F402395

General Info

Members Datasets Scaffolds Average Seq Length
313 198 626 203

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0128937|Ga0501037_0128937_198_866
Length 222
Sequence MAWQRLNFVLYNLNSFKMRVAIVFNHPYEGSYCNAVLQAVTSGLQKAGHEVDLMHLDRDNFDPVMRSKDLSAFARTKNEGEAIYRDIDPQVLNYKQRLEQAEHLVFIFPVWWELMPAMTKGFIDKVIFPGITYDYAKSGLKMISRLTQLKGATIITTQNTPALVYRLFFGNAIKYAMLRGTFWKIGFPKRKWINLCMVKFVSDKKRRKWLINIENRFSGLQG

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
38 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
50 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
51 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
58 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
59 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
60 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
61 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
62 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
63 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
64 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
65 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
66 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
67 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
68 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
69 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
70 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
71 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
72 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
73 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
74 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
75 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
76 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
77 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
78 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
79 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
80 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
81 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
84 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
85 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
95 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
98 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
99 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
100 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
101 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
116 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
117 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
131 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
132 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
149 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
150 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
151 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
152 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
153 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
154 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
155 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
156 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
160 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
161 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
162 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
163 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
164 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
165 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
166 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
167 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
168 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
169 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
170 2738541278 Niastella sp. CF465 Isolate Unclassified
171 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
172 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
