F402659

General Info

Members Datasets Scaffolds Average Seq Length
314 225 628 166

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10345477|Ga0105247_103454771
Length 199
Sequence MGEACKGRLGDNTPDRPPIQWRLGSPASRDAVTFTAAKRYDFRDQAGDYAGLADELRGLLSGESDLVANAANMSALLFDALPDLNWAGFYFLKRGELVVGPFQGKPACVRIALGKGVCGTAAQERRTIVVPDVNAFPGHIACDAASQSEIVVPLIVGGKVLGVLDIDSPRLARFNEGDARGLERMVSIFLDSIRIEDVA

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
106 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
107 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
194 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
199 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
200 2554235283 Bacillus safensis VK Isolate Rhizosphere
201 2643221735 Bacillus sp. Root920 Isolate Unclassified
202 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
203 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
204 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
205 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
206 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
207 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
208 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
209 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
210 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
211 2811994870 Bacillus sp. JB4 Isolate Unclassified
212 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
213 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
214 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
215 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
216 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
217 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
218 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
219 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
220 2919726948 Bacillus pumilus 4489 Isolate Unclassified
221 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
222 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
223 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
224 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
225 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.85
Metatranscriptomes 2.87
Isolates 8.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.69
Nodule 0.96
Rhizoplane 5.41
Rhizosphere 71.97
Stem 0
Stem Tuber 0
Unclassified 0.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10345477 3300009101 Unclassified 1045
2 JGI24740J21852_10014161 3300001979 Bacteria 2953
3 JGI24739J22299_10041146 3300001989 Bacteria 1539
4 JGI24737J22298_10025998 3300001990 Bacteria 1849
5 JGI24735J21928_10068337 3300002067 Bacteria 1019
6 JGI24735J21928_10069710 3300002067 Bacteria 1007
7 JGI25156J39149_1000439 3300002705 Bacteria 25558
8 JGI25151J46595_10005743 3300003187 Bacteria 6359
9 JGI25151J46595_10008940 3300003187 Bacteria 4778
10 rootH1_10001445 3300003316 Bacteria 56583
11 rootH2_10136565 3300003320 Bacteria 2495
12 rootL2_10013974 3300003322 Bacteria 148551
13 rootH1_10145346 3300003323 Bacteria 3100
14 rootH1_10146971 3300003323 Bacteria 2918
15 Ga0006562J51391_1003764 3300003578 Bacteria 927
16 Ga0055538_1000947 3300003751 Bacteria 6943
17 Ga0055532_1008590 3300003758 Bacteria 1270
18 Ga0055528_1001852 3300003790 Bacteria 12054
19 Ga0070658_10247442 3300005327 Bacteria 1512
20 Ga0068869_100009338 3300005334 Bacteria 6361
21 Ga0070680_100042238 3300005336 Bacteria 3699
22 Ga0070680_100282778 3300005336 Bacteria 1406
