F402462

General Info

Members Datasets Scaffolds Average Seq Length
313 193 626 251

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2775507192|2777836610
Length 285
Sequence SHAFVYCSLNQRKQSKEPFILTLSNENKGVYGMNILEAKKIHKSYGNKFNKQEVLSGIDINIEKGEFVSIMGASGSGKTTLLNVLSSIDKINSGGIAIEGKDITVMKEKQLAEFRKNYLGFIFQEYNLLDTLTVKENILLPLSITKTSPSEANQKFDVIAKELGIFELKDKYPNEISGGQKQRTSAARAFIHEPSIIFADEPTGALDSKSASDLLNKLSDLNERRNATIIMVTHDPVAASFCNRVVFIKDGQIYSQLHKGDETRQNFFKDIMKTQGVLGGVHHEH

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
22 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
23 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
25 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
26 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
31 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
32 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
33 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
34 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
35 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
36 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
37 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
38 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
39 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
40 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
41 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
42 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
43 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
44 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
45 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
46 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
47 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
48 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
49 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
50 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
51 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
52 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
53 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
54 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
55 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
56 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
57 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
58 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
59 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
60 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
61 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
62 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
63 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
64 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
65 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
66 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
67 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
68 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
69 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
70 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
71 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
72 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
73 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
74 2643221731 Bacillus sp. Root147 Isolate Unclassified
75 2643221732 Bacillus sp. Root239 Isolate Unclassified
76 2643221735 Bacillus sp. Root920 Isolate Unclassified
77 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
78 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
79 2671180694 Paenibacillus sp. A3 Isolate Unclassified
80 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
81 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
82 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
83 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
84 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
85 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
86 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
