F402018

General Info

Members Datasets Scaffolds Average Seq Length
313 178 626 283

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10271125|Ga0070676_102711251
Length 269
Sequence MAISLVETIADLRVRVAARRSEGPLGLVPTMGALHEGHASLIRQARAECATVVVTIFVNPIQFDRPEDLERYPRSLDVDARLCESLGVDLVFAECKVEVGRLADHLCGRFRPGHFSGVATVVLKLFDIVQADRSYFGEKDAQQLAVIRRLVSDFNVPTTIVGVPTVREADGLALSSRNQRLDASERQLAPALYRALQEVRRAIESGTTSVSDLTRRASDQIPGDARLRLEYFEIVDPIDFQPVEHVSGPVVAAGALWVGTTRLIDNIRI

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
168 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 1.28
Rhizosphere 98.4
Stem 0
Stem Tuber 0
Unclassified 3.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10271125 3300005328 Bacteria 1140
2 JGI24751J29686_10029506 3300002459 Bacteria 1139
3 Ga0065714_10084618 3300005288 Bacteria 2189
4 Ga0065712_10068386 3300005290 Bacteria 11051
5 Ga0065715_10010124 3300005293 Bacteria 2900
6 Ga0065715_10092008 3300005293 Bacteria 5394
7 Ga0070658_10096567 3300005327 Bacteria 2440
8 Ga0070683_100006352 3300005329 Bacteria 9912
9 Ga0070683_100040474 3300005329 Bacteria 4285
10 Ga0070690_100013406 3300005330 Bacteria 4842
11 Ga0070670_100037240 3300005331 Bacteria 4185
12 Ga0070677_10000496 3300005333 Bacteria 13547
13 Ga0068869_100027596 3300005334 Bacteria 3960
14 Ga0068869_100048678 3300005334 Bacteria 3066
15 Ga0070666_10014675 3300005335 Bacteria 4989
16 Ga0070666_10098663 3300005335 Unclassified 2012
17 Ga0070680_100021987 3300005336 Bacteria 5073
18 Ga0068868_100023620 3300005338 Bacteria 4655
19 Ga0070660_100110976 3300005339 Bacteria 2181
20 Ga0070689_100048634 3300005340 Bacteria 3271
21 Ga0070691_10000971 3300005341 Bacteria 11706
22 Ga0070661_100023881 3300005344 Bacteria 4386
23 Ga0070661_100046600 3300005344 Bacteria 3171
24 Ga0070661_100169990 3300005344 Bacteria 1655
25 Ga0070668_100060167 3300005347 Bacteria 2941
26 Ga0070675_100012320 3300005354 Bacteria 6702
27 Ga0070675_100153594 3300005354 Bacteria 1975
28 Ga0070671_100029958 3300005355 Bacteria 4490
29 Ga0070671_100044624 3300005355 Bacteria 3684
30 Ga0070674_100001307 3300005356 Bacteria 13100
31 Ga0070674_100028541 3300005356 Bacteria 3666
32 Ga0070673_100012223 3300005364 Bacteria 5887
33 Ga0070673_100057442 3300005364 Bacteria 3074
34 Ga0070673_100194461 3300005364 Bacteria 1744
35 Ga0070667_100010221 3300005367 Bacteria 7753
36 Ga0070711_100120473 3300005439 Unclassified 1940
37 Ga0070700_100046940 3300005441 Bacteria 2671
38 Ga0070663_100149249 3300005455 Bacteria 1791
39 Ga0070678_100039522 3300005456 Bacteria 3329
40 Ga0070678_100437850 3300005456 Bacteria 1142
41 Ga0070662_100053139 3300005457 Bacteria 2931
42 Ga0070662_100196116 3300005457 Bacteria 1599
43 Ga0070662_100221121 3300005457 Bacteria 1511
44 Ga0070681_10012206 3300005458 Bacteria 8519
45 Ga0068867_100023579 3300005459 Bacteria 4405
46 Ga0070685_10189062 3300005466 Bacteria 1331
47 Ga0070679_100007679 3300005530 Bacteria 10096
48 Ga0070684_100007521 3300005535 Bacteria 8478
49 Ga0070697_100315630 3300005536 Bacteria 1345
50 Ga0068853_100053631 3300005539 Bacteria 3472
51 Ga0070672_100074118 3300005543 Bacteria 2715
52 Ga0070672_100110282 3300005543 Bacteria 2242
