F402659
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 314 | 225 | 628 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10345477|Ga0105247_103454771 |
| Length | 199 |
| Sequence | MGEACKGRLGDNTPDRPPIQWRLGSPASRDAVTFTAAKRYDFRDQAGDYAGLADELRGLLSGESDLVANAANMSALLFDALPDLNWAGFYFLKRGELVVGPFQGKPACVRIALGKGVCGTAAQERRTIVVPDVNAFPGHIACDAASQSEIVVPLIVGGKVLGVLDIDSPRLARFNEGDARGLERMVSIFLDSIRIEDVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 94 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 95 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 96 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 98 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 99 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 100 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 101 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 102 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 105 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 106 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 107 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 108 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 109 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 110 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 111 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 112 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 113 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 114 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 115 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 116 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 163 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 164 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 165 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 166 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 167 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 170 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 171 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 172 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 173 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 174 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 175 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 176 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 177 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 178 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 179 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 180 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 181 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 192 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 193 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 194 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 195 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 196 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 197 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 198 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 199 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 200 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 201 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 202 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 203 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 204 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 205 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 206 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 207 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 208 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 209 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 210 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 211 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 212 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 213 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 214 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 215 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 216 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 217 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 218 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 219 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 220 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 221 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 222 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 223 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 224 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 225 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.85 |