87 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
88 2738541295 Bacillus sp. OK085 Isolate Unclassified
89 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
90 2738543017 Bacillus sp. OV186 Isolate Unclassified
91 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
92 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
93 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
94 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
95 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
96 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
97 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
98 2811994870 Bacillus sp. JB4 Isolate Unclassified
99 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
100 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
101 2818991441 Niallia circulans 3243 Isolate Rhizosphere
102 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
103 2818991459 Paenibacillus sp. 597 Isolate Unclassified
104 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
105 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
106 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
107 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
108 2842682962 Bacillus sp. R-72492 Isolate Unclassified
109 2842882022 Bacillus sp. R-71893 Isolate Unclassified
110 2849139964 Bacillus sp. R-71875 Isolate Unclassified
111 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
112 2857581216 Bacillus sp. R-71922 Isolate Unclassified
113 2857586860 Bacillus sp. R-71935 Isolate Unclassified
114 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
115 2860837431 Bacillus sp. WR11 Isolate Unclassified
116 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
117 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
118 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
119 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
120 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
121 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
122 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
123 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
124 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
125 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
126 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
127 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
128 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
129 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
130 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
131 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
132 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
133 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
134 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
135 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
136 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
137 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
138 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
139 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
140 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
141 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
142 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
143 2919720352 Priestia megaterium 4340 Isolate Unclassified
144 2919726948 Bacillus pumilus 4489 Isolate Unclassified
145 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
146 2929004312 Priestia megaterium 1104 Isolate Unclassified
147 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
148 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
149 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
150 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
151 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
152 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
153 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
154 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