53 Ga0070672_100451639 3300005543 Bacteria 1107
54 Ga0070686_100038123 3300005544 Bacteria 2985
55 Ga0070686_100159181 3300005544 Bacteria 1589
56 Ga0070686_100375270 3300005544 Bacteria 1075
57 Ga0070696_100047646 3300005546 Bacteria 2974
58 Ga0070704_100264109 3300005549 Bacteria 1419
59 Ga0070664_100105408 3300005564 Bacteria 2455
60 Ga0070664_100141467 3300005564 Bacteria 2119
61 Ga0070664_100570177 3300005564 Bacteria 1048
62 Ga0068857_100017792 3300005577 Bacteria 6231
63 Ga0068857_100056533 3300005577 Bacteria 3482
64 Ga0068857_100064000 3300005577 Bacteria 3269
65 Ga0068857_100116408 3300005577 Bacteria 2405
66 Ga0068854_100189873 3300005578 Bacteria 1609
67 Ga0068856_100005958 3300005614 Bacteria 11998
68 Ga0068852_100254090 3300005616 Bacteria 1685
69 Ga0068859_100024131 3300005617 Bacteria 6102
70 Ga0068859_100143377 3300005617 Bacteria 2462
71 Ga0068859_100288534 3300005617 Bacteria 1734
72 Ga0068859_100375021 3300005617 Bacteria 1518
73 Ga0068859_100559386 3300005617 Bacteria 1238
74 Ga0068864_100043788 3300005618 Bacteria 3834
75 Ga0068864_100072993 3300005618 Bacteria 2992
76 Ga0068861_100101018 3300005719 Bacteria 2294
77 Ga0068870_10001387 3300005840 Bacteria 9797
78 Ga0068870_10008581 3300005840 Bacteria 4602
79 Ga0068870_10018910 3300005840 Bacteria 3335
80 Ga0068870_10062247 3300005840 Bacteria 2009
81 Ga0068863_100012661 3300005841 Bacteria 8135
82 Ga0068858_100017000 3300005842 Bacteria 6830
83 Ga0068858_100227608 3300005842 Bacteria 1767
84 Ga0068860_100041624 3300005843 Bacteria 4388
85 Ga0068860_100260511 3300005843 Bacteria 1690
86 Ga0068860_100603858 3300005843 Bacteria 1103
87 Ga0068862_100262592 3300005844 Bacteria 1577
88 Ga0068862_100679671 3300005844 Unclassified 995
89 Ga0075432_10041019 3300006058 Bacteria 1616
90 Ga0068871_100034508 3300006358 Bacteria 4014
91 Ga0075428_100000786 3300006844 Bacteria 33072
92 Ga0075428_100022011 3300006844 Bacteria 7056
93 Ga0075428_100068878 3300006844 Bacteria 3870
94 Ga0075428_100167812 3300006844 Bacteria 2381
95 Ga0075428_100177567 3300006844 Bacteria 2306
96 Ga0075430_100001331 3300006846 Bacteria 19957
97 Ga0075430_100065740 3300006846 Bacteria 3046
98 Ga0075430_100088848 3300006846 Bacteria 2585
99 Ga0075430_100191866 3300006846 Bacteria 1698
100 Ga0075431_100001181 3300006847 Bacteria 23559
101 Ga0075431_100007844 3300006847 Bacteria 10640
102 Ga0075431_100146433 3300006847 Bacteria 2434
103 Ga0075433_10009974 3300006852 Bacteria 7611
104 Ga0075434_100019701 3300006871 Bacteria 6530
105 Ga0075434_100034089 3300006871 Bacteria 5026
106 Ga0075434_100053004 3300006871 Bacteria 4031
107 Ga0075429_100005213 3300006880 Bacteria 11180
108 Ga0075429_100014552 3300006880 Bacteria 6818
109 Ga0075429_100025940 3300006880 Bacteria 5087
110 Ga0075429_100351608 3300006880 Bacteria 1290
111 Ga0075436_100002834 3300006914 Bacteria 11873
112 Ga0097620_100024131 3300006931 Bacteria 6102
113 Ga0097620_100143383 3300006931 Bacteria 2462
114 Ga0097620_100288548 3300006931 Bacteria 1734
115 Ga0097620_100375038 3300006931 Bacteria 1518
116 Ga0097620_100559262 3300006931 Bacteria 1238
