bacteria 2638
11 Ga0070683_100116368 3300005329 Bacteria 2524
12 Ga0070683_100225326 3300005329 Bacteria 1782
13 Ga0070690_100000243 3300005330 Bacteria 28020
14 Ga0070670_100003122 3300005331 Bacteria 13714
15 Ga0070670_100127006 3300005331 Bacteria 2201
16 Ga0068869_100004293 3300005334 Bacteria 8848
17 Ga0068869_100005397 3300005334 Bacteria 8035
18 Ga0070680_100092182 3300005336 Bacteria 2509
19 Ga0068868_100000274 3300005338 Bacteria 34709
20 Ga0070689_100002559 3300005340 Bacteria 11922
21 Ga0070661_100004427 3300005344 Bacteria 9684
22 Ga0070669_100022021 3300005353 Bacteria 4558
23 Ga0070675_100005102 3300005354 Bacteria 10016
24 Ga0070671_100001209 3300005355 Bacteria 19343
25 Ga0070671_100085220 3300005355 Bacteria 2643
26 Ga0070673_100000586 3300005364 Bacteria 19774
27 Ga0070667_100008428 3300005367 Bacteria 8550
28 Ga0070714_100349205 3300005435 Unclassified 1389
29 Ga0070713_100322527 3300005436 Bacteria 1427
30 Ga0070711_100033935 3300005439 Bacteria 3401
31 Ga0070700_100033532 3300005441 Bacteria 3093
32 Ga0070694_100076763 3300005444 Bacteria 2313
33 Ga0070678_100026182 3300005456 Bacteria 3939
34 Ga0070662_100028869 3300005457 Bacteria 3866
35 Ga0070681_10120810 3300005458 Bacteria 2555
36 Ga0068867_100052563 3300005459 Bacteria 3007
37 Ga0070706_100255426 3300005467 Unclassified 1636
38 Ga0070707_100072353 3300005468 Bacteria 3322
39 Ga0070679_100067345 3300005530 Bacteria 3570
40 Ga0070684_100028641 3300005535 Bacteria 4713
41 Ga0070684_100030918 3300005535 Bacteria 4554
42 Ga0070684_100099551 3300005535 Bacteria 2595
43 Ga0070697_100051892 3300005536 Bacteria 3332
44 Ga0070697_100131736 3300005536 Unclassified 2098
45 Ga0068853_100003333 3300005539 Bacteria 12293
46 Ga0070672_100129675 3300005543 Bacteria 2071
47 Ga0070686_100037043 3300005544 Bacteria 3023
48 Ga0070665_100000894 3300005548 Bacteria 38327
49 Ga0070665_100016361 3300005548 Bacteria 7438
50 Ga0070665_100068500 3300005548 Unclassified 3558
51 Ga0068855_100005333 3300005563 Bacteria 15696
52 Ga0068855_100051485 3300005563 Bacteria 4850
53 Ga0068855_100442660 3300005563 Bacteria 1419
54 Ga0070664_100001059 3300005564 Bacteria 21634
55 Ga0068857_100001191 3300005577 Bacteria 20322
56 Ga0068857_100050826 3300005577 Bacteria 3677
57 Ga0068857_100111893 3300005577 Unclassified 2455
58 Ga0068857_100116963 3300005577 Bacteria 2399
59 Ga0068854_100001734 3300005578 Bacteria 13303
60 Ga0068856_100000684 3300005614 Bacteria 36817
61 Ga0068856_100004575 3300005614 Bacteria 13749
62 Ga0068856_100007587 3300005614 Bacteria 10586
63 Ga0068856_100046171 3300005614 Bacteria 4290
64 Ga0070702_100059501 3300005615 Bacteria 2217
65 Ga0068852_100000026 3300005616 Bacteria 114548
66 Ga0068852_100000162 3300005616 Bacteria 44844
67 Ga0068852_100134605 3300005616 Bacteria 2280
68 Ga0068852_100153993 3300005616 Bacteria 2140
69 Ga0068859_100004532 3300005617 Bacteria 14168
70 Ga0068859_100006754 3300005617 Bacteria 11655
71 Ga0068864_100000745 3300005618 Bacteria 27297
72 Ga0068864_100115197 3300005618 Bacteria 2397