23 Ga0070682_100000058 3300005337 Bacteria 108660
24 Ga0070682_101225142 3300005337 Bacteria 634
25 Ga0070660_100175417 3300005339 Bacteria 1733
26 Ga0070660_100532547 3300005339 Bacteria 979
27 Ga0070691_10204359 3300005341 Bacteria 1039
28 Ga0070692_10811964 3300005345 Bacteria 639
29 Ga0070671_100012395 3300005355 Bacteria 6865
30 Ga0070663_100132528 3300005455 Bacteria 1894
31 Ga0070662_100206033 3300005457 Bacteria 1563
32 Ga0070681_10012315 3300005458 Bacteria 8480
33 Ga0070681_10027983 3300005458 Bacteria 5667
34 Ga0070681_10078289 3300005458 Bacteria 3263
35 Ga0070685_10494080 3300005466 Bacteria 865
36 Ga0070679_100001538 3300005530 Bacteria 20571
37 Ga0070679_100032044 3300005530 Bacteria 5197
38 Ga0070679_100249132 3300005530 Bacteria 1733
39 Ga0070672_100082199 3300005543 Bacteria 2584
40 Ga0070672_101043651 3300005543 Bacteria 725
41 Ga0070665_100000547 3300005548 Bacteria 52634
42 Ga0070665_100133033 3300005548 Bacteria 2489
43 Ga0068855_100014554 3300005563 Bacteria 9476
44 Ga0068855_100047691 3300005563 Bacteria 5060
45 Ga0068855_100069167 3300005563 Bacteria 4109
46 Ga0068857_100255701 3300005577 Bacteria 1607
47 Ga0068856_100993813 3300005614 Bacteria 857
48 Ga0068858_100147682 3300005842 Bacteria 2209
49 Ga0068860_100705329 3300005843 Bacteria 1019
50 Ga0068862_101643995 3300005844 Bacteria 650
51 Ga0075428_100750863 3300006844 Bacteria 1038
52 Ga0105251_10245679 3300009011 Bacteria 806
53 Ga0105244_10049079 3300009036 Bacteria 2158
54 Ga0105250_10255952 3300009092 Bacteria 749
55 Ga0105240_10002956 3300009093 Bacteria 26781
56 Ga0105240_10027153 3300009093 Bacteria 7500
57 Ga0105240_10159499 3300009093 Bacteria 2681
58 Ga0105240_10214327 3300009093 Bacteria 2248
59 Ga0105240_11469173 3300009093 Bacteria 715
60 Ga0111539_10796808 3300009094 Bacteria 1100
61 Ga0105245_10777555 3300009098 Bacteria 994
62 Ga0105247_10005798 3300009101 Bacteria 7730
63 Ga0105243_10181081 3300009148 Bacteria 1833
64 Ga0105242_10007418 3300009176 Bacteria 8443
65 Ga0105237_10198789 3300009545 Bacteria 2004
66 Ga0105237_10288630 3300009545 Bacteria 1643
67 Ga0105237_10774971 3300009545 Bacteria 966
68 Ga0105237_10816408 3300009545 Bacteria 939
69 Ga0105238_10002575 3300009551 Bacteria 18089
70 Ga0105238_10069353 3300009551 Bacteria 3526
71 Ga0105238_10334861 3300009551 Bacteria 1501
72 Ga0105249_10019166 3300009553 Bacteria 6101
73 Ga0105249_11020385 3300009553 Bacteria 896
74 Ga0105239_10305539 3300010375 Bacteria 1792
75 Ga0105239_10332540 3300010375 Bacteria 1714
76 Ga0105246_10000909 3300011119 Bacteria 16953
77 Ga0157371_10008397 3300013102 Bacteria 8230
78 Ga0157370_10001137 3300013104 Bacteria 33243
79 Ga0157370_10195189 3300013104 Bacteria 1879
80 Ga0157369_10001388 3300013105 Bacteria 29820
81 Ga0157369_10008496 3300013105 Bacteria 11774
82 Ga0157369_10017029 3300013105 Bacteria 8167
83 Ga0157369_10064540 3300013105 Bacteria 3943
84 Ga0157378_10003349 3300013297 Bacteria 14260
85 Ga0157372_10029610 3300013307 Bacteria 5981
86 Ga0163163_11311855 3300014325 Unclassified 786
87 Ga0157380_10007450 3300014326 Bacteria 7771
88 Ga0157380_10386264 3300014326 Bacteria 1323
89 Ga0182008_10019771 3300014497 Bacteria 3472
90 Ga0157377_10073612 3300014745 Bacteria 1980
91 Ga0206356_11502887 3300020070 Bacteria 1753
92 Ga0209147_100231 3300025229 Bacteria 55288
93 Ga0209759_1000250 3300025256 Bacteria 80232
94 Ga0209673_1004662 3300025273 Bacteria 7247