173 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
174 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
175 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
176 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
177 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
178 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
179 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
180 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
181 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
182 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
183 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
184 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
185 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
186 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
187 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
188 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
189 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
190 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
191 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
192 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
193 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
194 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
195 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
196 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
197 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
198 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.22
Metatranscriptomes 0
Isolates 12.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.64
Bulb 0
Endosphere 4.15
Nodule 0
Rhizoplane 3.51
Rhizosphere 75.08
Stem 0
Stem Tuber 0
Unclassified 6.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0128937 3300049573 Unclassified 1815
2 MRS1b_contig_5348288 2162886011 Bacteria 3661
3 rootH1_10074903 3300003316 Bacteria 2928
4 rootH1_10105567 3300003316 Bacteria 3467
5 rootH1_10155350 3300003316 Unclassified 2205
6 rootH2_10056261 3300003320 Bacteria 14958
7 rootL2_10124107 3300003322 Bacteria 1892
8 rootL2_10364642 3300003322 Bacteria 2111
9 JGI25160J50197_1003406 3300003354 Bacteria 7120
10 Ga0058692_1023049 3300003856 Bacteria 1271
11 Ga0065714_10069641 3300005288 Bacteria 4147
12 Ga0070684_100012542 3300005535 Bacteria 6799
13 Ga0068853_100223921 3300005539 Bacteria 1719
14 Ga0068853_100241597 3300005539 Bacteria 1655
15 Ga0070665_100000018 3300005548 Bacteria 434118
16 Ga0068855_100009387 3300005563 Bacteria 11817
17 Ga0068855_100193447 3300005563 Bacteria 2293
18 Ga0068854_100387255 3300005578 Unclassified 1153
19 Ga0068852_100039840 3300005616 Bacteria 3959
20 Ga0068861_100630997 3300005719 Bacteria 987
21 Ga0068862_100218085 3300005844 Bacteria 1726
22 Ga0105251_10053656 3300009011 Bacteria 1916
23 Ga0105244_10000962 3300009036 Bacteria 24195
24 Ga0105244_10035907 3300009036 Bacteria 2600
25 Ga0105240_10000452 3300009093 Bacteria 75496
26 Ga0105240_10011297 3300009093 Bacteria 12444
27 Ga0114129_10006355 3300009147 Bacteria 16753
28 Ga0105243_10222683 3300009148 Bacteria 1669
29 Ga0105241_10182338 3300009174 Bacteria 1742
30 Ga0105241_10491763 3300009174 Bacteria 1092
31 Ga0105237_10003067 3300009545 Bacteria 20140
32 Ga0105238_11180537 3300009551 Bacteria 789
33 Ga0105239_10050406 3300010375 Bacteria 4566
34 Ga0105246_10323145 3300011119 Bacteria 1255
35 Ga0157373_10019646 3300013100 Bacteria 4915
36 Ga0157371_10026357 3300013102 Bacteria 4227
37 Ga0157371_10048992 3300013102 Bacteria 3002
38 Ga0157370_10010138 3300013104 Bacteria 9950
39 Ga0157369_10006552 3300013105 Bacteria 13479
40 Ga0157369_10153149 3300013105 Unclassified 2436
41 Ga0157374_10406615 3300013296 Unclassified 1358
42 Ga0157378_11343627 3300013297 Bacteria 757
43 Ga0163162_10003073 3300013306 Bacteria 15950
44 Ga0157372_10000244 3300013307 Bacteria 60217