73 Ga0068861_100004077 3300005719 Bacteria 9791
74 Ga0068851_10017760 3300005834 Bacteria 3422
75 Ga0068863_100030366 3300005841 Bacteria 5162
76 Ga0068863_100033177 3300005841 Bacteria 4918
77 Ga0068858_100000718 3300005842 Bacteria 34499
78 Ga0068858_100017696 3300005842 Bacteria 6678
79 Ga0068860_100004073 3300005843 Bacteria 14999
80 Ga0068860_100018965 3300005843 Bacteria 6682
81 Ga0068862_100001289 3300005844 Bacteria 23445
82 Ga0068862_100002490 3300005844 Bacteria 16300
83 Ga0068862_100117972 3300005844 Bacteria 2336
84 Ga0070717_10005897 3300006028 Bacteria 8971
85 Ga0070717_10377633 3300006028 Unclassified 1270
86 Ga0070716_100083112 3300006173 Bacteria 1917
87 Ga0070716_100092684 3300006173 Unclassified 1832
88 Ga0070712_100411114 3300006175 Unclassified 1119
89 Ga0097621_100001226 3300006237 Bacteria 17772
90 Ga0097621_100255792 3300006237 Unclassified 1535
91 Ga0068871_100057550 3300006358 Bacteria 3163
92 Ga0068871_100060983 3300006358 Bacteria 3078
93 Ga0068871_100075441 3300006358 Bacteria 2783
94 Ga0075428_100024520 3300006844 Bacteria 6675
95 Ga0075428_100028778 3300006844 Bacteria 6149
96 Ga0075428_100050456 3300006844 Bacteria 4563
97 Ga0075428_100321916 3300006844 Bacteria 1661
98 Ga0075430_100016748 3300006846 Bacteria 6243
99 Ga0075430_100021814 3300006846 Bacteria 5442
100 Ga0075430_100069316 3300006846 Bacteria 2958
101 Ga0075431_100006353 3300006847 Bacteria 11737
102 Ga0075431_100013425 3300006847 Bacteria 8274
103 Ga0075431_100149195 3300006847 Unclassified 2408
104 Ga0075431_100197995 3300006847 Bacteria 2056
105 Ga0075434_100343310 3300006871 Bacteria 1514
106 Ga0075429_100004053 3300006880 Bacteria 12549
107 Ga0075429_100012405 3300006880 Bacteria 7393
108 Ga0097620_100004532 3300006931 Bacteria 14168
109 Ga0097620_100006754 3300006931 Bacteria 11655
110 Ga0105240_10000038 3300009093 Bacteria 270341
111 Ga0105240_10000267 3300009093 Bacteria 103103
112 Ga0105240_10000543 3300009093 Bacteria 69816
113 Ga0105240_10002386 3300009093 Bacteria 30286
114 Ga0105240_10004670 3300009093 Bacteria 20720
115 Ga0105240_10027154 3300009093 Bacteria 7500
116 Ga0105240_10132261 3300009093 Bacteria 2991
117 Ga0105240_10197230 3300009093 Unclassified 2362
118 Ga0105240_10296941 3300009093 Bacteria 1849
119 Ga0105240_10298367 3300009093 Bacteria 1844
120 Ga0111539_10003479 3300009094 Bacteria 20747
121 Ga0111539_10109510 3300009094 Bacteria 3242
122 Ga0105245_10000750 3300009098 Bacteria 29290
123 Ga0105245_10030298 3300009098 Bacteria 4783
124 Ga0105245_10192060 3300009098 Bacteria 1956
125 Ga0105247_10003425 3300009101 Bacteria 10354
126 Ga0114129_10013029 3300009147 Bacteria 11844
127 Ga0114129_10091722 3300009147 Bacteria 4208
128 Ga0114129_10289942 3300009147 Bacteria 2184
129 Ga0105243_10145246 3300009148 Bacteria 2029
130 Ga0105241_10000059 3300009174 Bacteria 83637
131 Ga0105241_10001765 3300009174 Bacteria 16403
132 Ga0105241_10094323 3300009174 Bacteria 2367
133 Ga0105248_10000467 3300009177 Bacteria 46062