| Metatranscriptomes | 2.87 |
| Isolates | 8.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.69 |
| Nodule | 0.96 |
| Rhizoplane | 5.41 |
| Rhizosphere | 71.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105247_10345477 | 3300009101 | Unclassified | 1045 |
| 2 | JGI24740J21852_10014161 | 3300001979 | Bacteria | 2953 |
| 3 | JGI24739J22299_10041146 | 3300001989 | Bacteria | 1539 |
| 4 | JGI24737J22298_10025998 | 3300001990 | Bacteria | 1849 |
| 5 | JGI24735J21928_10068337 | 3300002067 | Bacteria | 1019 |
| 6 | JGI24735J21928_10069710 | 3300002067 | Bacteria | 1007 |
| 7 | JGI25156J39149_1000439 | 3300002705 | Bacteria | 25558 |
| 8 | JGI25151J46595_10005743 | 3300003187 | Bacteria | 6359 |
| 9 | JGI25151J46595_10008940 | 3300003187 | Bacteria | 4778 |
| 10 | rootH1_10001445 | 3300003316 | Bacteria | 56583 |
| 11 | rootH2_10136565 | 3300003320 | Bacteria | 2495 |
| 12 | rootL2_10013974 | 3300003322 | Bacteria | 148551 |
| 13 | rootH1_10145346 | 3300003323 | Bacteria | 3100 |
| 14 | rootH1_10146971 | 3300003323 | Bacteria | 2918 |
| 15 | Ga0006562J51391_1003764 | 3300003578 | Bacteria | 927 |
| 16 | Ga0055538_1000947 | 3300003751 | Bacteria | 6943 |
| 17 | Ga0055532_1008590 | 3300003758 | Bacteria | 1270 |
| 18 | Ga0055528_1001852 | 3300003790 | Bacteria | 12054 |
| 19 | Ga0070658_10247442 | 3300005327 | Bacteria | 1512 |
| 20 | Ga0068869_100009338 | 3300005334 | Bacteria | 6361 |
| 21 | Ga0070680_100042238 | 3300005336 | Bacteria | 3699 |
| 22 | Ga0070680_100282778 | 3300005336 | Bacteria | 1406 |
| 23 | Ga0070682_100000058 | 3300005337 | Bacteria | 108660 |
| 24 | Ga0070682_101225142 | 3300005337 | Bacteria | 634 |
| 25 | Ga0070660_100175417 | 3300005339 | Bacteria | 1733 |
| 26 | Ga0070660_100532547 | 3300005339 | Bacteria | 979 |
| 27 | Ga0070691_10204359 | 3300005341 | Bacteria | 1039 |
| 28 | Ga0070692_10811964 | 3300005345 | Bacteria | 639 |
| 29 | Ga0070671_100012395 | 3300005355 | Bacteria | 6865 |
| 30 | Ga0070663_100132528 | 3300005455 | Bacteria | 1894 |
| 31 | Ga0070662_100206033 | 3300005457 | Bacteria | 1563 |
| 32 | Ga0070681_10012315 | 3300005458 | Bacteria | 8480 |
| 33 | Ga0070681_10027983 | 3300005458 | Bacteria | 5667 |
| 34 | Ga0070681_10078289 | 3300005458 | Bacteria | 3263 |
| 35 | Ga0070685_10494080 | 3300005466 | Bacteria | 865 |
| 36 | Ga0070679_100001538 | 3300005530 | Bacteria | 20571 |
| 37 | Ga0070679_100032044 | 3300005530 | Bacteria | 5197 |
| 38 | Ga0070679_100249132 | 3300005530 | Bacteria | 1733 |
| 39 | Ga0070672_100082199 | 3300005543 | Bacteria | 2584 |
| 40 | Ga0070672_101043651 | 3300005543 | Bacteria | 725 |
| 41 | Ga0070665_100000547 | 3300005548 | Bacteria | 52634 |
| 42 | Ga0070665_100133033 | 3300005548 | Bacteria | 2489 |
| 43 | Ga0068855_100014554 | 3300005563 | Bacteria | 9476 |
| 44 | Ga0068855_100047691 | 3300005563 | Bacteria | 5060 |
| 45 | Ga0068855_100069167 | 3300005563 | Bacteria | 4109 |
| 46 | Ga0068857_100255701 | 3300005577 | Bacteria | 1607 |
| 47 | Ga0068856_100993813 | 3300005614 | Bacteria | 857 |
| 48 | Ga0068858_100147682 | 3300005842 | Bacteria | 2209 |
| 49 | Ga0068860_100705329 | 3300005843 | Bacteria | 1019 |
| 50 | Ga0068862_101643995 | 3300005844 | Bacteria | 650 |
| 51 | Ga0075428_100750863 | 3300006844 | Bacteria | 1038 |
| 52 | Ga0105251_10245679 | 3300009011 | Bacteria | 806 |
| 53 | Ga0105244_10049079 | 3300009036 | Bacteria | 2158 |
| 54 | Ga0105250_10255952 | 3300009092 | Bacteria | 749 |
| 55 | Ga0105240_10002956 | 3300009093 | Bacteria | 26781 |
| 56 | Ga0105240_10027153 | 3300009093 | Bacteria | 7500 |
| 57 | Ga0105240_10159499 | 3300009093 | Bacteria | 2681 |
| 58 | Ga0105240_10214327 | 3300009093 | Bacteria | 2248 |
| 59 | Ga0105240_11469173 | 3300009093 | Bacteria | 715 |
| 60 | Ga0111539_10796808 | 3300009094 | Bacteria | 1100 |
| 61 | Ga0105245_10777555 | 3300009098 | Bacteria | 994 |
| 62 | Ga0105247_10005798 | 3300009101 | Bacteria | 7730 |
| 63 | Ga0105243_10181081 | 3300009148 | Bacteria | 1833 |
| 64 | Ga0105242_10007418 | 3300009176 | Bacteria | 8443 |
| 65 | Ga0105237_10198789 | 3300009545 | Bacteria | 2004 |
| 66 | Ga0105237_10288630 | 3300009545 | Bacteria | 1643 |
| 67 | Ga0105237_10774971 | 3300009545 | Bacteria | 966 |