45 Ga0157372_10099703 3300013307 Bacteria 3314
46 Ga0163163_10340680 3300014325 Bacteria 1554
47 Ga0182008_10017082 3300014497 Bacteria 3765
48 Ga0182006_1035487 3300015261 Bacteria 1988
49 Ga0182006_1061751 3300015261 Bacteria 1412
50 Ga0207655_1001559 3300025728 Bacteria 20668
51 Ga0207655_1061052 3300025728 Bacteria 1458
52 Ga0207713_1000074 3300025735 Bacteria 181376
53 Ga0207695_10000060 3300025913 Bacteria 360217
54 Ga0207695_10130398 3300025913 Bacteria 2472
55 Ga0207671_10002891 3300025914 Bacteria 17784
56 Ga0207694_10121169 3300025924 Bacteria 2089
57 Ga0207667_10000084 3300025949 Bacteria 152086
58 Ga0207640_10403572 3300025981 Unclassified 1114
59 Ga0207639_10221020 3300026041 Unclassified 1636
60 Ga0209371_1001305 3300027312 Bacteria 17451
61 Ga0268266_10000026 3300028379 Bacteria 434485
62 Ga0268265_10430848 3300028380 Bacteria 1227
63 Ga0307517_10004138 3300028786 Bacteria 22383
64 Ga0307517_10108708 3300028786 Unclassified 2126
65 Ga0307517_10145961 3300028786 Unclassified 1642
66 Ga0307515_10000091 3300028794 Bacteria 214014
67 Ga0307515_10342696 3300028794 Bacteria 1146
68 Ga0268256_1001429 3300030500 Bacteria 14413
69 Ga0265327_10000122 3300031251 Bacteria 169992
70 Ga0307509_10077420 3300031507 Bacteria 3449
71 Ga0307408_100000027 3300031548 Bacteria 261506
72 Ga0265313_10094187 3300031595 Bacteria 1339
73 Ga0265313_10107086 3300031595 Bacteria 1233
74 Ga0307414_10302626 3300032004 Bacteria 1353
75 Ga0307510_10009263 3300033180 Bacteria 11736
76 Ga0307510_10058562 3300033180 Bacteria 3987
77 Ga0373936_0024324 3300035113 Unclassified 2364
78 Ga0400489_44762 3300039093 Bacteria 1231
79 Ga0439436_0012055 3300041404 Bacteria 2624
80 Ga0439438_004744 3300041405 Bacteria 5142
81 Ga0439447_000357 3300041407 Bacteria 16567
82 Ga0439461_0007283 3300041410 Bacteria 1954
83 Ga0439466_0002019 3300041411 Bacteria 7969
84 Ga0439466_0006283 3300041411 Bacteria 4523
85 Ga0439466_0121648 3300041411 Bacteria 805
86 Ga0451807_1835704 3300041486 Bacteria 1088
87 Ga0439431_0003909 3300041997 Bacteria 3287
88 Ga0439431_0058106 3300041997 Bacteria 1013
89 Ga0439437_001647 3300042000 Bacteria 2360
90 Ga0439432_034260 3300042006 Bacteria 1631
91 Ga0439452_003974 3300042010 Bacteria 5053
92 Ga0439456_000081 3300042013 Bacteria 33057
93 Ga0439456_034895 3300042013 Bacteria 1084
94 Ga0439463_000167 3300042016 Bacteria 17152
95 Ga0450911_000007 3300042115 Bacteria 212322
96 Ga0450904_000067 3300042139 Bacteria 23305
97 Ga0439446_0000473 3300042156 Bacteria 7969
98 Ga0439446_0001075 3300042156 Bacteria 6023
99 Ga0439446_0019939 3300042156 Bacteria 1886
100 Ga0439434_0003701 3300042435 Bacteria 4474
101 Ga0439459_0000862 3300042438 Bacteria 4228
102 Ga0439464_0000444 3300042439 Bacteria 8218
103 Ga0439464_0011405 3300042439 Bacteria 2355
104 Ga0450918_033144 3300042531 Bacteria 915
105 Ga0495617_035423 3300046452 Bacteria 1676
106 Ga0495627_000130 3300046453 Bacteria 91090
107 Ga0495627_010080 3300046453 Unclassified 3452
108 Ga0495627_019628 3300046453 Bacteria 2264
109 Ga0495591_000119 3300046458 Bacteria 87324
110 Ga0495591_000756 3300046458 Bacteria 23358
111 Ga0495591_004879 3300046458 Bacteria 6385
112 Ga0495591_006268 3300046458 Bacteria 5298
113 Ga0495591_067212 3300046458 Bacteria 938
114 Ga0495638_0025285 3300046460 Bacteria 3862
115 Ga0495638_0187790 3300046460 Bacteria 1174
116 Ga0495650_0001858 3300046471 Bacteria 18903
117 Ga0495650_0001938 3300046471 Bacteria 18294
118 Ga0495605_0000149 3300046474 Bacteria 90748
119 Ga0495605_0000429 3300046474 Bacteria 38029
120 Ga0495605_0000859 3300046474 Bacteria 21106
121 Ga0495605_0016005 3300046474 Bacteria 4068
122 Ga0495605_0059488 3300046474 Bacteria 1835
123 Ga0495584_0005774 3300046491 Bacteria 6528
124 Ga0495585_0011248 3300046492 Bacteria 5301
125 Ga0495596_0046177 3300046500 Bacteria 1711
126 Ga0495607_0000312 3300046501 Bacteria 50602