134 Ga0105248_10004320 3300009177 Bacteria 15718
135 Ga0105237_10012829 3300009545 Bacteria 8811
136 Ga0105237_10046735 3300009545 Bacteria 4354
137 Ga0105237_10057278 3300009545 Unclassified 3900
138 Ga0105238_10000466 3300009551 Bacteria 42492
139 Ga0105238_10000872 3300009551 Bacteria 31125
140 Ga0105238_10006878 3300009551 Bacteria 11358
141 Ga0105238_10065547 3300009551 Bacteria 3633
142 Ga0105249_10002458 3300009553 Bacteria 16073
143 Ga0105249_10015025 3300009553 Bacteria 6849
144 Ga0105239_10004984 3300010375 Bacteria 15679
145 Ga0105239_10006259 3300010375 Bacteria 13840
146 Ga0105239_10076760 3300010375 Unclassified 3675
147 Ga0105239_10085088 3300010375 Bacteria 3485
148 Ga0105239_10320399 3300010375 Bacteria 1748
149 Ga0105246_10014588 3300011119 Bacteria 4944
150 Ga0157373_10132807 3300013100 Bacteria 1750
151 Ga0157373_10191687 3300013100 Bacteria 1440
152 Ga0157370_10000011 3300013104 Bacteria 212362
153 Ga0157369_10000060 3300013105 Bacteria 152332
154 Ga0157369_10001279 3300013105 Bacteria 31266
155 Ga0157369_10001987 3300013105 Bacteria 24613
156 Ga0157369_10010327 3300013105 Bacteria 10647
157 Ga0157369_10207548 3300013105 Bacteria 2054
158 Ga0157374_10001832 3300013296 Bacteria 17895
159 Ga0157374_10035144 3300013296 Bacteria 4583
160 Ga0157374_10109676 3300013296 Bacteria 2653
161 Ga0157374_10259010 3300013296 Bacteria 1713
162 Ga0157378_10007414 3300013297 Bacteria 9584
163 Ga0163162_10117277 3300013306 Bacteria 2764
164 Ga0163162_10119263 3300013306 Bacteria 2741
165 Ga0163162_10237570 3300013306 Bacteria 1953
166 Ga0157372_10000240 3300013307 Bacteria 60611
167 Ga0157372_10006449 3300013307 Bacteria 12494
168 Ga0157372_10049144 3300013307 Bacteria 4689
169 Ga0157372_10109341 3300013307 Bacteria 3165
170 Ga0157375_10117085 3300013308 Bacteria 2770
171 Ga0157375_10162031 3300013308 Bacteria 2379
172 Ga0163163_10001965 3300014325 Bacteria 17374
173 Ga0163163_10003251 3300014325 Bacteria 13783
174 Ga0157377_10030011 3300014745 Bacteria 2941
175 Ga0157379_10001276 3300014968 Bacteria 20470
176 Ga0157376_10061091 3300014969 Bacteria 3167
177 Ga0157376_10064443 3300014969 Bacteria 3091
178 Ga0157376_10175458 3300014969 Unclassified 1955
179 Ga0224570_100112 3300022730 Bacteria 5066
180 Ga0228598_1001729 3300024227 Bacteria 4778
181 Ga0207656_10027764 3300025321 Bacteria 2318
182 Ga0207710_10000944 3300025900 Bacteria 15386
183 Ga0207645_10045069 3300025907 Bacteria 2819
184 Ga0207654_10000017 3300025911 Bacteria 201589
185 Ga0207654_10000728 3300025911 Bacteria 18352
186 Ga0207695_10000030 3300025913 Bacteria 533735
187 Ga0207695_10000070 3300025913 Bacteria 318111
188 Ga0207695_10000638 3300025913 Bacteria 69789
189 Ga0207695_10000669 3300025913 Bacteria 67530
190 Ga0207695_10002576 3300025913 Bacteria 26614
191 Ga0207695_10011077 3300025913 Bacteria 10951
192 Ga0207695_10115097 3300025913 Bacteria 2664
193 Ga0207695_10133468 3300025913 Bacteria 2438
194 Ga0207695_10140488 3300025913 Unclassified 2364
195 Ga0207671_10000071 3300025914 Bacteria 159699