155 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
156 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
157 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
158 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
159 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
160 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
161 2969141011 Bacillus velezensis MH25 Isolate Unclassified
162 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
163 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
164 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
165 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
166 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
167 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
168 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
169 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
170 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
171 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
172 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
173 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
174 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
175 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
176 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
177 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
178 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
179 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
180 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
181 8022653035 Bacillus sp. Rc4 Isolate Unclassified
182 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
183 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
184 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
185 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
186 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
187 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
188 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
189 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
190 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
191 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
192 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
193 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 46.96
Metatranscriptomes 0.64
Isolates 52.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.97
Nodule 0.64
Rhizoplane 8.31
Rhizosphere 33.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1007944 3300002737 Bacteria 1577
2 JGI25151J46595_10000046 3300003187 Bacteria 168647
3 JGI25151J46595_10001644 3300003187 Bacteria 14698
4 JGI25151J46595_10002503 3300003187 Bacteria 10960
5 JGI25151J46595_10003096 3300003187 Bacteria 9372
6 JGI25151J46595_10010210 3300003187 Bacteria 4378
7 JGI25151J46595_10017968 3300003187 Bacteria 3050
8 JGI25151J46595_10021308 3300003187 Bacteria 2714
9 JGI25151J46595_10037979 3300003187 Bacteria 1798
10 JGI25151J46595_10057797 3300003187 Bacteria 1261
11 JGI25151J46595_10070993 3300003187 Bacteria 1054
12 rootH1_10057463 3300003316 Bacteria 2000
13 rootH2_10104728 3300003320 Bacteria 1695
14 rootL2_10089199 3300003322 Bacteria 2388
15 rootL2_10153653 3300003322 Bacteria 6300
16 rootH1_10248568 3300003323 Bacteria 1198
17 Ga0006562J51391_1002636 3300003578 Bacteria 12190
18 Ga0006562J51391_1016660 3300003578 Bacteria 3584
19 Ga0055538_1000081 3300003751 Bacteria 85159
20 Ga0055538_1000121 3300003751 Bacteria 59513
21 Ga0055538_1000160 3300003751 Bacteria 44715
22 Ga0055538_1000189 3300003751 Bacteria 37630
23 Ga0055538_1000241 3300003751 Bacteria 29788
24 Ga0055532_1000121 3300003758 Bacteria 80171
25 Ga0055532_1014426 3300003758 Bacteria 887
26 Ga0055536_1027907 3300003781 Bacteria 1549
27 Ga0055536_1030439 3300003781 Bacteria 1432
28 Ga0070715_10133773 3300006163 Bacteria 1196
29 Ga0105251_10079357 3300009011 Bacteria 1519
30 Ga0105244_10005671 3300009036 Bacteria 8242
31 Ga0105244_10018839 3300009036 Bacteria 3865