117 Ga0075435_100377438 3300007076 Bacteria 1218
118 Ga0105240_10000519 3300009093 Bacteria 70908
119 Ga0105240_10139665 3300009093 Bacteria 2898
120 Ga0111539_10004949 3300009094 Bacteria 17332
121 Ga0111539_10008729 3300009094 Bacteria 12857
122 Ga0111539_10049693 3300009094 Bacteria 5000
123 Ga0111539_10536728 3300009094 Bacteria 1363
124 Ga0105245_10017657 3300009098 Bacteria 6228
125 Ga0105245_10165706 3300009098 Bacteria 2101
126 Ga0105245_10699073 3300009098 Bacteria 1047
127 Ga0105247_10179869 3300009101 Bacteria 1411
128 Ga0114129_10007194 3300009147 Bacteria 15838
129 Ga0114129_10036864 3300009147 Bacteria 6905
130 Ga0114129_10100757 3300009147 Bacteria 3996
131 Ga0114129_10331033 3300009147 Bacteria 2022
132 Ga0114129_10867227 3300009147 Bacteria 1146
133 Ga0105241_10009414 3300009174 Bacteria 7174
134 Ga0105242_10471312 3300009176 Unclassified 1188
135 Ga0105248_10210940 3300009177 Bacteria 2188
136 Ga0105248_10325155 3300009177 Bacteria 1732
137 Ga0105237_10024200 3300009545 Bacteria 6213
138 Ga0105238_10023408 3300009551 Bacteria 6295
139 Ga0105249_10004857 3300009553 Bacteria 11597
140 Ga0105249_10774503 3300009553 Unclassified 1022
141 Ga0105239_10012504 3300010375 Bacteria 9455
142 Ga0105239_10026797 3300010375 Bacteria 6343
143 Ga0105239_10541355 3300010375 Bacteria 1326
144 Ga0105246_10012907 3300011119 Bacteria 5227
145 Ga0157370_10035916 3300013104 Bacteria 4812
146 Ga0157369_10012234 3300013105 Bacteria 9744
147 Ga0157374_10166172 3300013296 Bacteria 2150
148 Ga0157374_10480051 3300013296 Bacteria 1246
149 Ga0157378_10015855 3300013297 Bacteria 6599
150 Ga0163162_10006226 3300013306 Bacteria 11566
151 Ga0163162_10051704 3300013306 Bacteria 4123
152 Ga0157372_10014421 3300013307 Bacteria 8454
153 Ga0157372_10027373 3300013307 Bacteria 6207
154 Ga0157372_10130109 3300013307 Bacteria 2895
155 Ga0157375_10063475 3300013308 Bacteria 3675
156 Ga0157375_10193611 3300013308 Bacteria 2188
157 Ga0163163_10002201 3300014325 Bacteria 16409
158 Ga0163163_10321241 3300014325 Bacteria 1602
159 Ga0157380_10000640 3300014326 Bacteria 21595
160 Ga0157380_10069422 3300014326 Bacteria 2843
161 Ga0157380_10232707 3300014326 Bacteria 1656
162 Ga0157380_10786091 3300014326 Unclassified 967
163 Ga0157377_10004677 3300014745 Bacteria 6335
164 Ga0157377_10029120 3300014745 Bacteria 2978
165 Ga0157379_10050880 3300014968 Bacteria 3699
166 Ga0157376_10073812 3300014969 Bacteria 2906
167 Ga0207697_10001265 3300025315 Bacteria 13892
168 Ga0207682_10004962 3300025893 Bacteria 5464
169 Ga0207682_10007252 3300025893 Bacteria 4427
170 Ga0207688_10075139 3300025901 Bacteria 1923
171 Ga0207680_10026007 3300025903 Bacteria 3237
172 Ga0207645_10003058 3300025907 Bacteria 12851
173 Ga0207645_10032326 3300025907 Bacteria 3363
174 Ga0207643_10001525 3300025908 Bacteria 13223
175 Ga0207643_10038787 3300025908 Bacteria 2677
176 Ga0207643_10097949 3300025908 Bacteria 1717
177 Ga0207684_10166164 3300025910 Bacteria 1901
178 Ga0207654_10037639 3300025911 Bacteria 2709
179 Ga0207707_10000793 3300025912 Bacteria 30969
180 Ga0207695_10000964 3300025913 Bacteria 51291
181 Ga0207695_10005742 3300025913 Bacteria 16341