196 Ga0207671_10003485 3300025914 Bacteria 15653
197 Ga0207671_10022294 3300025914 Bacteria 4789
198 Ga0207671_10063180 3300025914 Bacteria 2751
199 Ga0207671_10291250 3300025914 Unclassified 1289
200 Ga0207663_10313628 3300025916 Bacteria 1176
201 Ga0207649_10004369 3300025920 Bacteria 7670
202 Ga0207649_10022733 3300025920 Bacteria 3623
203 Ga0207681_10094786 3300025923 Unclassified 2139
204 Ga0207694_10000192 3300025924 Bacteria 61988
205 Ga0207694_10000859 3300025924 Bacteria 27018
206 Ga0207650_10001389 3300025925 Bacteria 17468
207 Ga0207650_10063762 3300025925 Bacteria 2756
208 Ga0207659_10008883 3300025926 Bacteria 6263
209 Ga0207687_10006755 3300025927 Bacteria 7558
210 Ga0207687_10077868 3300025927 Bacteria 2385
211 Ga0207644_10024261 3300025931 Bacteria 4161
212 Ga0207644_10085328 3300025931 Bacteria 2342
213 Ga0207706_10043977 3300025933 Bacteria 3958
214 Ga0207706_10106625 3300025933 Bacteria 2466
215 Ga0207670_10028733 3300025936 Bacteria 3535
216 Ga0207669_10311381 3300025937 Bacteria 1201
217 Ga0207665_10243028 3300025939 Unclassified 1327
218 Ga0207691_10039428 3300025940 Bacteria 4370
219 Ga0207689_10004353 3300025942 Bacteria 12896
220 Ga0207661_10038142 3300025944 Bacteria 3764
221 Ga0207661_10048079 3300025944 Bacteria 3388
222 Ga0207679_10002455 3300025945 Bacteria 11413
223 Ga0207667_10000815 3300025949 Bacteria 40351
224 Ga0207667_10004349 3300025949 Bacteria 17348
225 Ga0207667_10014201 3300025949 Bacteria 9087
226 Ga0207712_10038538 3300025961 Bacteria 3269
227 Ga0207668_10085173 3300025972 Bacteria 2305
228 Ga0207658_10001530 3300025986 Bacteria 17971
229 Ga0207677_10000986 3300026023 Bacteria 15683
230 Ga0207703_10020941 3300026035 Bacteria 5116
231 Ga0207703_10104879 3300026035 Bacteria 2402
232 Ga0207703_10218412 3300026035 Bacteria 1703
233 Ga0207639_10000113 3300026041 Bacteria 62522
234 Ga0207708_10048369 3300026075 Bacteria 3237
235 Ga0207708_10164506 3300026075 Bacteria 1753
236 Ga0207702_10005318 3300026078 Bacteria 11293
237 Ga0207702_10005718 3300026078 Bacteria 10840
238 Ga0207641_10001559 3300026088 Bacteria 22459
239 Ga0207641_10016673 3300026088 Bacteria 6014
240 Ga0207676_10025736 3300026095 Bacteria 4368
241 Ga0207674_10000764 3300026116 Bacteria 42010
242 Ga0207674_10013375 3300026116 Bacteria 9110
243 Ga0207674_10066586 3300026116 Bacteria 3628
244 Ga0207674_10132471 3300026116 Unclassified 2455
245 Ga0207675_100030502 3300026118 Bacteria 5023
246 Ga0207675_100043074 3300026118 Bacteria 4216
247 Ga0207683_10042282 3300026121 Bacteria 3980
248 Ga0207698_10000010 3300026142 Bacteria 270583
249 Ga0207698_10000273 3300026142 Bacteria 31333
250 Ga0207698_10038987 3300026142 Bacteria 3516
251 Ga0207698_10125793 3300026142 Bacteria 2179
252 Ga0207428_10007672 3300027907 Bacteria 9821
253 Ga0207428_10095480 3300027907 Bacteria 2303
254 Ga0207428_10172981 3300027907 Unclassified 1635
255 Ga0265354_1004203 3300028016 Bacteria 1530
256 Ga0265356_1000727 3300028017 Bacteria 5609
257 Ga0268266_10002272 3300028379 Bacteria 20880