95 Ga0209673_1077984 3300025273 Bacteria 767
96 Ga0209025_1000001 3300025294 Bacteria 1888151
97 Ga0209025_1087097 3300025294 Bacteria 1035
98 Ga0209025_1104384 3300025294 Bacteria 887
99 Ga0209025_1104546 3300025294 Bacteria 886
100 Ga0207696_1001406 3300025711 Bacteria 13145
101 Ga0207696_1130326 3300025711 Bacteria 676
102 Ga0207655_1031673 3300025728 Bacteria 2432
103 Ga0207655_1031677 3300025728 Bacteria 2432
104 Ga0207713_1001085 3300025735 Bacteria 23381
105 Ga0207647_10051809 3300025904 Bacteria 2535
106 Ga0207684_10000760 3300025910 Bacteria 37561
107 Ga0207707_10000390 3300025912 Bacteria 45829
108 Ga0207707_10014515 3300025912 Bacteria 6859
109 Ga0207707_10051572 3300025912 Bacteria 3583
110 Ga0207695_10015874 3300025913 Bacteria 8847
111 Ga0207695_10040708 3300025913 Bacteria 4979
112 Ga0207695_10372925 3300025913 Bacteria 1313
113 Ga0207695_10636469 3300025913 Bacteria 948
114 Ga0207695_10721380 3300025913 Bacteria 877
115 Ga0207671_10118312 3300025914 Bacteria 2023
116 Ga0207671_10373821 3300025914 Bacteria 1132
117 Ga0207671_10915151 3300025914 Bacteria 693
118 Ga0207693_10589037 3300025915 Bacteria 866
119 Ga0207660_10026804 3300025917 Bacteria 3927
120 Ga0207660_10228931 3300025917 Bacteria 1461
121 Ga0207657_10400602 3300025919 Bacteria 1079
122 Ga0207657_10912825 3300025919 Bacteria 676
123 Ga0207652_10000362 3300025921 Bacteria 47186
124 Ga0207652_10172112 3300025921 Bacteria 1943
125 Ga0207652_10387781 3300025921 Bacteria 1261
126 Ga0207652_10514884 3300025921 Bacteria 1077
127 Ga0207694_10011694 3300025924 Bacteria 6620
128 Ga0207694_10275607 3300025924 Bacteria 1381
129 Ga0207664_10200919 3300025929 Bacteria 1720
130 Ga0207644_10052071 3300025931 Bacteria 2941
131 Ga0207709_10138848 3300025935 Bacteria 1668
132 Ga0207670_10019064 3300025936 Bacteria 4182
133 Ga0207691_10014624 3300025940 Bacteria 7481
134 Ga0207689_10022925 3300025942 Bacteria 5244
135 Ga0207667_10002859 3300025949 Bacteria 21419
136 Ga0207667_10036586 3300025949 Bacteria 5260
137 Ga0207667_10290764 3300025949 Bacteria 1670
138 Ga0207667_10887107 3300025949 Bacteria 884
139 Ga0207651_10892851 3300025960 Bacteria 791
140 Ga0207651_10940707 3300025960 Bacteria 771
141 Ga0207678_10123105 3300026067 Bacteria 2213
142 Ga0207702_10412947 3300026078 Bacteria 1304
143 Ga0207674_10086108 3300026116 Bacteria 3137
144 Ga0207683_10373270 3300026121 Bacteria 1310
145 Ga0207683_10398639 3300026121 Bacteria 1266
146 Ga0207698_11502288 3300026142 Bacteria 689
147 Ga0268266_10000434 3300028379 Bacteria 62882
148 Ga0268266_10220586 3300028379 Bacteria 1743
149 Ga0268266_10248084 3300028379 Bacteria 1646
150 Ga0265338_10073810 3300028800 Bacteria 2906
151 Ga0265340_10001160 3300031247 Bacteria 15082
152 Ga0307408_100309512 3300031548 Bacteria 1326
153 Ga0265313_10092128 3300031595 Bacteria 1359
154 Ga0307412_10000005 3300031911 Bacteria 526194
155 Ga0307412_11009703 3300031911 Bacteria 735
156 Ga0307409_100333467 3300031995 Bacteria 1424
157 Ga0307416_102079769 3300032002 Bacteria 670
158 Ga0307411_10016517 3300032005 Bacteria 4180
159 Ga0307510_10035120 3300033180 Bacteria 5603
160 Ga0373923_0048651 3300035111 Bacteria 1771
161 Ga0373946_0369527 3300035171 Bacteria 720
162 Ga0395898_0008462 3300037466 Bacteria 10872
163 Ga0395898_0009096 3300037466 Bacteria 10461
164 Ga0395898_0534393 3300037466 Bacteria 1114
165 Ga0436365_1054294 3300039437 Bacteria 2056
166 Ga0451795_0094759 3300041456 Bacteria 620