32 Ga0105244_10027650 3300009036 Bacteria 3054
33 Ga0105250_10153332 3300009092 Bacteria 959
34 Ga0105245_10327502 3300009098 Bacteria 1511
35 Ga0105246_10036560 3300011119 Bacteria 3291
36 Ga0157371_10003838 3300013102 Bacteria 13413
37 Ga0157371_10059860 3300013102 Bacteria 2700
38 Ga0157371_10142886 3300013102 Bacteria 1705
39 Ga0157372_10327723 3300013307 Bacteria 1783
40 Ga0209784_100044 3300025224 Bacteria 206858
41 Ga0209784_100105 3300025224 Bacteria 98262
42 Ga0209784_100198 3300025224 Bacteria 43159
43 Ga0209784_100309 3300025224 Bacteria 25675
44 Ga0209147_100062 3300025229 Bacteria 242831
45 Ga0209147_100520 3300025229 Bacteria 22347
46 Ga0209147_101090 3300025229 Bacteria 11375
47 Ga0209437_100862 3300025233 Bacteria 12798
48 Ga0209437_101005 3300025233 Bacteria 9800
49 Ga0209130_1013115 3300025284 Bacteria 2136
50 Ga0209130_1020407 3300025284 Bacteria 1517
51 Ga0209676_1002524 3300025292 Bacteria 12769
52 Ga0209676_1003742 3300025292 Bacteria 9039
53 Ga0209676_1005084 3300025292 Bacteria 7024
54 Ga0209676_1031279 3300025292 Bacteria 1617
55 Ga0209676_1035496 3300025292 Bacteria 1461
56 Ga0209676_1043992 3300025292 Bacteria 1228
57 Ga0209025_1000001 3300025294 Bacteria 1888151
58 Ga0209025_1000287 3300025294 Bacteria 113923
59 Ga0209025_1000647 3300025294 Bacteria 60954
60 Ga0209025_1001244 3300025294 Bacteria 35424
61 Ga0209025_1002175 3300025294 Bacteria 21791
62 Ga0209025_1002323 3300025294 Bacteria 20551
63 Ga0209025_1008146 3300025294 Bacteria 7606
64 Ga0209025_1009080 3300025294 Bacteria 7007
65 Ga0209025_1009486 3300025294 Bacteria 6767
66 Ga0209025_1011621 3300025294 Bacteria 5771
67 Ga0209025_1025121 3300025294 Bacteria 3045
68 Ga0209025_1065616 3300025294 Bacteria 1324
69 Ga0207426_1017695 3300025302 Bacteria 2528
70 Ga0207696_1010260 3300025711 Bacteria 3446
71 Ga0207655_1008152 3300025728 Bacteria 6696
72 Ga0207655_1038885 3300025728 Bacteria 2073
73 Ga0207655_1041206 3300025728 Bacteria 1981
74 Ga0207713_1012015 3300025735 Bacteria 4662
75 Ga0207713_1071661 3300025735 Bacteria 1278
76 Ga0209371_1004583 3300027312 Bacteria 5917
77 Ga0265323_10058925 3300028653 Archaea 1340
78 Ga0268256_1003093 3300030500 Bacteria 7781
79 Ga0495603_0032225 3300046455 Bacteria 3154
80 Ga0495603_0061455 3300046455 Bacteria 2218
81 Ga0495603_0063549 3300046455 Bacteria 2177
82 Ga0495603_0063981 3300046455 Bacteria 2169
83 Ga0495585_0152029 3300046492 Bacteria 1206
84 Ga0495611_0136808 3300046648 Bacteria 1144
85 Ga0495649_0129864 3300046694 Bacteria 1330
86 Ga0495660_0021742 3300046810 Bacteria 3669
87 Ga0496101_0009437 3300048904 Bacteria 6413
88 Ga0496102_0080612 3300048905 Bacteria 2998
89 Ga0496103_0032946 3300048906 Bacteria 3164
90 Ga0496104_0007340 3300048907 Bacteria 9732
91 Ga0496105_0031731 3300048908 Bacteria 4332
92 Ga0496106_0041750 3300048909 Bacteria 3438
93 Ga0496107_0000190 3300048910 Bacteria 31945
94 Ga0496107_0007172 3300048910 Bacteria 7680
95 Ga0496108_0003397 3300048911 Bacteria 12781
96 Ga0496108_0014868 3300048911 Bacteria 6350
97 Ga0496108_0197488 3300048911 Bacteria 1745
98 Ga0496109_0015576 3300048912 Bacteria 6630
99 Ga0496110_0000447 3300048913 Bacteria 28092
100 Ga0496110_0051970 3300048913 Bacteria 3601
101 Ga0496111_0005054 3300048914 Bacteria 8393
102 Ga0496111_0007350 3300048914 Bacteria 7211
103 Ga0496111_0096353 3300048914 Bacteria 2171
104 Ga0496112_0041143 3300048915 Bacteria 4520
105 Ga0496113_0013359 3300048916 Bacteria 5559
106 Ga0496114_0242299 3300048917 Bacteria 1586
107 Ga0496114_0740868 3300048917 Bacteria 860
108 Ga0496116_0016810 3300048919 Bacteria 5708
109 Ga0496116_0031316 3300048919 Bacteria 3810
110 Ga0496116_0058531 3300048919 Bacteria 2512
111 Ga0496116_0061145 3300048919 Bacteria 2439
112 Ga0496116_0202893 3300048919 Bacteria 1036
113 Ga0496117_0024885 3300048920 Bacteria 4718
114 Ga0496117_0070699 3300048920 Bacteria 2343
115 Ga0496118_0065098 3300048921 Bacteria 2669
116 Ga0496118_0192614 3300048921 Bacteria 1218