| 68 | Ga0105237_10816408 | 3300009545 | Bacteria | 939 |
| 69 | Ga0105238_10002575 | 3300009551 | Bacteria | 18089 |
| 70 | Ga0105238_10069353 | 3300009551 | Bacteria | 3526 |
| 71 | Ga0105238_10334861 | 3300009551 | Bacteria | 1501 |
| 72 | Ga0105249_10019166 | 3300009553 | Bacteria | 6101 |
| 73 | Ga0105249_11020385 | 3300009553 | Bacteria | 896 |
| 74 | Ga0105239_10305539 | 3300010375 | Bacteria | 1792 |
| 75 | Ga0105239_10332540 | 3300010375 | Bacteria | 1714 |
| 76 | Ga0105246_10000909 | 3300011119 | Bacteria | 16953 |
| 77 | Ga0157371_10008397 | 3300013102 | Bacteria | 8230 |
| 78 | Ga0157370_10001137 | 3300013104 | Bacteria | 33243 |
| 79 | Ga0157370_10195189 | 3300013104 | Bacteria | 1879 |
| 80 | Ga0157369_10001388 | 3300013105 | Bacteria | 29820 |
| 81 | Ga0157369_10008496 | 3300013105 | Bacteria | 11774 |
| 82 | Ga0157369_10017029 | 3300013105 | Bacteria | 8167 |
| 83 | Ga0157369_10064540 | 3300013105 | Bacteria | 3943 |
| 84 | Ga0157378_10003349 | 3300013297 | Bacteria | 14260 |
| 85 | Ga0157372_10029610 | 3300013307 | Bacteria | 5981 |
| 86 | Ga0163163_11311855 | 3300014325 | Unclassified | 786 |
| 87 | Ga0157380_10007450 | 3300014326 | Bacteria | 7771 |
| 88 | Ga0157380_10386264 | 3300014326 | Bacteria | 1323 |
| 89 | Ga0182008_10019771 | 3300014497 | Bacteria | 3472 |
| 90 | Ga0157377_10073612 | 3300014745 | Bacteria | 1980 |
| 91 | Ga0206356_11502887 | 3300020070 | Bacteria | 1753 |
| 92 | Ga0209147_100231 | 3300025229 | Bacteria | 55288 |
| 93 | Ga0209759_1000250 | 3300025256 | Bacteria | 80232 |
| 94 | Ga0209673_1004662 | 3300025273 | Bacteria | 7247 |
| 95 | Ga0209673_1077984 | 3300025273 | Bacteria | 767 |
| 96 | Ga0209025_1000001 | 3300025294 | Bacteria | 1888151 |
| 97 | Ga0209025_1087097 | 3300025294 | Bacteria | 1035 |
| 98 | Ga0209025_1104384 | 3300025294 | Bacteria | 887 |
| 99 | Ga0209025_1104546 | 3300025294 | Bacteria | 886 |
| 100 | Ga0207696_1001406 | 3300025711 | Bacteria | 13145 |
| 101 | Ga0207696_1130326 | 3300025711 | Bacteria | 676 |
| 102 | Ga0207655_1031673 | 3300025728 | Bacteria | 2432 |
| 103 | Ga0207655_1031677 | 3300025728 | Bacteria | 2432 |
| 104 | Ga0207713_1001085 | 3300025735 | Bacteria | 23381 |
| 105 | Ga0207647_10051809 | 3300025904 | Bacteria | 2535 |
| 106 | Ga0207684_10000760 | 3300025910 | Bacteria | 37561 |
| 107 | Ga0207707_10000390 | 3300025912 | Bacteria | 45829 |
| 108 | Ga0207707_10014515 | 3300025912 | Bacteria | 6859 |
| 109 | Ga0207707_10051572 | 3300025912 | Bacteria | 3583 |
| 110 | Ga0207695_10015874 | 3300025913 | Bacteria | 8847 |
| 111 | Ga0207695_10040708 | 3300025913 | Bacteria | 4979 |
| 112 | Ga0207695_10372925 | 3300025913 | Bacteria | 1313 |
| 113 | Ga0207695_10636469 | 3300025913 | Bacteria | 948 |
| 114 | Ga0207695_10721380 | 3300025913 | Bacteria | 877 |
| 115 | Ga0207671_10118312 | 3300025914 | Bacteria | 2023 |
| 116 | Ga0207671_10373821 | 3300025914 | Bacteria | 1132 |
| 117 | Ga0207671_10915151 | 3300025914 | Bacteria | 693 |
| 118 | Ga0207693_10589037 | 3300025915 | Bacteria | 866 |
| 119 | Ga0207660_10026804 | 3300025917 | Bacteria | 3927 |
| 120 | Ga0207660_10228931 | 3300025917 | Bacteria | 1461 |
| 121 | Ga0207657_10400602 | 3300025919 | Bacteria | 1079 |
| 122 | Ga0207657_10912825 | 3300025919 | Bacteria | 676 |
| 123 | Ga0207652_10000362 | 3300025921 | Bacteria | 47186 |
| 124 | Ga0207652_10172112 | 3300025921 | Bacteria | 1943 |
| 125 | Ga0207652_10387781 | 3300025921 | Bacteria | 1261 |
| 126 | Ga0207652_10514884 | 3300025921 | Bacteria | 1077 |
| 127 | Ga0207694_10011694 | 3300025924 | Bacteria | 6620 |
| 128 | Ga0207694_10275607 | 3300025924 | Bacteria | 1381 |
| 129 | Ga0207664_10200919 | 3300025929 | Bacteria | 1720 |
| 130 | Ga0207644_10052071 | 3300025931 | Bacteria | 2941 |
| 131 | Ga0207709_10138848 | 3300025935 | Bacteria | 1668 |
| 132 | Ga0207670_10019064 | 3300025936 | Bacteria | 4182 |
| 133 | Ga0207691_10014624 | 3300025940 | Bacteria | 7481 |
| 134 | Ga0207689_10022925 | 3300025942 | Bacteria | 5244 |
| 135 | Ga0207667_10002859 | 3300025949 | Bacteria | 21419 |
| 136 | Ga0207667_10036586 | 3300025949 | Bacteria | 5260 |
| 137 | Ga0207667_10290764 | 3300025949 | Bacteria | 1670 |
| 138 | Ga0207667_10887107 | 3300025949 | Bacteria | 884 |
| 139 | Ga0207651_10892851 | 3300025960 | Bacteria | 791 |
| 140 | Ga0207651_10940707 | 3300025960 | Bacteria | 771 |