167 Ga0451800_1363794 3300041459 Bacteria 1031
168 Ga0451807_0327217 3300041486 Bacteria 1064
169 Ga0466965_0374022 3300044683 Bacteria 784
170 Ga0466966_0059469 3300044684 Bacteria 2413
171 Ga0466961_0077899 3300044693 Bacteria 2099
172 Ga0466964_0267359 3300044706 Bacteria 849
173 Ga0466971_0098468 3300044719 Bacteria 1342
174 Ga0466970_0089539 3300044765 Bacteria 1669
175 Ga0466957_0128838 3300044842 Bacteria 1619
176 Ga0466957_0165013 3300044842 Bacteria 1440
177 Ga0466959_0049433 3300045049 Bacteria 3089
178 Ga0466959_0303597 3300045049 Bacteria 1093
179 Ga0495603_0022682 3300046455 Bacteria 3798
180 Ga0495651_0202439 3300046462 Bacteria 1388
181 Ga0495651_0227842 3300046462 Bacteria 1285
182 Ga0495650_0002510 3300046471 Bacteria 14698
183 Ga0495580_0000760 3300046472 Bacteria 27683
184 Ga0495605_0016838 3300046474 Bacteria 3949
185 Ga0495584_0012691 3300046491 Bacteria 4300
186 Ga0495585_0004179 3300046492 Bacteria 9428
187 Ga0495596_0016406 3300046500 Bacteria 3077
188 Ga0495606_0016271 3300046507 Bacteria 5679
189 Ga0495606_0154036 3300046507 Bacteria 1346
190 Ga0495610_0007838 3300046512 Bacteria 7029
191 Ga0495610_0266534 3300046512 Unclassified 672
192 Ga0495628_0075465 3300046516 Bacteria 2625
193 Ga0495631_0087696 3300046518 Bacteria 1340
194 Ga0495648_0435618 3300046524 Bacteria 577
195 Ga0495663_0000946 3300046525 Bacteria 9688
196 Ga0495666_0234880 3300046526 Bacteria 837
197 Ga0495642_0098250 3300046528 Bacteria 1244
198 Ga0495652_0407302 3300046529 Bacteria 961
199 Ga0495598_0001080 3300046537 Bacteria 5222
200 Ga0495621_0000858 3300046539 Bacteria 7729
201 Ga0495621_0038336 3300046539 Bacteria 1671
202 Ga0495597_0085143 3300046542 Bacteria 1347
203 Ga0495668_0085231 3300046616 Bacteria 1733
204 Ga0495634_0180842 3300046642 Bacteria 1320
205 Ga0495611_0284869 3300046648 Bacteria 763
206 Ga0495625_0065778 3300046660 Bacteria 2555
207 Ga0495661_0040278 3300046665 Bacteria 2899
208 Ga0495657_0196556 3300046675 Bacteria 1231
209 Ga0495599_0011636 3300046678 Bacteria 5413
210 Ga0495599_0072096 3300046678 Bacteria 2155
211 Ga0495623_0002170 3300046679 Bacteria 13077
212 Ga0495646_0040733 3300046680 Bacteria 2859
213 Ga0495624_0011548 3300046690 Bacteria 6069
214 Ga0495670_0215500 3300046691 Bacteria 1019
215 Ga0495649_0018760 3300046694 Bacteria 3886
216 Ga0495649_0264925 3300046694 Bacteria 880
217 Ga0495589_0110562 3300046794 Bacteria 1326
218 Ga0495600_0181314 3300046809 Bacteria 1357
219 Ga0495604_0001173 3300047317 Bacteria 21652
220 Ga0495604_0413723 3300047317 Bacteria 886
221 Ga0495674_0037625 3300047319 Bacteria 4348
222 Ga0495680_0040642 3300047322 Bacteria 3704
223 Ga0495683_0003213 3300047323 Bacteria 9547
224 Ga0495683_0033754 3300047323 Bacteria 2602
225 Ga0495683_0065689 3300047323 Bacteria 1789
226 Ga0495687_007343 3300047443 Bacteria 6509
227 Ga0495687_190492 3300047443 Bacteria 661
228 Ga0495675_0019621 3300047444 Bacteria 4294
229 Ga0495684_0023016 3300047471 Bacteria 4792
230 Ga0495686_0047570 3300047472 Bacteria 2708
231 Ga0495602_0046895 3300048088 Bacteria 3898
232 Ga0495602_0268206 3300048088 Bacteria 1263
233 Ga0495614_0138510 3300048089 Bacteria 1081
234 Ga0496100_0002065 3300048903 Bacteria 10091
235 Ga0496101_0001813 3300048904 Bacteria 12871
236 Ga0496103_0002340 3300048906 Bacteria 11974
237 Ga0496103_0337525 3300048906 Bacteria 969
238 Ga0496104_0001243 3300048907 Bacteria 21946
239 Ga0496105_0000266 3300048908 Bacteria 34749