127 Ga0495607_0000379 3300046501 Bacteria 45776
128 Ga0495607_0000455 3300046501 Bacteria 40967
129 Ga0495607_0000464 3300046501 Bacteria 40712
130 Ga0495607_0004448 3300046501 Bacteria 10300
131 Ga0495607_0076460 3300046501 Bacteria 1852
132 Ga0495607_0107853 3300046501 Bacteria 1480
133 Ga0495607_0142787 3300046501 Bacteria 1233
134 Ga0495607_0260686 3300046501 Bacteria 830
135 Ga0495607_0264471 3300046501 Bacteria 822
136 Ga0495607_0388958 3300046501 Bacteria 636
137 Ga0495583_0000990 3300046506 Bacteria 32535
138 Ga0495583_0002285 3300046506 Bacteria 16764
139 Ga0495583_0003079 3300046506 Bacteria 13207
140 Ga0495583_0046068 3300046506 Bacteria 2012
141 Ga0495606_0000712 3300046507 Bacteria 51489
142 Ga0495606_0001261 3300046507 Bacteria 35236
143 Ga0495606_0055358 3300046507 Bacteria 2565
144 Ga0495610_0002975 3300046512 Bacteria 13669
145 Ga0495610_0020752 3300046512 Bacteria 3638
146 Ga0495620_0001154 3300046515 Bacteria 16178
147 Ga0495620_0009656 3300046515 Bacteria 5122
148 Ga0495620_0030095 3300046515 Bacteria 2504
149 Ga0495631_0007468 3300046518 Bacteria 5557
150 Ga0495631_0040970 3300046518 Bacteria 2050
151 Ga0495632_0002050 3300046519 Bacteria 15837
152 Ga0495632_0010457 3300046519 Bacteria 5494
153 Ga0495637_0000162 3300046520 Bacteria 50983
154 Ga0495637_0000231 3300046520 Bacteria 43247
155 Ga0495637_0011965 3300046520 Bacteria 4159
156 Ga0495637_0025137 3300046520 Bacteria 2686
157 Ga0495643_0000049 3300046522 Bacteria 212242
158 Ga0495643_0020632 3300046522 Bacteria 3795
159 Ga0495643_0122489 3300046522 Bacteria 1312
160 Ga0495644_0000341 3300046523 Bacteria 21235
161 Ga0495644_0071828 3300046523 Bacteria 1301
162 Ga0495648_0003503 3300046524 Bacteria 13761
163 Ga0495648_0029234 3300046524 Bacteria 3660
164 Ga0495648_0110612 3300046524 Bacteria 1496
165 Ga0495654_0013387 3300046530 Bacteria 4390
166 Ga0495654_0056820 3300046530 Bacteria 1891
167 Ga0495609_0000087 3300046538 Bacteria 110204
168 Ga0495609_0000213 3300046538 Bacteria 57790
169 Ga0495609_0087726 3300046538 Bacteria 1355
170 Ga0495597_0000097 3300046542 Bacteria 78347
171 Ga0495597_0029976 3300046542 Bacteria 2481
172 Ga0495597_0048217 3300046542 Bacteria 1885
173 Ga0495622_0029871 3300046557 Bacteria 2546
174 Ga0495668_0018140 3300046616 Bacteria 4070
175 Ga0495668_0027174 3300046616 Bacteria 3242
176 Ga0495668_0042157 3300046616 Bacteria 2541
177 Ga0495611_0000086 3300046648 Bacteria 66762
178 Ga0495625_0000145 3300046660 Bacteria 108480
179 Ga0495625_0050372 3300046660 Bacteria 2989
180 Ga0495625_0215901 3300046660 Bacteria 1259
181 Ga0495625_0254080 3300046660 Unclassified 1140
182 Ga0495625_0493107 3300046660 Bacteria 750
183 Ga0495661_0000193 3300046665 Bacteria 70300
184 Ga0495661_0000608 3300046665 Bacteria 36516
185 Ga0495661_0019857 3300046665 Bacteria 4396
186 Ga0495661_0061736 3300046665 Bacteria 2223
187 Ga0495670_0039044 3300046691 Bacteria 2368
188 Ga0495670_0078165 3300046691 Bacteria 1683
189 Ga0495671_0002074 3300046692 Bacteria 12862
190 Ga0495671_0014694 3300046692 Bacteria 4207
191 Ga0495671_0101189 3300046692 Bacteria 1408
192 Ga0495649_0000462 3300046694 Bacteria 34992
193 Ga0495649_0379770 3300046694 Unclassified 711
194 Ga0495660_0001305 3300046810 Bacteria 17241
195 Ga0495660_0003345 3300046810 Bacteria 9947
196 Ga0495660_0013003 3300046810 Bacteria 4824
197 Ga0495660_0106073 3300046810 Bacteria 1440
198 Ga0495660_0148156 3300046810 Bacteria 1161
199 Ga0495672_0014974 3300047320 Bacteria 5284
200 Ga0495672_0061544 3300047320 Bacteria 2163
201 Ga0495672_0063038 3300047320 Bacteria 2129
202 Ga0495676_0000119 3300047321 Bacteria 60424
203 Ga0495683_0040284 3300047323 Bacteria 2360
204 Ga0495687_000031 3300047443 Bacteria 274659
205 Ga0495679_000379 3300047446 Bacteria 34084
206 Ga0495673_0001123 3300047469 Bacteria 22938
207 Ga0495673_0001214 3300047469 Bacteria 21441