117 Ga0496119_0001964 3300048922 Bacteria 23377
118 Ga0496119_0031606 3300048922 Bacteria 3545
119 Ga0496119_0226519 3300048922 Bacteria 954
120 Ga0496120_0001344 3300048923 Bacteria 30284
121 Ga0496120_0008276 3300048923 Bacteria 7590
122 Ga0496120_0023002 3300048923 Bacteria 3908
123 Ga0496120_0172325 3300048923 Bacteria 1069
124 Ga0496121_0008191 3300048924 Bacteria 12405
125 Ga0496121_0071911 3300048924 Bacteria 2780
126 Ga0496122_0010420 3300048925 Bacteria 9589
127 Ga0496122_0015132 3300048925 Bacteria 7395
128 Ga0496122_0021753 3300048925 Bacteria 5726
129 Ga0496122_0023506 3300048925 Bacteria 5430
130 Ga0496122_0039234 3300048925 Bacteria 3779
131 Ga0496122_0152947 3300048925 Bacteria 1421
132 Ga0496122_0238374 3300048925 Bacteria 1028
133 Ga0496122_0248833 3300048925 Bacteria 996
134 Ga0496123_0051215 3300048926 Bacteria 2751
135 Ga0496123_0239196 3300048926 Bacteria 903
136 Ga0496124_0000924 3300048927 Bacteria 47434
137 Ga0496124_0001846 3300048927 Bacteria 29253
138 Ga0496124_0135851 3300048927 Bacteria 1947
139 Ga0496124_0159494 3300048927 Bacteria 1760
140 Ga0496125_0003247 3300048928 Bacteria 20031
141 Ga0496125_0009088 3300048928 Bacteria 10279
142 Ga0496125_0018455 3300048928 Bacteria 6625
143 Ga0496125_0024087 3300048928 Bacteria 5605
144 Ga0496125_0183654 3300048928 Bacteria 1390
145 Ga0496126_0001573 3300048929 Bacteria 34950
146 Ga0496126_0003809 3300048929 Bacteria 18704
147 Ga0496126_0020781 3300048929 Bacteria 6426
148 Ga0496126_0032988 3300048929 Bacteria 4874
149 Ga0496126_0834272 3300048929 Bacteria 704
150 2777836610 2775507192 Bacteria 4622234
151 2511700697 2511231119 Bacteria 4019861
152 2540607921 2540341094 Bacteria 4061186
153 2545557395 2545555800 Bacteria 4222588
154 2550902797 2548877040 Bacteria 7507281
155 2571532029 2571042143 Bacteria 6986194
156 2595091892 2593339131 Bacteria 5116855
157 2600199183 2599185353 Bacteria 2219443
158 2600199611 2599185353 Bacteria 2219443
159 2600401744 2600254943 Bacteria 2613887
160 2600402365 2600254943 Bacteria 2613887
161 2631983576 2630968484 Bacteria 3876276
162 2643736434 2643221543 Bacteria 6628015
163 2643739290 2643221543 Bacteria 6628015
164 2644423600 2643221676 Bacteria 8119172
165 2644716442 2643221731 Bacteria 5623886
166 2644716949 2643221731 Bacteria 5623886
167 2644723688 2643221732 Bacteria 5756404
168 2644725770 2643221732 Bacteria 5756404
169 2644741490 2643221735 Bacteria 3676263
170 2651532585 2648501850 Bacteria 3975476
171 2672337461 2671180330 Bacteria 5521719
172 2673819981 2671180694 Bacteria 7506943
173 2674418481 2671180844 Bacteria 4164150
174 2686997913 2684623153 Bacteria 3878815
175 2687499253 2687453109 Bacteria 3860091
176 2695628687 2695420354 Bacteria 3922431
177 2717915616 2716884898 Bacteria 3928789
178 2723606756 2721755693 Bacteria 6126117
179 2728530799 2728368933 Bacteria 7044283
180 2730137337 2728369359 Bacteria 5621728
181 2738816537 2738541295 Bacteria 5730091
182 2738840543 2738541299 Bacteria 4020721
183 2739269349 2738543017 Bacteria 4271950
184 2757566939 2757320391 Bacteria 4746095
185 2777760842 2775507177 Bacteria 4384303
186 2791211675 2788500588 Bacteria 4584915
187 2791215884 2788500588 Bacteria 4584915
188 2793182613 2791355222 Bacteria 5898266
189 2802437579 2802428803 Bacteria 5806948
190 2808870840 2808606364 Bacteria 4465927
191 2809056287 2808606399 Bacteria 4021018
192 2812317107 2811994870 Bacteria 3776934
193 2816862129 2816332186 Bacteria 5331395
194 2817482271 2816332295 Bacteria 4352468
195 2819566856 2818991441 Bacteria 5062707
196 2819627554 2818991451 Bacteria 4697364
197 2819628677 2818991451 Bacteria 4697364
198 2819675851 2818991459 Bacteria 8736032
199 2819709911 2818991465 Bacteria 5388835
200 2819710394 2818991465 Bacteria 5388835
201 2819724187 2818991468 Bacteria 3723169
202 2821113267 2821111986 Bacteria 6894338
203 2821114167 2821111986 Bacteria 6894338
204 2823529067 2823526263 Bacteria 3765752