240 Ga0496106_0001528 3300048909 Bacteria 17394
241 Ga0496107_0000213 3300048910 Bacteria 30470
242 Ga0496108_0001891 3300048911 Bacteria 16781
243 Ga0496109_0000475 3300048912 Bacteria 34137
244 Ga0496111_0009739 3300048914 Bacteria 6422
245 Ga0496111_1156691 3300048914 Bacteria 550
246 Ga0496112_0002950 3300048915 Bacteria 13877
247 Ga0496116_0077787 3300048919 Bacteria 2071
248 Ga0496116_0103052 3300048919 Bacteria 1699
249 Ga0496116_0266336 3300048919 Bacteria 841
250 Ga0496117_0049264 3300048920 Bacteria 2998
251 Ga0496119_0004308 3300048922 Bacteria 14214
252 Ga0496119_0005826 3300048922 Bacteria 11645
253 Ga0496120_0049254 3300048923 Bacteria 2419
254 Ga0496120_0052260 3300048923 Bacteria 2328
255 Ga0496120_0419293 3300048923 Bacteria 588
256 Ga0496121_0047883 3300048924 Bacteria 3642
257 Ga0496121_0606116 3300048924 Bacteria 675
258 Ga0496122_0079475 3300048925 Bacteria 2291
259 Ga0496123_0091839 3300048926 Bacteria 1799
260 Ga0496124_0058698 3300048927 Bacteria 3235
261 Ga0496125_0007791 3300048928 Bacteria 11326
262 Ga0496125_0013927 3300048928 Bacteria 7866
263 Ga0496125_0299450 3300048928 Bacteria 986
264 Ga0496126_0001253 3300048929 Bacteria 41064
265 Ga0496126_0001943 3300048929 Bacteria 29458
266 Ga0496126_0010599 3300048929 Bacteria 9642
267 Ga0496126_0146602 3300048929 Bacteria 2027
268 Ga0496126_0188234 3300048929 Bacteria 1749
269 Ga0501306_048135 3300049127 Bacteria 678
270 Ga0501305_059676 3300049161 Bacteria 654
271 Ga0501312_005660 3300049528 Bacteria 1528
272 Ga0501316_034887 3300049532 Bacteria 685
273 Ga0501318_031942 3300049534 Bacteria 720
274 Ga0501321_029105 3300049537 Bacteria 730
275 Ga0501322_013660 3300049538 Bacteria 657
276 Ga0501034_1162924 3300049571 Bacteria 651
277 Ga0501040_0855261 3300049576 Bacteria 659
278 Ga0501047_0496826 3300049581 Bacteria 1047
279 Ga0501047_0703571 3300049581 Bacteria 828
280 Ga0500643_014116 3300053087 Bacteria 2790
281 Ga0500641_0224919 3300053096 Bacteria 795
282 Ga0500648_354641 3300053097 Bacteria 595
283 Ga0500591_029095 3300053115 Bacteria 2675
284 Ga0500568_0037134 3300053139 Bacteria 1978
285 Ga0500590_190446 3300053148 Bacteria 880
286 Ga0500616_0000425 3300053153 Bacteria 56265
287 Ga0500639_099111 3300053163 Bacteria 1438
288 Ga0500596_015626 3300053735 Bacteria 1140
289 2555469916 2554235283 Bacteria 3683090
290 2644741505 2643221735 Bacteria 3676263
291 2686997928 2684623153 Bacteria 3878815
292 2687499270 2687453109 Bacteria 3860091
293 2738823399 2738541296 Bacteria 7285013
294 2738835499 2738541298 Bacteria 7286732
295 2738877320 2738541306 Bacteria 7284992
296 2739189026 2738543002 Bacteria 7284546
297 2739223913 2738543008 Bacteria 7282815
298 2746091873 2744054900 Bacteria 8399525
299 2746096022 2744054901 Bacteria 8397047
300 2812317123 2811994870 Bacteria 3776934
301 2819724202 2818991468 Bacteria 3723169
302 2823529085 2823526263 Bacteria 3765752
303 2842330049 2842324504 Bacteria 9364110
304 2842356287 2842348783 Bacteria 9002918
305 2842457614 2842454564 Bacteria 8730687
306 2900635700 2900634093 Bacteria 10263517
307 2908667708 2908665501 Bacteria 3678115
308 2919095502 2919093281 Bacteria 3660974
309 2919728790 2919726948 Bacteria 3696050
310 2945935990 2945934425 Bacteria 7444609
311 2954773373 2954773129 Bacteria 3741715
312 2990710107 2990703756 Bacteria 7715990
313 642422638 641736151 Bacteria 7477263
314 642620835 642555113 Bacteria 8214658
315 Ga0105247_10345477
316 JGI24740J21852_10014161