208 Ga0495673_0007109 3300047469 Bacteria 6485
209 Ga0495673_0008634 3300047469 Bacteria 5704
210 Ga0495673_0066350 3300047469 Bacteria 1530
211 Ga0495681_0020876 3300047470 Bacteria 3542
212 Ga0495686_0068935 3300047472 Bacteria 2181
213 Ga0495626_0000259 3300048091 Bacteria 60592
214 Ga0496102_0757251 3300048905 Bacteria 894
215 Ga0496110_0124933 3300048913 Bacteria 2321
216 Ga0496111_0080552 3300048914 Bacteria 2376
217 Ga0496116_0039458 3300048919 Bacteria 3265
218 Ga0496117_0066975 3300048920 Bacteria 2433
219 Ga0496118_0071089 3300048921 Bacteria 2507
220 Ga0496118_0143156 3300048921 Bacteria 1511
221 Ga0496118_0223546 3300048921 Bacteria 1093
222 Ga0496121_0000858 3300048924 Bacteria 55007
223 Ga0496121_0003434 3300048924 Bacteria 22636
224 Ga0496122_0003009 3300048925 Bacteria 22888
225 Ga0496123_0000550 3300048926 Bacteria 64267
226 Ga0496123_0017814 3300048926 Bacteria 5689
227 Ga0496123_0224411 3300048926 Bacteria 945
228 Ga0496124_0000355 3300048927 Bacteria 83748
229 Ga0496124_0007064 3300048927 Bacteria 12028
230 Ga0496124_0031263 3300048927 Bacteria 4715
231 Ga0496124_0040568 3300048927 Bacteria 4025
232 Ga0496124_0090632 3300048927 Bacteria 2493
233 Ga0495678_000338 3300049459 Bacteria 49205
234 Ga0495678_005524 3300049459 Bacteria 6954
235 Ga0495682_0000170 3300049460 Bacteria 55005
236 Ga0501295_043147 3300049518 Bacteria 943
237 Ga0501032_0056305 3300049569 Bacteria 2643
238 Ga0501034_0079838 3300049571 Bacteria 3275
239 Ga0501034_0095957 3300049571 Unclassified 2961
240 Ga0501034_0200459 3300049571 Unclassified 1954
241 Ga0501034_0655095 3300049571 Bacteria 951
242 Ga0501034_0986817 3300049571 Bacteria 727
243 Ga0501037_0025390 3300049573 Bacteria 4379
244 Ga0501039_0116020 3300049575 Bacteria 2096
245 Ga0501043_0109466 3300049579 Unclassified 2169
246 Ga0501047_0546592 3300049581 Unclassified 983
247 Ga0501070_0158376 3300049586 Bacteria 1867
248 Ga0501071_0143062 3300049587 Bacteria 1782
249 Ga0501073_0031899 3300049589 Bacteria 3759
250 Ga0501074_0510760 3300049590 Bacteria 851
251 Ga0501080_0103062 3300049742 Bacteria 2646
252 Ga0501035_0496708 3300049822 Bacteria 1005
253 Ga0501035_0627676 3300049822 Bacteria 873
254 Ga0501035_0836472 3300049822 Bacteria 733
255 Ga0501044_0057972 3300049823 Bacteria 3973
256 Ga0501044_0243802 3300049823 Bacteria 1740
257 Ga0501226_000006 3300049853 Bacteria 259153
258 nmdc:mga05p37_7918_c1 3300050507 Bacteria 12540
259 nmdc:mga08x19_388400_c1 3300050514 Bacteria 978
260 Ga0500578_0021565 3300053086 Bacteria 4138
261 Ga0500646_0038415 3300053090 Unclassified 1340
262 Ga0500646_0067578 3300053090 Bacteria 1066
263 Ga0500583_0399108 3300053092 Bacteria 660
264 Ga0500650_0066372 3300053098 Bacteria 1686
265 Ga0500642_0053174 3300053130 Unclassified 1795
266 Ga0500568_0257906 3300053139 Bacteria 634
267 Ga0500586_068351 3300053145 Bacteria 1242
268 Ga0500586_163495 3300053145 Bacteria 753
269 Ga0500588_0000560 3300053146 Bacteria 6049
270 Ga0500588_0004990 3300053146 Bacteria 2917
271 Ga0500622_0004885 3300053156 Bacteria 8206
272 Ga0501084_0244829 3300054114 Unclassified 1513
273 Ga0501082_0018126 3300060353 Bacteria 6063
274 2510280888 2510065053 Bacteria 5005518
275 2510294982 2510065055 Bacteria 5037935
276 2510309035 2510065058 Bacteria 5005894
277 2554816919 2554235132 Bacteria 6772433
278 2599327004 2599185155 Bacteria 5827168
279 2599972835 2599185307 Bacteria 6194719
280 2600445422 2600254954 Bacteria 5100516
281 2601625475 2600255283 Bacteria 6061572
282 2602009821 2600255389 Bacteria 5275336
283 2608379792 2606217733 Bacteria 6360972
284 2738689124 2738541271 Bacteria 5657310
285 2738731273 2738541278 Bacteria 9755573
286 2739264511 2738543016 Bacteria 5657564
287 2739287500 2738543020 Bacteria 5718238
288 2739292813 2738543021 Bacteria 5718241
289 2774132176 2773857672 Bacteria 4993178
290 2808907459 2808606373 Bacteria 4423627