| 141 | Ga0207678_10123105 | 3300026067 | Bacteria | 2213 |
| 142 | Ga0207702_10412947 | 3300026078 | Bacteria | 1304 |
| 143 | Ga0207674_10086108 | 3300026116 | Bacteria | 3137 |
| 144 | Ga0207683_10373270 | 3300026121 | Bacteria | 1310 |
| 145 | Ga0207683_10398639 | 3300026121 | Bacteria | 1266 |
| 146 | Ga0207698_11502288 | 3300026142 | Bacteria | 689 |
| 147 | Ga0268266_10000434 | 3300028379 | Bacteria | 62882 |
| 148 | Ga0268266_10220586 | 3300028379 | Bacteria | 1743 |
| 149 | Ga0268266_10248084 | 3300028379 | Bacteria | 1646 |
| 150 | Ga0265338_10073810 | 3300028800 | Bacteria | 2906 |
| 151 | Ga0265340_10001160 | 3300031247 | Bacteria | 15082 |
| 152 | Ga0307408_100309512 | 3300031548 | Bacteria | 1326 |
| 153 | Ga0265313_10092128 | 3300031595 | Bacteria | 1359 |
| 154 | Ga0307412_10000005 | 3300031911 | Bacteria | 526194 |
| 155 | Ga0307412_11009703 | 3300031911 | Bacteria | 735 |
| 156 | Ga0307409_100333467 | 3300031995 | Bacteria | 1424 |
| 157 | Ga0307416_102079769 | 3300032002 | Bacteria | 670 |
| 158 | Ga0307411_10016517 | 3300032005 | Bacteria | 4180 |
| 159 | Ga0307510_10035120 | 3300033180 | Bacteria | 5603 |
| 160 | Ga0373923_0048651 | 3300035111 | Bacteria | 1771 |
| 161 | Ga0373946_0369527 | 3300035171 | Bacteria | 720 |
| 162 | Ga0395898_0008462 | 3300037466 | Bacteria | 10872 |
| 163 | Ga0395898_0009096 | 3300037466 | Bacteria | 10461 |
| 164 | Ga0395898_0534393 | 3300037466 | Bacteria | 1114 |
| 165 | Ga0436365_1054294 | 3300039437 | Bacteria | 2056 |
| 166 | Ga0451795_0094759 | 3300041456 | Bacteria | 620 |
| 167 | Ga0451800_1363794 | 3300041459 | Bacteria | 1031 |
| 168 | Ga0451807_0327217 | 3300041486 | Bacteria | 1064 |
| 169 | Ga0466965_0374022 | 3300044683 | Bacteria | 784 |
| 170 | Ga0466966_0059469 | 3300044684 | Bacteria | 2413 |
| 171 | Ga0466961_0077899 | 3300044693 | Bacteria | 2099 |
| 172 | Ga0466964_0267359 | 3300044706 | Bacteria | 849 |
| 173 | Ga0466971_0098468 | 3300044719 | Bacteria | 1342 |
| 174 | Ga0466970_0089539 | 3300044765 | Bacteria | 1669 |
| 175 | Ga0466957_0128838 | 3300044842 | Bacteria | 1619 |
| 176 | Ga0466957_0165013 | 3300044842 | Bacteria | 1440 |
| 177 | Ga0466959_0049433 | 3300045049 | Bacteria | 3089 |
| 178 | Ga0466959_0303597 | 3300045049 | Bacteria | 1093 |
| 179 | Ga0495603_0022682 | 3300046455 | Bacteria | 3798 |
| 180 | Ga0495651_0202439 | 3300046462 | Bacteria | 1388 |
| 181 | Ga0495651_0227842 | 3300046462 | Bacteria | 1285 |
| 182 | Ga0495650_0002510 | 3300046471 | Bacteria | 14698 |
| 183 | Ga0495580_0000760 | 3300046472 | Bacteria | 27683 |
| 184 | Ga0495605_0016838 | 3300046474 | Bacteria | 3949 |
| 185 | Ga0495584_0012691 | 3300046491 | Bacteria | 4300 |
| 186 | Ga0495585_0004179 | 3300046492 | Bacteria | 9428 |
| 187 | Ga0495596_0016406 | 3300046500 | Bacteria | 3077 |
| 188 | Ga0495606_0016271 | 3300046507 | Bacteria | 5679 |
| 189 | Ga0495606_0154036 | 3300046507 | Bacteria | 1346 |
| 190 | Ga0495610_0007838 | 3300046512 | Bacteria | 7029 |
| 191 | Ga0495610_0266534 | 3300046512 | Unclassified | 672 |
| 192 | Ga0495628_0075465 | 3300046516 | Bacteria | 2625 |
| 193 | Ga0495631_0087696 | 3300046518 | Bacteria | 1340 |
| 194 | Ga0495648_0435618 | 3300046524 | Bacteria | 577 |
| 195 | Ga0495663_0000946 | 3300046525 | Bacteria | 9688 |
| 196 | Ga0495666_0234880 | 3300046526 | Bacteria | 837 |
| 197 | Ga0495642_0098250 | 3300046528 | Bacteria | 1244 |
| 198 | Ga0495652_0407302 | 3300046529 | Bacteria | 961 |
| 199 | Ga0495598_0001080 | 3300046537 | Bacteria | 5222 |
| 200 | Ga0495621_0000858 | 3300046539 | Bacteria | 7729 |
| 201 | Ga0495621_0038336 | 3300046539 | Bacteria | 1671 |
| 202 | Ga0495597_0085143 | 3300046542 | Bacteria | 1347 |
| 203 | Ga0495668_0085231 | 3300046616 | Bacteria | 1733 |
| 204 | Ga0495634_0180842 | 3300046642 | Bacteria | 1320 |
| 205 | Ga0495611_0284869 | 3300046648 | Bacteria | 763 |
| 206 | Ga0495625_0065778 | 3300046660 | Bacteria | 2555 |
| 207 | Ga0495661_0040278 | 3300046665 | Bacteria | 2899 |
| 208 | Ga0495657_0196556 | 3300046675 | Bacteria | 1231 |
| 209 | Ga0495599_0011636 | 3300046678 | Bacteria | 5413 |
| 210 | Ga0495599_0072096 | 3300046678 | Bacteria | 2155 |
| 211 | Ga0495623_0002170 | 3300046679 | Bacteria | 13077 |
| 212 | Ga0495646_0040733 | 3300046680 | Bacteria | 2859 |
| 213 | Ga0495624_0011548 | 3300046690 | Bacteria | 6069 |
| 214 | Ga0495670_0215500 | 3300046691 | Bacteria | 1019 |