317 JGI24739J22299_10041146
318 JGI24737J22298_10025998
319 JGI24735J21928_10068337
320 JGI24735J21928_10069710
321 JGI25156J39149_1000439
322 JGI25151J46595_10005743
323 JGI25151J46595_10008940
324 rootH1_10001445
325 rootH2_10136565
326 rootL2_10013974
327 rootH1_10145346
328 rootH1_10146971
329 Ga0006562J51391_1003764
330 Ga0055538_1000947
331 Ga0055532_1008590
332 Ga0055528_1001852
333 Ga0070658_10247442
334 Ga0068869_100009338
335 Ga0070680_100042238
336 Ga0070680_100282778
337 Ga0070682_100000058
338 Ga0070682_101225142
339 Ga0070660_100175417
340 Ga0070660_100532547
341 Ga0070691_10204359
342 Ga0070692_10811964
343 Ga0070671_100012395
344 Ga0070663_100132528
345 Ga0070662_100206033
346 Ga0070681_10012315
347 Ga0070681_10027983
348 Ga0070681_10078289
349 Ga0070685_10494080
350 Ga0070679_100001538
351 Ga0070679_100032044
352 Ga0070679_100249132
353 Ga0070672_100082199
354 Ga0070672_101043651
355 Ga0070665_100000547
356 Ga0070665_100133033
357 Ga0068855_100014554
358 Ga0068855_100047691
359 Ga0068855_100069167
360 Ga0068857_100255701
361 Ga0068856_100993813
362 Ga0068858_100147682
363 Ga0068860_100705329
364 Ga0068862_101643995
365 Ga0075428_100750863
366 Ga0105251_10245679
367 Ga0105244_10049079
368 Ga0105250_10255952
369 Ga0105240_10002956
370 Ga0105240_10027153
371 Ga0105240_10159499
372 Ga0105240_10214327
373 Ga0105240_11469173
374 Ga0111539_10796808
375 Ga0105245_10777555
376 Ga0105247_10005798
377 Ga0105243_10181081
378 Ga0105242_10007418
379 Ga0105237_10198789
380 Ga0105237_10288630
381 Ga0105237_10774971
382 Ga0105237_10816408
383 Ga0105238_10002575
384 Ga0105238_10069353
385 Ga0105238_10334861
386 Ga0105249_10019166
387 Ga0105249_11020385
388 Ga0105239_10305539
389 Ga0105239_10332540
390 Ga0105246_10000909
391 Ga0157371_10008397
392 Ga0157370_10001137
393 Ga0157370_10195189
394 Ga0157369_10001388
395 Ga0157369_10008496
396 Ga0157369_10017029
397 Ga0157369_10064540
398 Ga0157378_10003349
399 Ga0157372_10029610
400 Ga0163163_11311855
401 Ga0157380_10007450
402 Ga0157380_10386264
403 Ga0182008_10019771
404 Ga0157377_10073612
405 Ga0206356_11502887
406 Ga0209147_100231
407 Ga0209759_1000250
408 Ga0209673_1004662
409 Ga0209673_1077984
410 Ga0209025_1000001
411 Ga0209025_1087097
412 Ga0209025_1104384
413 Ga0209025_1104546
414 Ga0207696_1001406
415 Ga0207696_1130326
416 Ga0207655_1031673
417 Ga0207655_1031677
418 Ga0207713_1001085
419 Ga0207647_10051809
420 Ga0207684_10000760
421 Ga0207707_10000390
422 Ga0207707_10014515
423 Ga0207707_10051572
424 Ga0207695_10015874
425 Ga0207695_10040708
426 Ga0207695_10372925
427 Ga0207695_10636469
428 Ga0207695_10721380
429 Ga0207671_10118312
430 Ga0207671_10373821
431 Ga0207671_10915151
432 Ga0207693_10589037
433 Ga0207660_10026804
434 Ga0207660_10228931
435 Ga0207657_10400602
436 Ga0207657_10912825
437 Ga0207652_10000362
438 Ga0207652_10172112
439 Ga0207652_10387781
440 Ga0207652_10514884
441 Ga0207694_10011694
442 Ga0207694_10275607
443 Ga0207664_10200919
444 Ga0207644_10052071
445 Ga0207709_10138848
446 Ga0207670_10019064
447 Ga0207691_10014624
448 Ga0207689_10022925
449 Ga0207667_10002859
450 Ga0207667_10036586
451 Ga0207667_10290764
452 Ga0207667_10887107
453 Ga0207651_10892851
454 Ga0207651_10940707
455 Ga0207678_10123105
456 Ga0207702_10412947
457 Ga0207674_10086108
458 Ga0207683_10373270
459 Ga0207683_10398639
460 Ga0207698_11502288
461 Ga0268266_10000434
462 Ga0268266_10220586
463 Ga0268266_10248084
464 Ga0265338_10073810