258 Ga0268266_10020099 3300028379 Bacteria 5692
259 Ga0268266_10114316 3300028379 Unclassified 2395
260 Ga0268266_10475620 3300028379 Bacteria 1190
261 Ga0268265_10000310 3300028380 Bacteria 54158
262 Ga0268265_10024424 3300028380 Bacteria 4275
263 Ga0268264_10000331 3300028381 Bacteria 73935
264 Ga0268264_10010820 3300028381 Bacteria 7536
265 Ga0265334_10019746 3300028573 Bacteria 2768
266 Ga0307515_10017070 3300028794 Bacteria 13252
267 Ga0265765_1002925 3300030879 Unclassified 1688
268 Ga0265760_10003158 3300031090 Bacteria 4817
269 Ga0265760_10037466 3300031090 Bacteria 1440
270 Ga0265320_10011531 3300031240 Bacteria 5194
271 Ga0265340_10007652 3300031247 Bacteria 5860
272 Ga0265331_10017954 3300031250 Bacteria 3679
273 Ga0307408_100054495 3300031548 Bacteria 2892
274 Ga0307405_10203764 3300031731 Bacteria 1439
275 Ga0307412_10049022 3300031911 Bacteria 2781
276 Ga0373940_0024709 3300035088 Bacteria 1560
277 Ga0373949_0008230 3300035090 Bacteria 2283
278 Ga0373954_0111704 3300035118 Bacteria 1322
279 Ga0373955_0020312 3300035172 Bacteria 3337
280 Ga0373931_0124677 3300035691 Bacteria 1476
281 Ga0373935_0065489 3300035692 Bacteria 2332
282 Ga0373927_0011866 3300035695 Bacteria 5804
283 Ga0436364_0394271 3300037853 Bacteria 2628
284 Ga0466969_0003994 3300044656 Bacteria 7827
285 Ga0466963_0004875 3300044694 Bacteria 7822
286 Ga0466959_0023852 3300045049 Bacteria 4528
287 Ga0495580_0001153 3300046472 Bacteria 23240
288 Ga0495665_0045926 3300046531 Bacteria 2320
289 Ga0495674_0042575 3300047319 Bacteria 4049
290 Ga0495684_0033363 3300047471 Unclassified 3949
291 Ga0495686_0003309 3300047472 Bacteria 14066
292 Ga0496105_0008004 3300048908 Bacteria 8212
293 Ga0496106_0031489 3300048909 Bacteria 3953
294 Ga0496109_0020321 3300048912 Bacteria 5865
295 Ga0496110_0022260 3300048913 Bacteria 5379
296 Ga0496118_0047370 3300048921 Bacteria 3332
297 Ga0496126_0002850 3300048929 Bacteria 22616
298 Ga0501034_0033103 3300049571 Bacteria 5248
299 nmdc:mga05p37_14773_c1 3300050507 Bacteria 8590
300 nmdc:mga05p37_401830_c1 3300050507 Unclassified 1599
301 nmdc:mga05p37_58086_c1 3300050507 Unclassified 4765
302 nmdc:mga09592_2457_c1 3300050508 Bacteria 14954
303 nmdc:mga09592_49425_c1 3300050508 Unclassified 3546
304 nmdc:mga0qj67_102106_c1 3300050509 Bacteria 2312
305 nmdc:mga0qj67_5098_c1 3300050509 Bacteria 9560
306 nmdc:mga06r32_1027_c1 3300050510 Bacteria 25122
307 nmdc:mga06r32_16759_c1 3300050510 Bacteria 6680
308 nmdc:mga06r32_19652_c1 3300050510 Bacteria 6205
309 nmdc:mga06r32_344746_c1 3300050510 Bacteria 1474
310 nmdc:mga06r32_541040_c1 3300050510 Bacteria 1139
311 nmdc:mga08y16_149407_c1 3300050511 Bacteria 2429
312 nmdc:mga08y16_6357_c1 3300050511 Bacteria 12391
313 Ga0500583_0075406 3300053092 Bacteria 1620
314 Ga0500637_0086574 3300053178 Bacteria 1812
315 Ga0228598_1001779
316 MBSR1b_contig_7691107
317 Ga0065712_10068367
318 Ga0065715_10123353
319 Ga0070658_10155066
320 Ga0070676_10087527
321 Ga0070683_100001978
322 Ga0070683_100008214
323 Ga0070683_100050035