| 215 | Ga0495649_0018760 | 3300046694 | Bacteria | 3886 |
| 216 | Ga0495649_0264925 | 3300046694 | Bacteria | 880 |
| 217 | Ga0495589_0110562 | 3300046794 | Bacteria | 1326 |
| 218 | Ga0495600_0181314 | 3300046809 | Bacteria | 1357 |
| 219 | Ga0495604_0001173 | 3300047317 | Bacteria | 21652 |
| 220 | Ga0495604_0413723 | 3300047317 | Bacteria | 886 |
| 221 | Ga0495674_0037625 | 3300047319 | Bacteria | 4348 |
| 222 | Ga0495680_0040642 | 3300047322 | Bacteria | 3704 |
| 223 | Ga0495683_0003213 | 3300047323 | Bacteria | 9547 |
| 224 | Ga0495683_0033754 | 3300047323 | Bacteria | 2602 |
| 225 | Ga0495683_0065689 | 3300047323 | Bacteria | 1789 |
| 226 | Ga0495687_007343 | 3300047443 | Bacteria | 6509 |
| 227 | Ga0495687_190492 | 3300047443 | Bacteria | 661 |
| 228 | Ga0495675_0019621 | 3300047444 | Bacteria | 4294 |
| 229 | Ga0495684_0023016 | 3300047471 | Bacteria | 4792 |
| 230 | Ga0495686_0047570 | 3300047472 | Bacteria | 2708 |
| 231 | Ga0495602_0046895 | 3300048088 | Bacteria | 3898 |
| 232 | Ga0495602_0268206 | 3300048088 | Bacteria | 1263 |
| 233 | Ga0495614_0138510 | 3300048089 | Bacteria | 1081 |
| 234 | Ga0496100_0002065 | 3300048903 | Bacteria | 10091 |
| 235 | Ga0496101_0001813 | 3300048904 | Bacteria | 12871 |
| 236 | Ga0496103_0002340 | 3300048906 | Bacteria | 11974 |
| 237 | Ga0496103_0337525 | 3300048906 | Bacteria | 969 |
| 238 | Ga0496104_0001243 | 3300048907 | Bacteria | 21946 |
| 239 | Ga0496105_0000266 | 3300048908 | Bacteria | 34749 |
| 240 | Ga0496106_0001528 | 3300048909 | Bacteria | 17394 |
| 241 | Ga0496107_0000213 | 3300048910 | Bacteria | 30470 |
| 242 | Ga0496108_0001891 | 3300048911 | Bacteria | 16781 |
| 243 | Ga0496109_0000475 | 3300048912 | Bacteria | 34137 |
| 244 | Ga0496111_0009739 | 3300048914 | Bacteria | 6422 |
| 245 | Ga0496111_1156691 | 3300048914 | Bacteria | 550 |
| 246 | Ga0496112_0002950 | 3300048915 | Bacteria | 13877 |
| 247 | Ga0496116_0077787 | 3300048919 | Bacteria | 2071 |
| 248 | Ga0496116_0103052 | 3300048919 | Bacteria | 1699 |
| 249 | Ga0496116_0266336 | 3300048919 | Bacteria | 841 |
| 250 | Ga0496117_0049264 | 3300048920 | Bacteria | 2998 |
| 251 | Ga0496119_0004308 | 3300048922 | Bacteria | 14214 |
| 252 | Ga0496119_0005826 | 3300048922 | Bacteria | 11645 |
| 253 | Ga0496120_0049254 | 3300048923 | Bacteria | 2419 |
| 254 | Ga0496120_0052260 | 3300048923 | Bacteria | 2328 |
| 255 | Ga0496120_0419293 | 3300048923 | Bacteria | 588 |
| 256 | Ga0496121_0047883 | 3300048924 | Bacteria | 3642 |
| 257 | Ga0496121_0606116 | 3300048924 | Bacteria | 675 |
| 258 | Ga0496122_0079475 | 3300048925 | Bacteria | 2291 |
| 259 | Ga0496123_0091839 | 3300048926 | Bacteria | 1799 |
| 260 | Ga0496124_0058698 | 3300048927 | Bacteria | 3235 |
| 261 | Ga0496125_0007791 | 3300048928 | Bacteria | 11326 |
| 262 | Ga0496125_0013927 | 3300048928 | Bacteria | 7866 |
| 263 | Ga0496125_0299450 | 3300048928 | Bacteria | 986 |
| 264 | Ga0496126_0001253 | 3300048929 | Bacteria | 41064 |
| 265 | Ga0496126_0001943 | 3300048929 | Bacteria | 29458 |
| 266 | Ga0496126_0010599 | 3300048929 | Bacteria | 9642 |
| 267 | Ga0496126_0146602 | 3300048929 | Bacteria | 2027 |
| 268 | Ga0496126_0188234 | 3300048929 | Bacteria | 1749 |
| 269 | Ga0501306_048135 | 3300049127 | Bacteria | 678 |
| 270 | Ga0501305_059676 | 3300049161 | Bacteria | 654 |
| 271 | Ga0501312_005660 | 3300049528 | Bacteria | 1528 |
| 272 | Ga0501316_034887 | 3300049532 | Bacteria | 685 |
| 273 | Ga0501318_031942 | 3300049534 | Bacteria | 720 |
| 274 | Ga0501321_029105 | 3300049537 | Bacteria | 730 |
| 275 | Ga0501322_013660 | 3300049538 | Bacteria | 657 |
| 276 | Ga0501034_1162924 | 3300049571 | Bacteria | 651 |
| 277 | Ga0501040_0855261 | 3300049576 | Bacteria | 659 |
| 278 | Ga0501047_0496826 | 3300049581 | Bacteria | 1047 |
| 279 | Ga0501047_0703571 | 3300049581 | Bacteria | 828 |
| 280 | Ga0500643_014116 | 3300053087 | Bacteria | 2790 |
| 281 | Ga0500641_0224919 | 3300053096 | Bacteria | 795 |
| 282 | Ga0500648_354641 | 3300053097 | Bacteria | 595 |
| 283 | Ga0500591_029095 | 3300053115 | Bacteria | 2675 |
| 284 | Ga0500568_0037134 | 3300053139 | Bacteria | 1978 |
| 285 | Ga0500590_190446 | 3300053148 | Bacteria | 880 |
| 286 | Ga0500616_0000425 | 3300053153 | Bacteria | 56265 |
| 287 | Ga0500639_099111 | 3300053163 | Bacteria | 1438 |
| 288 | Ga0500596_015626 | 3300053735 | Bacteria | 1140 |