291 2808941483 2808606379 Bacteria 5022697
292 2812367138 2811994881 Bacteria 6298475
293 2823424327 2823421272 Bacteria 5372474
294 2826585937 2826581358 Bacteria 5963467
295 2842805981 2842805378 Bacteria 5385175
296 2842818970 2842815866 Bacteria 5947510
297 2842853873 2842849001 Bacteria 5924277
298 2912964572 2912963787 Bacteria 5646108
299 2917835122 2917832318 Bacteria 5346010
300 2919130018 2919125081 Bacteria 5385106
301 2919504056 2919501602 Bacteria 5286340
302 2923521179 2923519811 Bacteria 6298479
303 2926065371 2926063275 Bacteria 5285848
304 2939652080 2939651529 Bacteria 5895393
305 2974301208 2974298342 Bacteria 4840922
306 2984503686 2984499530 Bacteria 5020881
307 2984507741 2984504281 Bacteria 5262371
308 2990200566 2990196909 Bacteria 4054280
309 3007253218 3007252601 Bacteria 4559114
310 3007317988 3007315729 Bacteria 5076637
311 8011356689 8011350971 Bacteria 6158957
312 8016730111 8016728285 Bacteria 5263933
313 8034965646 8034962539 Bacteria 4884839
314 Ga0501037_0128937
315 MRS1b_contig_5348288
316 rootH1_10074903
317 rootH1_10105567
318 rootH1_10155350
319 rootH2_10056261
320 rootL2_10124107
321 rootL2_10364642
322 JGI25160J50197_1003406
323 Ga0058692_1023049
324 Ga0065714_10069641
325 Ga0070684_100012542
326 Ga0068853_100223921
327 Ga0068853_100241597
328 Ga0070665_100000018
329 Ga0068855_100009387
330 Ga0068855_100193447
331 Ga0068854_100387255
332 Ga0068852_100039840
333 Ga0068861_100630997
334 Ga0068862_100218085
335 Ga0105251_10053656
336 Ga0105244_10000962
337 Ga0105244_10035907
338 Ga0105240_10000452
339 Ga0105240_10011297
340 Ga0114129_10006355
341 Ga0105243_10222683
342 Ga0105241_10182338
343 Ga0105241_10491763
344 Ga0105237_10003067
345 Ga0105238_11180537
346 Ga0105239_10050406
347 Ga0105246_10323145
348 Ga0157373_10019646
349 Ga0157371_10026357
350 Ga0157371_10048992
351 Ga0157370_10010138
352 Ga0157369_10006552
353 Ga0157369_10153149
354 Ga0157374_10406615
355 Ga0157378_11343627
356 Ga0163162_10003073
357 Ga0157372_10000244
358 Ga0157372_10099703
359 Ga0163163_10340680
360 Ga0182008_10017082
361 Ga0182006_1035487
362 Ga0182006_1061751
363 Ga0207655_1001559
364 Ga0207655_1061052
365 Ga0207713_1000074
366 Ga0207695_10000060
367 Ga0207695_10130398
368 Ga0207671_10002891
369 Ga0207694_10121169
370 Ga0207667_10000084
371 Ga0207640_10403572
372 Ga0207639_10221020
373 Ga0209371_1001305
374 Ga0268266_10000026
375 Ga0268265_10430848
376 Ga0307517_10004138
377 Ga0307517_10108708
378 Ga0307517_10145961
379 Ga0307515_10000091
380 Ga0307515_10342696
381 Ga0268256_1001429
382 Ga0265327_10000122
383 Ga0307509_10077420
384 Ga0307408_100000027
385 Ga0265313_10094187
386 Ga0265313_10107086
387 Ga0307414_10302626
388 Ga0307510_10009263
389 Ga0307510_10058562
390 Ga0373936_0024324
391 Ga0400489_44762
392 Ga0439436_0012055
393 Ga0439438_004744
394 Ga0439447_000357
395 Ga0439461_0007283
396 Ga0439466_0002019
397 Ga0439466_0006283
398 Ga0439466_0121648
399 Ga0451807_1835704
400 Ga0439431_0003909
401 Ga0439431_0058106
402 Ga0439437_001647
403 Ga0439432_034260
404 Ga0439452_003974
405 Ga0439456_000081
406 Ga0439456_034895
407 Ga0439463_000167
408 Ga0450911_000007
409 Ga0450904_000067
410 Ga0439446_0000473
411 Ga0439446_0001075
412 Ga0439446_0019939
413 Ga0439434_0003701
414 Ga0439459_0000862
415 Ga0439464_0000444
416 Ga0439464_0011405
417 Ga0450918_033144
418 Ga0495617_035423
419 Ga0495627_000130
420 Ga0495627_010080
421 Ga0495627_019628
422 Ga0495591_000119
423 Ga0495591_000756
424 Ga0495591_004879
425 Ga0495591_006268
426 Ga0495591_067212
427 Ga0495638_0025285
428 Ga0495638_0187790
429 Ga0495650_0001858
430 Ga0495650_0001938
431 Ga0495605_0000149
432 Ga0495605_0000429
433 Ga0495605_0000859
434 Ga0495605_0016005
435 Ga0495605_0059488
436 Ga0495584_0005774
437 Ga0495585_0011248
438 Ga0495596_0046177
439 Ga0495607_0000312
440 Ga0495607_0000379
441 Ga0495607_0000455