324 Ga0070683_100106936
325 Ga0070683_100116368
326 Ga0070683_100225326
327 Ga0070690_100000243
328 Ga0070670_100003122
329 Ga0070670_100127006
330 Ga0068869_100004293
331 Ga0068869_100005397
332 Ga0070680_100092182
333 Ga0068868_100000274
334 Ga0070689_100002559
335 Ga0070661_100004427
336 Ga0070669_100022021
337 Ga0070675_100005102
338 Ga0070671_100001209
339 Ga0070671_100085220
340 Ga0070673_100000586
341 Ga0070667_100008428
342 Ga0070714_100349205
343 Ga0070713_100322527
344 Ga0070711_100033935
345 Ga0070700_100033532
346 Ga0070694_100076763
347 Ga0070678_100026182
348 Ga0070662_100028869
349 Ga0070681_10120810
350 Ga0068867_100052563
351 Ga0070706_100255426
352 Ga0070707_100072353
353 Ga0070679_100067345
354 Ga0070684_100028641
355 Ga0070684_100030918
356 Ga0070684_100099551
357 Ga0070697_100051892
358 Ga0070697_100131736
359 Ga0068853_100003333
360 Ga0070672_100129675
361 Ga0070686_100037043
362 Ga0070665_100000894
363 Ga0070665_100016361
364 Ga0070665_100068500
365 Ga0068855_100005333
366 Ga0068855_100051485
367 Ga0068855_100442660
368 Ga0070664_100001059
369 Ga0068857_100001191
370 Ga0068857_100050826
371 Ga0068857_100111893
372 Ga0068857_100116963
373 Ga0068854_100001734
374 Ga0068856_100000684
375 Ga0068856_100004575
376 Ga0068856_100007587
377 Ga0068856_100046171
378 Ga0070702_100059501
379 Ga0068852_100000026
380 Ga0068852_100000162
381 Ga0068852_100134605
382 Ga0068852_100153993
383 Ga0068859_100004532
384 Ga0068859_100006754
385 Ga0068864_100000745
386 Ga0068864_100115197
387 Ga0068861_100004077
388 Ga0068851_10017760
389 Ga0068863_100030366
390 Ga0068863_100033177
391 Ga0068858_100000718
392 Ga0068858_100017696
393 Ga0068860_100004073
394 Ga0068860_100018965
395 Ga0068862_100001289
396 Ga0068862_100002490
397 Ga0068862_100117972
398 Ga0070717_10005897
399 Ga0070717_10377633
400 Ga0070716_100083112
401 Ga0070716_100092684
402 Ga0070712_100411114
403 Ga0097621_100001226
404 Ga0097621_100255792
405 Ga0068871_100057550
406 Ga0068871_100060983
407 Ga0068871_100075441
408 Ga0075428_100024520
409 Ga0075428_100028778
410 Ga0075428_100050456
411 Ga0075428_100321916
412 Ga0075430_100016748
413 Ga0075430_100021814
414 Ga0075430_100069316
415 Ga0075431_100006353
416 Ga0075431_100013425
417 Ga0075431_100149195
418 Ga0075431_100197995
419 Ga0075434_100343310
420 Ga0075429_100004053
421 Ga0075429_100012405
422 Ga0097620_100004532
423 Ga0097620_100006754
424 Ga0105240_10000038
425 Ga0105240_10000267
426 Ga0105240_10000543
427 Ga0105240_10002386
428 Ga0105240_10004670
429 Ga0105240_10027154
430 Ga0105240_10132261
431 Ga0105240_10197230
432 Ga0105240_10296941
433 Ga0105240_10298367
434 Ga0111539_10003479
435 Ga0111539_10109510
436 Ga0105245_10000750
437 Ga0105245_10030298
438 Ga0105245_10192060
439 Ga0105247_10003425
440 Ga0114129_10013029
441 Ga0114129_10091722
442 Ga0114129_10289942
443 Ga0105243_10145246
444 Ga0105241_10000059
445 Ga0105241_10001765
446 Ga0105241_10094323
447 Ga0105248_10000467
448 Ga0105248_10004320
449 Ga0105237_10012829
450 Ga0105237_10046735