465 Ga0265340_10001160
466 Ga0307408_100309512
467 Ga0265313_10092128
468 Ga0307412_10000005
469 Ga0307412_11009703
470 Ga0307409_100333467
471 Ga0307416_102079769
472 Ga0307411_10016517
473 Ga0307510_10035120
474 Ga0373923_0048651
475 Ga0373946_0369527
476 Ga0395898_0008462
477 Ga0395898_0009096
478 Ga0395898_0534393
479 Ga0436365_1054294
480 Ga0451795_0094759
481 Ga0451800_1363794
482 Ga0451807_0327217
483 Ga0466965_0374022
484 Ga0466966_0059469
485 Ga0466961_0077899
486 Ga0466964_0267359
487 Ga0466971_0098468
488 Ga0466970_0089539
489 Ga0466957_0128838
490 Ga0466957_0165013
491 Ga0466959_0049433
492 Ga0466959_0303597
493 Ga0495603_0022682
494 Ga0495651_0202439
495 Ga0495651_0227842
496 Ga0495650_0002510
497 Ga0495580_0000760
498 Ga0495605_0016838
499 Ga0495584_0012691
500 Ga0495585_0004179
501 Ga0495596_0016406
502 Ga0495606_0016271
503 Ga0495606_0154036
504 Ga0495610_0007838
505 Ga0495610_0266534
506 Ga0495628_0075465
507 Ga0495631_0087696
508 Ga0495648_0435618
509 Ga0495663_0000946
510 Ga0495666_0234880
511 Ga0495642_0098250
512 Ga0495652_0407302
513 Ga0495598_0001080
514 Ga0495621_0000858
515 Ga0495621_0038336
516 Ga0495597_0085143
517 Ga0495668_0085231
518 Ga0495634_0180842
519 Ga0495611_0284869
520 Ga0495625_0065778
521 Ga0495661_0040278
522 Ga0495657_0196556
523 Ga0495599_0011636
524 Ga0495599_0072096
525 Ga0495623_0002170
526 Ga0495646_0040733
527 Ga0495624_0011548
528 Ga0495670_0215500
529 Ga0495649_0018760
530 Ga0495649_0264925
531 Ga0495589_0110562
532 Ga0495600_0181314
533 Ga0495604_0001173
534 Ga0495604_0413723
535 Ga0495674_0037625
536 Ga0495680_0040642
537 Ga0495683_0003213
538 Ga0495683_0033754
539 Ga0495683_0065689
540 Ga0495687_007343
541 Ga0495687_190492
542 Ga0495675_0019621
543 Ga0495684_0023016
544 Ga0495686_0047570
545 Ga0495602_0046895
546 Ga0495602_0268206
547 Ga0495614_0138510
548 Ga0496100_0002065
549 Ga0496101_0001813
550 Ga0496103_0002340
551 Ga0496103_0337525
552 Ga0496104_0001243
553 Ga0496105_0000266
554 Ga0496106_0001528
555 Ga0496107_0000213
556 Ga0496108_0001891
557 Ga0496109_0000475
558 Ga0496111_0009739
559 Ga0496111_1156691
560 Ga0496112_0002950
561 Ga0496116_0077787
562 Ga0496116_0103052
563 Ga0496116_0266336
564 Ga0496117_0049264
565 Ga0496119_0004308
566 Ga0496119_0005826
567 Ga0496120_0049254
568 Ga0496120_0052260
569 Ga0496120_0419293
570 Ga0496121_0047883
571 Ga0496121_0606116
572 Ga0496122_0079475
573 Ga0496123_0091839
574 Ga0496124_0058698
575 Ga0496125_0007791
576 Ga0496125_0013927
577 Ga0496125_0299450
578 Ga0496126_0001253
579 Ga0496126_0001943
580 Ga0496126_0010599
581 Ga0496126_0146602
582 Ga0496126_0188234
583 Ga0501306_048135
584 Ga0501305_059676
585 Ga0501312_005660
586 Ga0501316_034887
587 Ga0501318_031942
588 Ga0501321_029105
589 Ga0501322_013660
590 Ga0501034_1162924
591 Ga0501040_0855261
592 Ga0501047_0496826
593 Ga0501047_0703571
594 Ga0500643_014116
595 Ga0500641_0224919
596 Ga0500648_354641
597 Ga0500591_029095
598 Ga0500568_0037134
599 Ga0500590_190446
600 Ga0500616_0000425
601 Ga0500639_099111
602 Ga0500596_015626
603 2555469916
604 2644741505
605 2686997928
606 2687499270
607 2738823399
608 2738835499
609 2738877320
610 2739189026
611 2739223913
612 2746091873
613 2746096022
614 2812317123
615 2819724202
616 2823529085
617 2842330049
618 2842356287
619 2842457614
620 2900635700
621 2908667708
622 2919095502
623 2919728790
624 2945935990
625 2954773373
626 2990710107
627 642422638
628 642620835