| 289 | 2555469916 | 2554235283 | Bacteria | 3683090 |
| 290 | 2644741505 | 2643221735 | Bacteria | 3676263 |
| 291 | 2686997928 | 2684623153 | Bacteria | 3878815 |
| 292 | 2687499270 | 2687453109 | Bacteria | 3860091 |
| 293 | 2738823399 | 2738541296 | Bacteria | 7285013 |
| 294 | 2738835499 | 2738541298 | Bacteria | 7286732 |
| 295 | 2738877320 | 2738541306 | Bacteria | 7284992 |
| 296 | 2739189026 | 2738543002 | Bacteria | 7284546 |
| 297 | 2739223913 | 2738543008 | Bacteria | 7282815 |
| 298 | 2746091873 | 2744054900 | Bacteria | 8399525 |
| 299 | 2746096022 | 2744054901 | Bacteria | 8397047 |
| 300 | 2812317123 | 2811994870 | Bacteria | 3776934 |
| 301 | 2819724202 | 2818991468 | Bacteria | 3723169 |
| 302 | 2823529085 | 2823526263 | Bacteria | 3765752 |
| 303 | 2842330049 | 2842324504 | Bacteria | 9364110 |
| 304 | 2842356287 | 2842348783 | Bacteria | 9002918 |
| 305 | 2842457614 | 2842454564 | Bacteria | 8730687 |
| 306 | 2900635700 | 2900634093 | Bacteria | 10263517 |
| 307 | 2908667708 | 2908665501 | Bacteria | 3678115 |
| 308 | 2919095502 | 2919093281 | Bacteria | 3660974 |
| 309 | 2919728790 | 2919726948 | Bacteria | 3696050 |
| 310 | 2945935990 | 2945934425 | Bacteria | 7444609 |
| 311 | 2954773373 | 2954773129 | Bacteria | 3741715 |
| 312 | 2990710107 | 2990703756 | Bacteria | 7715990 |
| 313 | 642422638 | 641736151 | Bacteria | 7477263 |
| 314 | 642620835 | 642555113 | Bacteria | 8214658 |
| 315 | Ga0105247_10345477 | |||
| 316 | JGI24740J21852_10014161 | |||
| 317 | JGI24739J22299_10041146 | |||
| 318 | JGI24737J22298_10025998 | |||
| 319 | JGI24735J21928_10068337 | |||
| 320 | JGI24735J21928_10069710 | |||
| 321 | JGI25156J39149_1000439 | |||
| 322 | JGI25151J46595_10005743 | |||
| 323 | JGI25151J46595_10008940 | |||
| 324 | rootH1_10001445 | |||
| 325 | rootH2_10136565 | |||
| 326 | rootL2_10013974 | |||
| 327 | rootH1_10145346 | |||
| 328 | rootH1_10146971 | |||
| 329 | Ga0006562J51391_1003764 | |||
| 330 | Ga0055538_1000947 | |||
| 331 | Ga0055532_1008590 | |||
| 332 | Ga0055528_1001852 | |||
| 333 | Ga0070658_10247442 | |||
| 334 | Ga0068869_100009338 | |||
| 335 | Ga0070680_100042238 | |||
| 336 | Ga0070680_100282778 | |||
| 337 | Ga0070682_100000058 | |||
| 338 | Ga0070682_101225142 | |||
| 339 | Ga0070660_100175417 | |||
| 340 | Ga0070660_100532547 | |||
| 341 | Ga0070691_10204359 | |||
| 342 | Ga0070692_10811964 | |||
| 343 | Ga0070671_100012395 | |||
| 344 | Ga0070663_100132528 | |||
| 345 | Ga0070662_100206033 | |||
| 346 | Ga0070681_10012315 | |||
| 347 | Ga0070681_10027983 | |||
| 348 | Ga0070681_10078289 | |||
| 349 | Ga0070685_10494080 | |||
| 350 | Ga0070679_100001538 | |||
| 351 | Ga0070679_100032044 | |||
| 352 | Ga0070679_100249132 | |||
| 353 | Ga0070672_100082199 | |||
| 354 | Ga0070672_101043651 | |||
| 355 | Ga0070665_100000547 | |||
| 356 | Ga0070665_100133033 | |||
| 357 | Ga0068855_100014554 | |||
| 358 | Ga0068855_100047691 | |||
| 359 | Ga0068855_100069167 | |||
| 360 | Ga0068857_100255701 | |||
| 361 | Ga0068856_100993813 | |||
| 362 | Ga0068858_100147682 | |||
| 363 | Ga0068860_100705329 | |||
| 364 | Ga0068862_101643995 | |||
| 365 | Ga0075428_100750863 | |||
| 366 | Ga0105251_10245679 | |||
| 367 | Ga0105244_10049079 | |||
| 368 | Ga0105250_10255952 | |||
| 369 | Ga0105240_10002956 | |||
| 370 | Ga0105240_10027153 | |||
| 371 | Ga0105240_10159499 | |||
| 372 | Ga0105240_10214327 | |||
| 373 | Ga0105240_11469173 | |||
| 374 | Ga0111539_10796808 | |||
| 375 | Ga0105245_10777555 | |||
| 376 | Ga0105247_10005798 | |||
| 377 | Ga0105243_10181081 | |||
| 378 | Ga0105242_10007418 | |||
| 379 | Ga0105237_10198789 | |||
| 380 | Ga0105237_10288630 | |||
| 381 | Ga0105237_10774971 | |||
| 382 | Ga0105237_10816408 | |||
| 383 | Ga0105238_10002575 | |||
| 384 | Ga0105238_10069353 | |||
| 385 | Ga0105238_10334861 | |||
| 386 | Ga0105249_10019166 | |||
| 387 | Ga0105249_11020385 | |||
| 388 | Ga0105239_10305539 | |||
| 389 | Ga0105239_10332540 | |||
| 390 | Ga0105246_10000909 | |||
| 391 | Ga0157371_10008397 | |||
| 392 | Ga0157370_10001137 | |||
| 393 | Ga0157370_10195189 | |||
| 394 | Ga0157369_10001388 | |||
| 395 | Ga0157369_10008496 | |||
| 396 | Ga0157369_10017029 | |||
| 397 | Ga0157369_10064540 | |||
| 398 | Ga0157378_10003349 | |||
| 399 | Ga0157372_10029610 | |||
| 400 | Ga0163163_11311855 | |||
| 401 | Ga0157380_10007450 | |||
| 402 | Ga0157380_10386264 | |||