442 Ga0495607_0000464
443 Ga0495607_0004448
444 Ga0495607_0076460
445 Ga0495607_0107853
446 Ga0495607_0142787
447 Ga0495607_0260686
448 Ga0495607_0264471
449 Ga0495607_0388958
450 Ga0495583_0000990
451 Ga0495583_0002285
452 Ga0495583_0003079
453 Ga0495583_0046068
454 Ga0495606_0000712
455 Ga0495606_0001261
456 Ga0495606_0055358
457 Ga0495610_0002975
458 Ga0495610_0020752
459 Ga0495620_0001154
460 Ga0495620_0009656
461 Ga0495620_0030095
462 Ga0495631_0007468
463 Ga0495631_0040970
464 Ga0495632_0002050
465 Ga0495632_0010457
466 Ga0495637_0000162
467 Ga0495637_0000231
468 Ga0495637_0011965
469 Ga0495637_0025137
470 Ga0495643_0000049
471 Ga0495643_0020632
472 Ga0495643_0122489
473 Ga0495644_0000341
474 Ga0495644_0071828
475 Ga0495648_0003503
476 Ga0495648_0029234
477 Ga0495648_0110612
478 Ga0495654_0013387
479 Ga0495654_0056820
480 Ga0495609_0000087
481 Ga0495609_0000213
482 Ga0495609_0087726
483 Ga0495597_0000097
484 Ga0495597_0029976
485 Ga0495597_0048217
486 Ga0495622_0029871
487 Ga0495668_0018140
488 Ga0495668_0027174
489 Ga0495668_0042157
490 Ga0495611_0000086
491 Ga0495625_0000145
492 Ga0495625_0050372
493 Ga0495625_0215901
494 Ga0495625_0254080
495 Ga0495625_0493107
496 Ga0495661_0000193
497 Ga0495661_0000608
498 Ga0495661_0019857
499 Ga0495661_0061736
500 Ga0495670_0039044
501 Ga0495670_0078165
502 Ga0495671_0002074
503 Ga0495671_0014694
504 Ga0495671_0101189
505 Ga0495649_0000462
506 Ga0495649_0379770
507 Ga0495660_0001305
508 Ga0495660_0003345
509 Ga0495660_0013003
510 Ga0495660_0106073
511 Ga0495660_0148156
512 Ga0495672_0014974
513 Ga0495672_0061544
514 Ga0495672_0063038
515 Ga0495676_0000119
516 Ga0495683_0040284
517 Ga0495687_000031
518 Ga0495679_000379
519 Ga0495673_0001123
520 Ga0495673_0001214
521 Ga0495673_0007109
522 Ga0495673_0008634
523 Ga0495673_0066350
524 Ga0495681_0020876
525 Ga0495686_0068935
526 Ga0495626_0000259
527 Ga0496102_0757251
528 Ga0496110_0124933
529 Ga0496111_0080552
530 Ga0496116_0039458
531 Ga0496117_0066975
532 Ga0496118_0071089
533 Ga0496118_0143156
534 Ga0496118_0223546
535 Ga0496121_0000858
536 Ga0496121_0003434
537 Ga0496122_0003009
538 Ga0496123_0000550
539 Ga0496123_0017814
540 Ga0496123_0224411
541 Ga0496124_0000355
542 Ga0496124_0007064
543 Ga0496124_0031263
544 Ga0496124_0040568
545 Ga0496124_0090632
546 Ga0495678_000338
547 Ga0495678_005524
548 Ga0495682_0000170
549 Ga0501295_043147
550 Ga0501032_0056305
551 Ga0501034_0079838
552 Ga0501034_0095957
553 Ga0501034_0200459
554 Ga0501034_0655095
555 Ga0501034_0986817
556 Ga0501037_0025390
557 Ga0501039_0116020
558 Ga0501043_0109466
559 Ga0501047_0546592
560 Ga0501070_0158376
561 Ga0501071_0143062
562 Ga0501073_0031899
563 Ga0501074_0510760
564 Ga0501080_0103062
565 Ga0501035_0496708
566 Ga0501035_0627676
567 Ga0501035_0836472
568 Ga0501044_0057972
569 Ga0501044_0243802
570 Ga0501226_000006
571 nmdc:mga05p37_7918_c1
572 nmdc:mga08x19_388400_c1
573 Ga0500578_0021565
574 Ga0500646_0038415
575 Ga0500646_0067578
576 Ga0500583_0399108
577 Ga0500650_0066372
578 Ga0500642_0053174
579 Ga0500568_0257906
580 Ga0500586_068351
581 Ga0500586_163495
582 Ga0500588_0000560
583 Ga0500588_0004990
584 Ga0500622_0004885
585 Ga0501084_0244829
586 Ga0501082_0018126
587 2510280888
588 2510294982
589 2510309035
590 2554816919
591 2599327004
592 2599972835
593 2600445422
594 2601625475
595 2602009821
596 2608379792
597 2738689124
598 2738731273
599 2739264511
600 2739287500
601 2739292813
602 2774132176
603 2808907459
604 2808941483
605 2812367138
606 2823424327
607 2826585937
608 2842805981
609 2842818970
610 2842853873
611 2912964572
612 2917835122
613 2919130018
614 2919504056
615 2923521179
616 2926065371
617 2939652080
618 2974301208
619 2984503686
620 2984507741
621 2990200566
622 3007253218
623 3007317988
624 8011356689
625 8016730111
626 8034965646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02525