182 Ga0207695_10291581 3300025913 Bacteria 1524
183 Ga0207695_10341353 3300025913 Bacteria 1385
184 Ga0207671_10025191 3300025914 Bacteria 4469
185 Ga0207663_10192285 3300025916 Bacteria 1466
186 Ga0207660_10008265 3300025917 Bacteria 6727
187 Ga0207662_10001040 3300025918 Bacteria 12994
188 Ga0207662_10011592 3300025918 Bacteria 4896
189 Ga0207657_10097575 3300025919 Bacteria 2443
190 Ga0207657_10164468 3300025919 Unclassified 1801
191 Ga0207649_10121576 3300025920 Unclassified 1761
192 Ga0207652_10009744 3300025921 Bacteria 7729
193 Ga0207681_10077155 3300025923 Bacteria 2341
194 Ga0207694_10005266 3300025924 Bacteria 9962
195 Ga0207659_10012611 3300025926 Bacteria 5385
196 Ga0207659_10035749 3300025926 Bacteria 3436
197 Ga0207659_10084008 3300025926 Bacteria 2362
198 Ga0207659_10084432 3300025926 Bacteria 2356
199 Ga0207659_10141309 3300025926 Bacteria 1869
200 Ga0207687_10010769 3300025927 Bacteria 5976
201 Ga0207687_10105450 3300025927 Bacteria 2082
202 Ga0207687_10560382 3300025927 Bacteria 959
203 Ga0207644_10029556 3300025931 Bacteria 3803
204 Ga0207690_10117303 3300025932 Unclassified 1927
205 Ga0207706_10010919 3300025933 Bacteria 8283
206 Ga0207706_10192619 3300025933 Bacteria 1789
207 Ga0207686_10017621 3300025934 Bacteria 4028
208 Ga0207709_10103501 3300025935 Bacteria 1887
209 Ga0207670_10034311 3300025936 Bacteria 3278
210 Ga0207670_10174390 3300025936 Bacteria 1615
211 Ga0207669_10000672 3300025937 Bacteria 14741
212 Ga0207669_10223554 3300025937 Bacteria 1383
213 Ga0207704_10151064 3300025938 Bacteria 1639
214 Ga0207691_10004019 3300025940 Bacteria 14255
215 Ga0207691_10014137 3300025940 Bacteria 7615
216 Ga0207691_10122766 3300025940 Bacteria 2300
217 Ga0207711_10235022 3300025941 Bacteria 1679
218 Ga0207689_10009117 3300025942 Bacteria 8588
219 Ga0207689_10011380 3300025942 Bacteria 7624
220 Ga0207661_10010741 3300025944 Bacteria 6600
221 Ga0207661_10014810 3300025944 Bacteria 5721
222 Ga0207661_10015364 3300025944 Bacteria 5632
223 Ga0207679_10014360 3300025945 Bacteria 5206
224 Ga0207667_10007231 3300025949 Bacteria 13398
225 Ga0207667_10025979 3300025949 Bacteria 6405
226 Ga0207712_10019812 3300025961 Bacteria 4397
227 Ga0207712_10225262 3300025961 Bacteria 1501
228 Ga0207658_10327452 3300025986 Bacteria 1328
229 Ga0207703_10334412 3300026035 Bacteria 1390
230 Ga0207708_10008617 3300026075 Bacteria 7545
231 Ga0207641_10379922 3300026088 Bacteria 1353
232 Ga0207648_10016008 3300026089 Bacteria 6872
233 Ga0207648_10315293 3300026089 Bacteria 1404
234 Ga0207676_10017720 3300026095 Bacteria 5167
235 Ga0207676_10152278 3300026095 Bacteria 1993
236 Ga0207674_10000320 3300026116 Bacteria 61127
237 Ga0207674_10018287 3300026116 Bacteria 7620
238 Ga0207674_10092623 3300026116 Bacteria 3011
239 Ga0207674_10163839 3300026116 Bacteria 2178
240 Ga0207674_10276451 3300026116 Bacteria 1627
241 Ga0207675_100007903 3300026118 Bacteria 10027
242 Ga0207675_100298845 3300026118 Bacteria 1568
243 Ga0207683_10026394 3300026121 Bacteria 5013
244 Ga0207683_10031763 3300026121 Bacteria 4584
245 Ga0207683_10225059 3300026121 Bacteria 1710
246 Ga0209971_1020725 3300027682 Bacteria 1564