| 403 | Ga0182008_10019771 | |||
| 404 | Ga0157377_10073612 | |||
| 405 | Ga0206356_11502887 | |||
| 406 | Ga0209147_100231 | |||
| 407 | Ga0209759_1000250 | |||
| 408 | Ga0209673_1004662 | |||
| 409 | Ga0209673_1077984 | |||
| 410 | Ga0209025_1000001 | |||
| 411 | Ga0209025_1087097 | |||
| 412 | Ga0209025_1104384 | |||
| 413 | Ga0209025_1104546 | |||
| 414 | Ga0207696_1001406 | |||
| 415 | Ga0207696_1130326 | |||
| 416 | Ga0207655_1031673 | |||
| 417 | Ga0207655_1031677 | |||
| 418 | Ga0207713_1001085 | |||
| 419 | Ga0207647_10051809 | |||
| 420 | Ga0207684_10000760 | |||
| 421 | Ga0207707_10000390 | |||
| 422 | Ga0207707_10014515 | |||
| 423 | Ga0207707_10051572 | |||
| 424 | Ga0207695_10015874 | |||
| 425 | Ga0207695_10040708 | |||
| 426 | Ga0207695_10372925 | |||
| 427 | Ga0207695_10636469 | |||
| 428 | Ga0207695_10721380 | |||
| 429 | Ga0207671_10118312 | |||
| 430 | Ga0207671_10373821 | |||
| 431 | Ga0207671_10915151 | |||
| 432 | Ga0207693_10589037 | |||
| 433 | Ga0207660_10026804 | |||
| 434 | Ga0207660_10228931 | |||
| 435 | Ga0207657_10400602 | |||
| 436 | Ga0207657_10912825 | |||
| 437 | Ga0207652_10000362 | |||
| 438 | Ga0207652_10172112 | |||
| 439 | Ga0207652_10387781 | |||
| 440 | Ga0207652_10514884 | |||
| 441 | Ga0207694_10011694 | |||
| 442 | Ga0207694_10275607 | |||
| 443 | Ga0207664_10200919 | |||
| 444 | Ga0207644_10052071 | |||
| 445 | Ga0207709_10138848 | |||
| 446 | Ga0207670_10019064 | |||
| 447 | Ga0207691_10014624 | |||
| 448 | Ga0207689_10022925 | |||
| 449 | Ga0207667_10002859 | |||
| 450 | Ga0207667_10036586 | |||
| 451 | Ga0207667_10290764 | |||
| 452 | Ga0207667_10887107 | |||
| 453 | Ga0207651_10892851 | |||
| 454 | Ga0207651_10940707 | |||
| 455 | Ga0207678_10123105 | |||
| 456 | Ga0207702_10412947 | |||
| 457 | Ga0207674_10086108 | |||
| 458 | Ga0207683_10373270 | |||
| 459 | Ga0207683_10398639 | |||
| 460 | Ga0207698_11502288 | |||
| 461 | Ga0268266_10000434 | |||
| 462 | Ga0268266_10220586 | |||
| 463 | Ga0268266_10248084 | |||
| 464 | Ga0265338_10073810 | |||
| 465 | Ga0265340_10001160 | |||
| 466 | Ga0307408_100309512 | |||
| 467 | Ga0265313_10092128 | |||
| 468 | Ga0307412_10000005 | |||
| 469 | Ga0307412_11009703 | |||
| 470 | Ga0307409_100333467 | |||
| 471 | Ga0307416_102079769 | |||
| 472 | Ga0307411_10016517 | |||
| 473 | Ga0307510_10035120 | |||
| 474 | Ga0373923_0048651 | |||
| 475 | Ga0373946_0369527 | |||
| 476 | Ga0395898_0008462 | |||
| 477 | Ga0395898_0009096 | |||
| 478 | Ga0395898_0534393 | |||
| 479 | Ga0436365_1054294 | |||
| 480 | Ga0451795_0094759 | |||
| 481 | Ga0451800_1363794 | |||
| 482 | Ga0451807_0327217 | |||
| 483 | Ga0466965_0374022 | |||
| 484 | Ga0466966_0059469 | |||
| 485 | Ga0466961_0077899 | |||
| 486 | Ga0466964_0267359 | |||
| 487 | Ga0466971_0098468 | |||
| 488 | Ga0466970_0089539 | |||
| 489 | Ga0466957_0128838 | |||
| 490 | Ga0466957_0165013 | |||
| 491 | Ga0466959_0049433 | |||
| 492 | Ga0466959_0303597 | |||
| 493 | Ga0495603_0022682 | |||
| 494 | Ga0495651_0202439 | |||
| 495 | Ga0495651_0227842 | |||
| 496 | Ga0495650_0002510 | |||
| 497 | Ga0495580_0000760 | |||
| 498 | Ga0495605_0016838 | |||
| 499 | Ga0495584_0012691 | |||
| 500 | Ga0495585_0004179 | |||
| 501 | Ga0495596_0016406 | |||
| 502 | Ga0495606_0016271 | |||
| 503 | Ga0495606_0154036 | |||
| 504 | Ga0495610_0007838 | |||
| 505 | Ga0495610_0266534 | |||
| 506 | Ga0495628_0075465 | |||
| 507 | Ga0495631_0087696 | |||
| 508 | Ga0495648_0435618 | |||
| 509 | Ga0495663_0000946 | |||
| 510 | Ga0495666_0234880 | |||
| 511 | Ga0495642_0098250 | |||
| 512 | Ga0495652_0407302 | |||
| 513 | Ga0495598_0001080 | |||
| 514 | Ga0495621_0000858 | |||
| 515 | Ga0495621_0038336 | |||
| 516 | Ga0495597_0085143 | |||
| 517 | Ga0495668_0085231 | |||
| 518 | Ga0495634_0180842 | |||
| 519 | Ga0495611_0284869 | |||
| 520 | Ga0495625_0065778 | |||
| 521 | Ga0495661_0040278 | |||
| 522 | Ga0495657_0196556 | |||
| 523 | Ga0495599_0011636 | |||
| 524 | Ga0495599_0072096 | |||
| 525 | Ga0495623_0002170 | |||
| 526 | Ga0495646_0040733 | |||
| 527 | Ga0495624_0011548 | |||
| 528 | Ga0495670_0215500 | |||
| 529 | Ga0495649_0018760 | |||
| 530 | Ga0495649_0264925 | |||
| 531 | Ga0495589_0110562 | |||
| 532 | Ga0495600_0181314 | |||
| 533 | Ga0495604_0001173 | |||
| 534 | Ga0495604_0413723 | |||
| 535 | Ga0495674_0037625 | |||
| 536 | Ga0495680_0040642 | |||
| 537 | Ga0495683_0003213 | |||