205 2842684960 2842682962 Bacteria 5589973
206 2842886836 2842882022 Bacteria 6158489
207 2849141519 2849139964 Bacteria 5613304
208 2857457863 2857453340 Bacteria 8090534
209 2857457903 2857453340 Bacteria 8090534
210 2857584043 2857581216 Bacteria 5522813
211 2857589030 2857586860 Bacteria 4354574
212 2857606072 2857604169 Bacteria 5111450
213 2860840700 2860837431 Bacteria 4202080
214 2864738747 2864733723 Bacteria 6770668
215 2865008435 2865002811 Bacteria 6333767
216 2877771611 2877768649 Bacteria 3957164
217 2880172457 2880169592 Bacteria 3900066
218 2881646387 2881644220 Bacteria 5302661
219 2881649666 2881644220 Bacteria 5302661
220 2885526524 2885526491 Bacteria 7164189
221 2885530524 2885526491 Bacteria 7164189
222 2888583047 2888578766 Bacteria 6743310
223 2889044224 2889042446 Bacteria 7618936
224 2889045224 2889042446 Bacteria 7618936
225 2889054734 2889049205 Bacteria 7524325
226 2889277305 2889276214 Bacteria 5979355
227 2897112731 2897109615 Bacteria 4009619
228 2904165073 2904162308 Bacteria 7086713
229 2904166072 2904162308 Bacteria 7086713
230 2904491114 2904490793 Bacteria 7046938
231 2904492097 2904490793 Bacteria 7046938
232 2904525726 2904524088 Bacteria 5887454
233 2904564058 2904560550 Bacteria 4029838
234 2904595983 2904595352 Bacteria 6124848
235 2904609104 2904606771 Bacteria 4684500
236 2904610124 2904606771 Bacteria 4684500
237 2904761458 2904755435 Bacteria 7986759
238 2907204480 2907202186 Bacteria 6632024
239 2907206585 2907202186 Bacteria 6632024
240 2908667721 2908665501 Bacteria 3678115
241 2915599984 2915597211 Bacteria 6475886
242 2916976378 2916971899 Bacteria 4250608
243 2919095515 2919093281 Bacteria 3660974
244 2919145679 2919143609 Bacteria 6219228
245 2919160362 2919160200 Bacteria 6929020
246 2919161327 2919160200 Bacteria 6929020
247 2919432230 2919425241 Bacteria 8055701
248 2919517620 2919517244 Bacteria 5858162
249 2919721994 2919720352 Bacteria 5986006
250 2919722535 2919720352 Bacteria 5986006
251 2919728775 2919726948 Bacteria 3696050
252 2928094242 2928093941 Bacteria 5965005
253 2929005691 2929004312 Bacteria 5678476
254 2929007216 2929004312 Bacteria 5678476
255 2931387659 2931384279 Bacteria 7299545
256 2931388658 2931384279 Bacteria 7299545
257 2936344425 2936340661 Bacteria 5139038
258 2936364057 2936361878 Bacteria 5632809
259 2938652335 2938649242 Bacteria 7118381
260 2939595674 2939593269 Bacteria 4798695
261 2939596148 2939593269 Bacteria 4798695
262 2939682748 2939679117 Bacteria 6921672
263 2939703282 2939702853 Bacteria 5139229
264 2945992769 2945991243 Bacteria 7008369
265 2945993753 2945991243 Bacteria 7008369
266 2946055518 2946053406 Bacteria 6978655
267 2946056487 2946053406 Bacteria 6978655
268 2960320161 2960319331 Bacteria 5502575
269 2960321028 2960319331 Bacteria 5502575
270 2960379408 2960375949 Bacteria 5361395
271 2960380132 2960375949 Bacteria 5361395
272 2962293919 2962290636 Bacteria 4072939
273 2968559489 2968558590 Bacteria 6956864
274 2969139905 2969136845 Bacteria 3923176
275 2969144054 2969141011 Bacteria 4118468
276 2969769626 2969765954 Bacteria 4216713
277 2969772690 2969770375 Bacteria 4271280
278 2971409149 2971403814 Bacteria 7370929
279 2971412908 2971410472 Bacteria 8311090
280 2971416417 2971410472 Bacteria 8311090
281 2971896279 2971893375 Bacteria 3929648
282 2977255732 2977254563 Bacteria 4828420
283 2980187555 2980182181 Bacteria 9454109
284 2980495694 2980492589 Bacteria 4072961
285 2988229992 2988225383 Bacteria 7221625
286 2990276540 2990275345 Bacteria 4887158
287 2996638428 2996632988 Bacteria 6921523
288 2996707930 2996706504 Bacteria 5757485
289 3001898443 3001892409 Bacteria 6328293
290 3006829489 3006826541 Bacteria 4678913
291 3006862705 3006858327 Bacteria 4317835
292 3006882126 3006879489 Bacteria 4064221
293 3006980236 3006978542 Bacteria 5328100
294 648172711 648028048 Bacteria 5394884
295 8022632338 8022630665 Bacteria 3886130
296 8022654860 8022653035 Bacteria 4035078