Flavodoxin_2

Flavodoxin-like fold

18

214

0.87

PF03358

FMN_red

NADPH-dependent FMN reductase

18

143

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f8y-assembly2.cif.gz_D complex structure of nadph:quinone oxidoreductase with menadione in streptococcus mutans 0.8708 17 203
5ea2-assembly1.cif.gz_C crystal structure of holo nad(p)h dehydrogenase, quinone 1 0.8649 15 203
2pme-assembly1.cif.gz_A the apo crystal structure of the glycyl-trna synthetase 0.8614 16 52
4cet-assembly1.cif.gz_A-2 crystal structure of the complex of the p187s variant of human nad(p) h:quinone oxidoreductase with dicoumarol at 2.2 a resolution 0.8583 15 203
1h66-assembly2.cif.gz_D crystal structure of human nad[p]h-quinone oxidoreductase co with 2,5-diaziridinyl-3-hydroxyl-6-methyl-1,4-benzoquinone 0.8567 15 203
ID Description Score Start End Superfamily
4cetA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8583 15 203 3.40.50.360
1d4aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8491 15 203 3.40.50.360
af_Q54PF9_562_677_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.8449 16 56 3.40.50.800
5lbtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8437 15 203 3.40.50.360
3lcmC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8276 17 202 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A244ENZ4-F1-model_v4 NAD(P)H dehydrogenase 0.9697 1 204 GO:0003955
GO:0005829
AF-A0A6S5RTZ5-F1-model_v4 Flavodoxin-like fold domain-containing protein 0.9666 15 104 GO:0003955
GO:0005829
AF-J2JTQ2-F1-model_v4 Putative NADPH-quinone reductase (Modulator of drug activity B) 0.9637 16 116 GO:0003955
GO:0005829
AF-A0A3M5B0R7-F1-model_v4 Flavodoxin-like fold domain-containing protein 0.9624 101 204 GO:0003955
GO:0005829
AF-A0A3M6HXG5-F1-model_v4 Flavodoxin-like fold domain-containing protein 0.9614 1 158 GO:0003955
GO:0005829

Map