| 538 | Ga0495683_0033754 | |||
| 539 | Ga0495683_0065689 | |||
| 540 | Ga0495687_007343 | |||
| 541 | Ga0495687_190492 | |||
| 542 | Ga0495675_0019621 | |||
| 543 | Ga0495684_0023016 | |||
| 544 | Ga0495686_0047570 | |||
| 545 | Ga0495602_0046895 | |||
| 546 | Ga0495602_0268206 | |||
| 547 | Ga0495614_0138510 | |||
| 548 | Ga0496100_0002065 | |||
| 549 | Ga0496101_0001813 | |||
| 550 | Ga0496103_0002340 | |||
| 551 | Ga0496103_0337525 | |||
| 552 | Ga0496104_0001243 | |||
| 553 | Ga0496105_0000266 | |||
| 554 | Ga0496106_0001528 | |||
| 555 | Ga0496107_0000213 | |||
| 556 | Ga0496108_0001891 | |||
| 557 | Ga0496109_0000475 | |||
| 558 | Ga0496111_0009739 | |||
| 559 | Ga0496111_1156691 | |||
| 560 | Ga0496112_0002950 | |||
| 561 | Ga0496116_0077787 | |||
| 562 | Ga0496116_0103052 | |||
| 563 | Ga0496116_0266336 | |||
| 564 | Ga0496117_0049264 | |||
| 565 | Ga0496119_0004308 | |||
| 566 | Ga0496119_0005826 | |||
| 567 | Ga0496120_0049254 | |||
| 568 | Ga0496120_0052260 | |||
| 569 | Ga0496120_0419293 | |||
| 570 | Ga0496121_0047883 | |||
| 571 | Ga0496121_0606116 | |||
| 572 | Ga0496122_0079475 | |||
| 573 | Ga0496123_0091839 | |||
| 574 | Ga0496124_0058698 | |||
| 575 | Ga0496125_0007791 | |||
| 576 | Ga0496125_0013927 | |||
| 577 | Ga0496125_0299450 | |||
| 578 | Ga0496126_0001253 | |||
| 579 | Ga0496126_0001943 | |||
| 580 | Ga0496126_0010599 | |||
| 581 | Ga0496126_0146602 | |||
| 582 | Ga0496126_0188234 | |||
| 583 | Ga0501306_048135 | |||
| 584 | Ga0501305_059676 | |||
| 585 | Ga0501312_005660 | |||
| 586 | Ga0501316_034887 | |||
| 587 | Ga0501318_031942 | |||
| 588 | Ga0501321_029105 | |||
| 589 | Ga0501322_013660 | |||
| 590 | Ga0501034_1162924 | |||
| 591 | Ga0501040_0855261 | |||
| 592 | Ga0501047_0496826 | |||
| 593 | Ga0501047_0703571 | |||
| 594 | Ga0500643_014116 | |||
| 595 | Ga0500641_0224919 | |||
| 596 | Ga0500648_354641 | |||
| 597 | Ga0500591_029095 | |||
| 598 | Ga0500568_0037134 | |||
| 599 | Ga0500590_190446 | |||
| 600 | Ga0500616_0000425 | |||
| 601 | Ga0500639_099111 | |||
| 602 | Ga0500596_015626 | |||
| 603 | 2555469916 | |||
| 604 | 2644741505 | |||
| 605 | 2686997928 | |||
| 606 | 2687499270 | |||
| 607 | 2738823399 | |||
| 608 | 2738835499 | |||
| 609 | 2738877320 | |||
| 610 | 2739189026 | |||
| 611 | 2739223913 | |||
| 612 | 2746091873 | |||
| 613 | 2746096022 | |||
| 614 | 2812317123 | |||
| 615 | 2819724202 | |||
| 616 | 2823529085 | |||
| 617 | 2842330049 | |||
| 618 | 2842356287 | |||
| 619 | 2842457614 | |||
| 620 | 2900635700 | |||
| 621 | 2908667708 | |||
| 622 | 2919095502 | |||
| 623 | 2919728790 | |||
| 624 | 2945935990 | |||
| 625 | 2954773373 | |||
| 626 | 2990710107 | |||
| 627 | 642422638 | |||
| 628 | 642620835 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hl6-assembly1.cif.gz_A | crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis | 0.9813 | 10 | 161 |
| 3ksf-assembly3.cif.gz_F | structure of frmsr of staphylococcus aureus (reduced form) | 0.9737 | 16 | 162 |
| 3rfb-assembly1.cif.gz_A | structure of frmsr | 0.9729 | 14 | 162 |
| 8dgd-assembly1.cif.gz_A | crystal structure of gaf domain-containing protein, from klebsiella pneumoniae | 0.9649 | 9 | 160 |
| 1vhm-assembly1.cif.gz_A | crystal structure of an hypothetical protein | 0.9599 | 11 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rfbA00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9729 | 14 | 162 | 3.30.450.40 |
| 1vhmA00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9599 | 11 | 160 | 3.30.450.40 |
| af_Q4DSC2_14_185_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9482 | 11 | 162 | 3.30.450.40 |
| af_Q8MTJ7_3_158_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9467 | 1 | 158 | 3.30.450.40 |
| af_Q8MTJ7_3_158_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9293 | 1 | 158 | 3.30.450.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5UCN6-F1-model_v4 | GAF domain-containing protein | 0.9922 | 1 | 160 |
GO:0005829
GO:0033745 |
| AF-A0A227J7W3-F1-model_v4 | GAF domain-containing protein | 0.9922 | 14 | 106 |
|
| AF-A0A520YGG9-F1-model_v4 | GAF domain-containing protein | 0.9918 | 29 | 160 |
GO:0005829
GO:0033745 |
| AF-A0A7C6KJH3-F1-model_v4 | GAF domain-containing protein | 0.9906 | 16 | 161 |
GO:0005829
GO:0033745 |
| AF-A0A0A2VZ32-F1-model_v4 | ProP effector | 0.9906 | 28 | 137 |
GO:0005829
GO:0010608 GO:0033592 GO:0033745 GO:0034057 GO:0034599 |