297 8022895556 8022893055 Bacteria 5300455
298 8022898741 8022893055 Bacteria 5300455
299 8022916670 8022914991 Bacteria 5584517
300 8022920259 8022914991 Bacteria 5584517
301 8022920651 8022914991 Bacteria 5584517
302 8022953027 8022948649 Bacteria 5366783
303 8051954770 8051952484 Bacteria 3926774
304 8052176523 8052174270 Bacteria 3881265
305 8054284542 8054280661 Bacteria 4232245
306 8054469269 8054465665 Bacteria 7323556
307 8054803312 8054795415 Bacteria 9785225
308 8055532251 8055531788 Bacteria 5249694
309 8055537102 8055531788 Bacteria 5249694
310 8056534405 8056533031 Bacteria 8964429
311 8056534450 8056533031 Bacteria 8964429
312 8057476493 8057473075 Bacteria 5892720
313 8057636826 8057632132 Bacteria 4726859
314 JGI25162J39368_1007944
315 JGI25151J46595_10000046
316 JGI25151J46595_10001644
317 JGI25151J46595_10002503
318 JGI25151J46595_10003096
319 JGI25151J46595_10010210
320 JGI25151J46595_10017968
321 JGI25151J46595_10021308
322 JGI25151J46595_10037979
323 JGI25151J46595_10057797
324 JGI25151J46595_10070993
325 rootH1_10057463
326 rootH2_10104728
327 rootL2_10089199
328 rootL2_10153653
329 rootH1_10248568
330 Ga0006562J51391_1002636
331 Ga0006562J51391_1016660
332 Ga0055538_1000081
333 Ga0055538_1000121
334 Ga0055538_1000160
335 Ga0055538_1000189
336 Ga0055538_1000241
337 Ga0055532_1000121
338 Ga0055532_1014426
339 Ga0055536_1027907
340 Ga0055536_1030439
341 Ga0070715_10133773
342 Ga0105251_10079357
343 Ga0105244_10005671
344 Ga0105244_10018839
345 Ga0105244_10027650
346 Ga0105250_10153332
347 Ga0105245_10327502
348 Ga0105246_10036560
349 Ga0157371_10003838
350 Ga0157371_10059860
351 Ga0157371_10142886
352 Ga0157372_10327723
353 Ga0209784_100044
354 Ga0209784_100105
355 Ga0209784_100198
356 Ga0209784_100309
357 Ga0209147_100062
358 Ga0209147_100520
359 Ga0209147_101090
360 Ga0209437_100862
361 Ga0209437_101005
362 Ga0209130_1013115
363 Ga0209130_1020407
364 Ga0209676_1002524
365 Ga0209676_1003742
366 Ga0209676_1005084
367 Ga0209676_1031279
368 Ga0209676_1035496
369 Ga0209676_1043992
370 Ga0209025_1000001
371 Ga0209025_1000287
372 Ga0209025_1000647
373 Ga0209025_1001244
374 Ga0209025_1002175
375 Ga0209025_1002323
376 Ga0209025_1008146
377 Ga0209025_1009080
378 Ga0209025_1009486
379 Ga0209025_1011621
380 Ga0209025_1025121
381 Ga0209025_1065616
382 Ga0207426_1017695
383 Ga0207696_1010260
384 Ga0207655_1008152
385 Ga0207655_1038885
386 Ga0207655_1041206
387 Ga0207713_1012015
388 Ga0207713_1071661
389 Ga0209371_1004583
390 Ga0265323_10058925
391 Ga0268256_1003093
392 Ga0495603_0032225
393 Ga0495603_0061455
394 Ga0495603_0063549
395 Ga0495603_0063981
396 Ga0495585_0152029
397 Ga0495611_0136808
398 Ga0495649_0129864
399 Ga0495660_0021742
400 Ga0496101_0009437
401 Ga0496102_0080612
402 Ga0496103_0032946
403 Ga0496104_0007340
404 Ga0496105_0031731
405 Ga0496106_0041750
406 Ga0496107_0000190
407 Ga0496107_0007172
408 Ga0496108_0003397
409 Ga0496108_0014868
410 Ga0496108_0197488
411 Ga0496109_0015576
412 Ga0496110_0000447
413 Ga0496110_0051970
414 Ga0496111_0005054
415 Ga0496111_0007350
416 Ga0496111_0096353
417 Ga0496112_0041143
418 Ga0496113_0013359
419 Ga0496114_0242299
420 Ga0496114_0740868
421 Ga0496116_0016810
422 Ga0496116_0031316
423 Ga0496116_0058531
424 Ga0496116_0061145
425 Ga0496116_0202893
426 Ga0496117_0024885
427 Ga0496117_0070699
428 Ga0496118_0065098
429 Ga0496118_0192614
430 Ga0496119_0001964
431 Ga0496119_0031606
432 Ga0496119_0226519
433 Ga0496120_0001344
434 Ga0496120_0008276
435 Ga0496120_0023002
436 Ga0496120_0172325
437 Ga0496121_0008191
438 Ga0496121_0071911
439 Ga0496122_0010420
440 Ga0496122_0015132
441 Ga0496122_0021753
442 Ga0496122_0023506
443 Ga0496122_0039234
444 Ga0496122_0152947
445 Ga0496122_0238374
446 Ga0496122_0248833
447 Ga0496123_0051215
448 Ga0496123_0239196
449 Ga0496124_0000924
450 Ga0496124_0001846
451 Ga0496124_0135851
452 Ga0496124_0159494
453 Ga0496125_0003247
454 Ga0496125_0009088
455 Ga0496125_0018455