247 Ga0207428_10009716 3300027907 Bacteria 8620
248 Ga0207428_10090034 3300027907 Bacteria 2384
249 Ga0207428_10170656 3300027907 Bacteria 1648
250 Ga0268265_10002584 3300028380 Bacteria 13512
251 Ga0268264_10137629 3300028381 Bacteria 2173
252 Ga0268264_10317304 3300028381 Bacteria 1472
253 Ga0265330_10064779 3300031235 Bacteria 1587
254 Ga0265340_10029510 3300031247 Bacteria 2754
255 Ga0265331_10036632 3300031250 Unclassified 2407
256 Ga0265316_10006992 3300031344 Bacteria 10692
257 Ga0265316_10040312 3300031344 Bacteria 3744
258 Ga0265313_10011578 3300031595 Bacteria 5470
259 Ga0265314_10003569 3300031711 Bacteria 14986
260 Ga0307416_100503671 3300032002 Bacteria 1276
261 Ga0373932_0002999 3300035112 Bacteria 4141
262 Ga0373953_0033874 3300035117 Bacteria 2000
263 Ga0373954_0006606 3300035118 Bacteria 5062
264 Ga0373954_0014664 3300035118 Bacteria 3496
265 Ga0373957_0091083 3300035120 Bacteria 1212
266 Ga0373955_0038866 3300035172 Bacteria 2537
267 Ga0373927_0003188 3300035695 Bacteria 11821
268 Ga0373933_0191645 3300035724 Bacteria 1306
269 Ga0373937_0004792 3300036401 Bacteria 11490
270 Ga0373937_0566230 3300036401 Bacteria 1079
271 Ga0495639_0121658 3300046475 Bacteria 1245
272 Ga0495594_0106577 3300046499 Bacteria 1578
273 Ga0495665_0019045 3300046531 Bacteria 3690
274 Ga0495586_0041978 3300046535 Bacteria 2464
275 Ga0495658_0079146 3300046683 Bacteria 1925
276 Ga0495674_0302662 3300047319 Bacteria 1306
277 Ga0495675_0078791 3300047444 Bacteria 2075
278 Ga0495684_0080082 3300047471 Bacteria 2480
279 Ga0496102_0344726 3300048905 Bacteria 1403
280 Ga0496104_0426138 3300048907 Bacteria 1239
281 Ga0496108_0165353 3300048911 Bacteria 1913
282 Ga0496113_0047209 3300048916 Bacteria 3200
283 Ga0501041_0177673 3300049577 Bacteria 1333
284 Ga0501249_024815 3300049679 Bacteria 1322
285 Ga0501249_048247 3300049679 Unclassified 975
286 Ga0501283_016390 3300049779 Bacteria 1149
287 Ga0501044_0001575 3300049823 Bacteria 26679
288 nmdc:mga05p37_14944_c1 3300050507 Bacteria 9319
289 nmdc:mga05p37_198849_c1 3300050507 Bacteria 2429
290 nmdc:mga05p37_314848_c1 3300050507 Bacteria 1854
291 nmdc:mga09592_15261_c1 3300050508 Bacteria 6276
292 nmdc:mga09592_16629_c1 3300050508 Bacteria 6020
293 nmdc:mga09592_4540_c1 3300050508 Bacteria 11227
294 nmdc:mga09592_6049_c1 3300050508 Bacteria 9871
295 nmdc:mga0qj67_2456_c1 3300050509 Bacteria 13199
296 nmdc:mga0qj67_3237_c1 3300050509 Bacteria 11722
297 nmdc:mga0qj67_359635_c1 3300050509 Bacteria 1176
298 nmdc:mga06r32_125051_c1 3300050510 Bacteria 2539
299 nmdc:mga06r32_27711_c1 3300050510 Bacteria 5296
300 nmdc:mga06r32_316409_c1 3300050510 Bacteria 1546
301 nmdc:mga06r32_404687_c1 3300050510 Bacteria 1347
302 nmdc:mga06r32_6086_c1 3300050510 Bacteria 10838
303 nmdc:mga08y16_50153_c1 3300050511 Bacteria 4368
304 nmdc:mga08y16_57893_c1 3300050511 Bacteria 4049
305 nmdc:mga08y16_597385_c1 3300050511 Bacteria 1113
306 nmdc:mga0n895_239759_c1 3300050512 Bacteria 1840
307 nmdc:mga0n895_24503_c1 3300050512 Bacteria 5687
308 nmdc:mga0n895_403_c1 3300050512 Bacteria 29107
309 nmdc:mga0rr50_6397_c1 3300050513 Bacteria 7165
310 nmdc:mga0a205_11163_c1 3300050515 Bacteria 8268