451 Ga0105237_10057278
452 Ga0105238_10000466
453 Ga0105238_10000872
454 Ga0105238_10006878
455 Ga0105238_10065547
456 Ga0105249_10002458
457 Ga0105249_10015025
458 Ga0105239_10004984
459 Ga0105239_10006259
460 Ga0105239_10076760
461 Ga0105239_10085088
462 Ga0105239_10320399
463 Ga0105246_10014588
464 Ga0157373_10132807
465 Ga0157373_10191687
466 Ga0157370_10000011
467 Ga0157369_10000060
468 Ga0157369_10001279
469 Ga0157369_10001987
470 Ga0157369_10010327
471 Ga0157369_10207548
472 Ga0157374_10001832
473 Ga0157374_10035144
474 Ga0157374_10109676
475 Ga0157374_10259010
476 Ga0157378_10007414
477 Ga0163162_10117277
478 Ga0163162_10119263
479 Ga0163162_10237570
480 Ga0157372_10000240
481 Ga0157372_10006449
482 Ga0157372_10049144
483 Ga0157372_10109341
484 Ga0157375_10117085
485 Ga0157375_10162031
486 Ga0163163_10001965
487 Ga0163163_10003251
488 Ga0157377_10030011
489 Ga0157379_10001276
490 Ga0157376_10061091
491 Ga0157376_10064443
492 Ga0157376_10175458
493 Ga0224570_100112
494 Ga0228598_1001729
495 Ga0207656_10027764
496 Ga0207710_10000944
497 Ga0207645_10045069
498 Ga0207654_10000017
499 Ga0207654_10000728
500 Ga0207695_10000030
501 Ga0207695_10000070
502 Ga0207695_10000638
503 Ga0207695_10000669
504 Ga0207695_10002576
505 Ga0207695_10011077
506 Ga0207695_10115097
507 Ga0207695_10133468
508 Ga0207695_10140488
509 Ga0207671_10000071
510 Ga0207671_10003485
511 Ga0207671_10022294
512 Ga0207671_10063180
513 Ga0207671_10291250
514 Ga0207663_10313628
515 Ga0207649_10004369
516 Ga0207649_10022733
517 Ga0207681_10094786
518 Ga0207694_10000192
519 Ga0207694_10000859
520 Ga0207650_10001389
521 Ga0207650_10063762
522 Ga0207659_10008883
523 Ga0207687_10006755
524 Ga0207687_10077868
525 Ga0207644_10024261
526 Ga0207644_10085328
527 Ga0207706_10043977
528 Ga0207706_10106625
529 Ga0207670_10028733
530 Ga0207669_10311381
531 Ga0207665_10243028
532 Ga0207691_10039428
533 Ga0207689_10004353
534 Ga0207661_10038142
535 Ga0207661_10048079
536 Ga0207679_10002455
537 Ga0207667_10000815
538 Ga0207667_10004349
539 Ga0207667_10014201
540 Ga0207712_10038538
541 Ga0207668_10085173
542 Ga0207658_10001530
543 Ga0207677_10000986
544 Ga0207703_10020941
545 Ga0207703_10104879
546 Ga0207703_10218412
547 Ga0207639_10000113
548 Ga0207708_10048369
549 Ga0207708_10164506
550 Ga0207702_10005318
551 Ga0207702_10005718
552 Ga0207641_10001559
553 Ga0207641_10016673
554 Ga0207676_10025736
555 Ga0207674_10000764
556 Ga0207674_10013375
557 Ga0207674_10066586
558 Ga0207674_10132471
559 Ga0207675_100030502
560 Ga0207675_100043074
561 Ga0207683_10042282
562 Ga0207698_10000010
563 Ga0207698_10000273
564 Ga0207698_10038987
565 Ga0207698_10125793
566 Ga0207428_10007672
567 Ga0207428_10095480
568 Ga0207428_10172981
569 Ga0265354_1004203
570 Ga0265356_1000727
571 Ga0268266_10002272
572 Ga0268266_10020099
573 Ga0268266_10114316
574 Ga0268266_10475620
575 Ga0268265_10000310
576 Ga0268265_10024424
577 Ga0268264_10000331
578 Ga0268264_10010820
579 Ga0265334_10019746
580 Ga0307515_10017070
581 Ga0265765_1002925