456 Ga0496125_0024087
457 Ga0496125_0183654
458 Ga0496126_0001573
459 Ga0496126_0003809
460 Ga0496126_0020781
461 Ga0496126_0032988
462 Ga0496126_0834272
463 2777836610
464 2511700697
465 2540607921
466 2545557395
467 2550902797
468 2571532029
469 2595091892
470 2600199183
471 2600199611
472 2600401744
473 2600402365
474 2631983576
475 2643736434
476 2643739290
477 2644423600
478 2644716442
479 2644716949
480 2644723688
481 2644725770
482 2644741490
483 2651532585
484 2672337461
485 2673819981
486 2674418481
487 2686997913
488 2687499253
489 2695628687
490 2717915616
491 2723606756
492 2728530799
493 2730137337
494 2738816537
495 2738840543
496 2739269349
497 2757566939
498 2777760842
499 2791211675
500 2791215884
501 2793182613
502 2802437579
503 2808870840
504 2809056287
505 2812317107
506 2816862129
507 2817482271
508 2819566856
509 2819627554
510 2819628677
511 2819675851
512 2819709911
513 2819710394
514 2819724187
515 2821113267
516 2821114167
517 2823529067
518 2842684960
519 2842886836
520 2849141519
521 2857457863
522 2857457903
523 2857584043
524 2857589030
525 2857606072
526 2860840700
527 2864738747
528 2865008435
529 2877771611
530 2880172457
531 2881646387
532 2881649666
533 2885526524
534 2885530524
535 2888583047
536 2889044224
537 2889045224
538 2889054734
539 2889277305
540 2897112731
541 2904165073
542 2904166072
543 2904491114
544 2904492097
545 2904525726
546 2904564058
547 2904595983
548 2904609104
549 2904610124
550 2904761458
551 2907204480
552 2907206585
553 2908667721
554 2915599984
555 2916976378
556 2919095515
557 2919145679
558 2919160362
559 2919161327
560 2919432230
561 2919517620
562 2919721994
563 2919722535
564 2919728775
565 2928094242
566 2929005691
567 2929007216
568 2931387659
569 2931388658
570 2936344425
571 2936364057
572 2938652335
573 2939595674
574 2939596148
575 2939682748
576 2939703282
577 2945992769
578 2945993753
579 2946055518
580 2946056487
581 2960320161
582 2960321028
583 2960379408
584 2960380132
585 2962293919
586 2968559489
587 2969139905
588 2969144054
589 2969769626
590 2969772690
591 2971409149
592 2971412908
593 2971416417
594 2971896279
595 2977255732
596 2980187555
597 2980495694
598 2988229992
599 2990276540
600 2996638428
601 2996707930
602 3001898443
603 3006829489
604 3006862705
605 3006882126
606 3006980236
607 648172711
608 8022632338
609 8022654860
610 8022895556
611 8022898741
612 8022916670
613 8022920259
614 8022920651
615 8022953027
616 8051954770
617 8052176523
618 8054284542
619 8054469269
620 8054803312
621 8055532251
622 8055537102
623 8056534405
624 8056534450
625 8057476493
626 8057636826

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

204

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g3l-assembly1.cif.gz_B bceab-s nucleotide free bces state 2 0.9696 3 246
8g3l-assembly1.cif.gz_B bceab-s nucleotide free bces state 2 0.9658 3 246
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9644 1 227
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.956 1 227
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9524 4 226
ID Description Score Start End Superfamily
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9915 1 226 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9829 1 226 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9719 3 244 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.97 1 226 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9602 3 244 3.40.50.300
ID Description Score Start End GO Terms
AF-Q7V2N9-F1-model_v4 Possible ABC transporter, ATP binding protein 0.9648 2 227 GO:0005524
GO:0016887
AF-C0GFN8-F1-model_v4 ABC transporter related protein 0.9637 39 223 GO:0005524
GO:0016887
AF-G5IEQ9-F1-model_v4 ABC transporter domain-containing protein 0.9601 2 226 GO:0005524
GO:0016887
AF-A0A7V9KYT5-F1-model_v4 ABC transporter ATP-binding protein 0.9588 1 176 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A0B0HZW9-F1-model_v4 deleted 0.9575 2 157

Map