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13185

GAF_2

GAF domain

67

191

0.83

PF01590

GAF

GAF domain

55

190

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hl6-assembly1.cif.gz_A crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis 0.9813 10 161
3ksf-assembly3.cif.gz_F structure of frmsr of staphylococcus aureus (reduced form) 0.9737 16 162
3rfb-assembly1.cif.gz_A structure of frmsr 0.9729 14 162
8dgd-assembly1.cif.gz_A crystal structure of gaf domain-containing protein, from klebsiella pneumoniae 0.9649 9 160
1vhm-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.9599 11 160
ID Description Score Start End Superfamily
3rfbA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9729 14 162 3.30.450.40
1vhmA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9599 11 160 3.30.450.40
af_Q4DSC2_14_185_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9482 11 162 3.30.450.40
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9467 1 158 3.30.450.40
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9293 1 158 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A7X5UCN6-F1-model_v4 GAF domain-containing protein 0.9922 1 160 GO:0005829
GO:0033745
AF-A0A227J7W3-F1-model_v4 GAF domain-containing protein 0.9922 14 106
AF-A0A520YGG9-F1-model_v4 GAF domain-containing protein 0.9918 29 160 GO:0005829
GO:0033745
AF-A0A7C6KJH3-F1-model_v4 GAF domain-containing protein 0.9906 16 161 GO:0005829
GO:0033745
AF-A0A0A2VZ32-F1-model_v4 ProP effector 0.9906 28 137 GO:0005829
GO:0010608
GO:0033592
GO:0033745
GO:0034057
GO:0034599

Map