582 Ga0265760_10003158
583 Ga0265760_10037466
584 Ga0265320_10011531
585 Ga0265340_10007652
586 Ga0265331_10017954
587 Ga0307408_100054495
588 Ga0307405_10203764
589 Ga0307412_10049022
590 Ga0373940_0024709
591 Ga0373949_0008230
592 Ga0373954_0111704
593 Ga0373955_0020312
594 Ga0373931_0124677
595 Ga0373935_0065489
596 Ga0373927_0011866
597 Ga0436364_0394271
598 Ga0466969_0003994
599 Ga0466963_0004875
600 Ga0466959_0023852
601 Ga0495580_0001153
602 Ga0495665_0045926
603 Ga0495674_0042575
604 Ga0495684_0033363
605 Ga0495686_0003309
606 Ga0496105_0008004
607 Ga0496106_0031489
608 Ga0496109_0020321
609 Ga0496110_0022260
610 Ga0496118_0047370
611 Ga0496126_0002850
612 Ga0501034_0033103
613 nmdc:mga05p37_14773_c1
614 nmdc:mga05p37_401830_c1
615 nmdc:mga05p37_58086_c1
616 nmdc:mga09592_2457_c1
617 nmdc:mga09592_49425_c1
618 nmdc:mga0qj67_102106_c1
619 nmdc:mga0qj67_5098_c1
620 nmdc:mga06r32_1027_c1
621 nmdc:mga06r32_16759_c1
622 nmdc:mga06r32_19652_c1
623 nmdc:mga06r32_344746_c1
624 nmdc:mga06r32_541040_c1
625 nmdc:mga08y16_149407_c1
626 nmdc:mga08y16_6357_c1
627 Ga0500583_0075406
628 Ga0500637_0086574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fgm-assembly1.cif.gz_A crystal structure of the aminopeptidase n family protein q5qty1 from idiomarina loihiensis. northeast structural genomics consortium target ilr60. 0.738 30 282
7xyo-assembly1.cif.gz_A crystal structure of a m61 aminopeptidase family member from myxococcus fulvus 0.6826 29 276
3q7j-assembly2.cif.gz_B engineered thermoplasma acidophilum f3 factor mimics human aminopeptidase n (apn) as a target for anticancer drug development 0.6764 31 271
7p7p-assembly2.cif.gz_B crystal structure of erap2 aminopeptidase in complex with phosphinic pseudotripeptide((1r)-1-amino-3-phenylpropyl){(2s)-3-[((2s)-1-amino-1-oxo-3-phenylpropan-2-yl)amino]-2-{[3-(2-hydroxyphenyl)-isoxazol-5-yl]methyl}-3-oxopropyl}phosphinic acid 0.6734 31 269
4kxa-assembly1.cif.gz_A crystal structure of human aminopeptidase a complexed with aspartate and calcium 0.6723 31 266
ID Description Score Start End Superfamily
af_I1K8E3_209_456_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.7114 31 267 1.10.390.10
4fgmA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.71 30 267 1.10.390.10
af_Q9VD87_240_494_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.6975 32 267 1.10.390.10
af_Q8SWX4_261_515_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.6957 31 269 1.10.390.10
af_Q557I4_333_589_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.6956 43 269 1.10.390.10
ID Description Score Start End GO Terms
AF-A0A0R3KMD1-F1-model_v4 Peptidase M61 catalytic domain-containing protein 0.9882 125 307
AF-A0A0K1E9C2-F1-model_v4 Peptidase M61 catalytic domain-containing protein 0.9874 31 305
AF-A0A1F6UWX1-F1-model_v4 Peptidase M61 catalytic domain-containing protein 0.9862 31 306
AF-A0A6B9YN15-F1-model_v4 M1 family metallopeptidase 0.9857 84 307
AF-A0A496WH89-F1-model_v4 Peptidase M61 catalytic domain-containing protein 0.9832 30 307

Map