311 nmdc:mga0a205_28378_c1 3300050515 Bacteria 5351
312 nmdc:mga0a205_5280_c1 3300050515 Bacteria 11633
313 Ga0500568_0001879 3300053139 Bacteria 12933
314 Ga0070676_10271125
315 JGI24751J29686_10029506
316 Ga0065714_10084618
317 Ga0065712_10068386
318 Ga0065715_10010124
319 Ga0065715_10092008
320 Ga0070658_10096567
321 Ga0070683_100006352
322 Ga0070683_100040474
323 Ga0070690_100013406
324 Ga0070670_100037240
325 Ga0070677_10000496
326 Ga0068869_100027596
327 Ga0068869_100048678
328 Ga0070666_10014675
329 Ga0070666_10098663
330 Ga0070680_100021987
331 Ga0068868_100023620
332 Ga0070660_100110976
333 Ga0070689_100048634
334 Ga0070691_10000971
335 Ga0070661_100023881
336 Ga0070661_100046600
337 Ga0070661_100169990
338 Ga0070668_100060167
339 Ga0070675_100012320
340 Ga0070675_100153594
341 Ga0070671_100029958
342 Ga0070671_100044624
343 Ga0070674_100001307
344 Ga0070674_100028541
345 Ga0070673_100012223
346 Ga0070673_100057442
347 Ga0070673_100194461
348 Ga0070667_100010221
349 Ga0070711_100120473
350 Ga0070700_100046940
351 Ga0070663_100149249
352 Ga0070678_100039522
353 Ga0070678_100437850
354 Ga0070662_100053139
355 Ga0070662_100196116
356 Ga0070662_100221121
357 Ga0070681_10012206
358 Ga0068867_100023579
359 Ga0070685_10189062
360 Ga0070679_100007679
361 Ga0070684_100007521
362 Ga0070697_100315630
363 Ga0068853_100053631
364 Ga0070672_100074118
365 Ga0070672_100110282
366 Ga0070672_100451639
367 Ga0070686_100038123
368 Ga0070686_100159181
369 Ga0070686_100375270
370 Ga0070696_100047646
371 Ga0070704_100264109
372 Ga0070664_100105408
373 Ga0070664_100141467
374 Ga0070664_100570177
375 Ga0068857_100017792
376 Ga0068857_100056533
377 Ga0068857_100064000
378 Ga0068857_100116408
379 Ga0068854_100189873
380 Ga0068856_100005958
381 Ga0068852_100254090
382 Ga0068859_100024131
383 Ga0068859_100143377
384 Ga0068859_100288534
385 Ga0068859_100375021
386 Ga0068859_100559386
387 Ga0068864_100043788
388 Ga0068864_100072993
389 Ga0068861_100101018
390 Ga0068870_10001387
391 Ga0068870_10008581
392 Ga0068870_10018910
393 Ga0068870_10062247
394 Ga0068863_100012661
395 Ga0068858_100017000
396 Ga0068858_100227608
397 Ga0068860_100041624
398 Ga0068860_100260511
399 Ga0068860_100603858
400 Ga0068862_100262592
401 Ga0068862_100679671
402 Ga0075432_10041019
403 Ga0068871_100034508
404 Ga0075428_100000786
405 Ga0075428_100022011
406 Ga0075428_100068878
407 Ga0075428_100167812
408 Ga0075428_100177567
409 Ga0075430_100001331
410 Ga0075430_100065740
411 Ga0075430_100088848
412 Ga0075430_100191866
413 Ga0075431_100001181
414 Ga0075431_100007844
415 Ga0075431_100146433
416 Ga0075433_10009974
417 Ga0075434_100019701
418 Ga0075434_100034089
419 Ga0075434_100053004
420 Ga0075429_100005213
421 Ga0075429_100014552
422 Ga0075429_100025940
423 Ga0075429_100351608
424 Ga0075436_100002834
425 Ga0097620_100024131
426 Ga0097620_100143383
427 Ga0097620_100288548
428 Ga0097620_100375038
429 Ga0097620_100559262
430 Ga0075435_100377438
431 Ga0105240_10000519
432 Ga0105240_10139665
433 Ga0111539_10004949
434 Ga0111539_10008729
435 Ga0111539_10049693
436 Ga0111539_10536728
437 Ga0105245_10017657
438 Ga0105245_10165706
439 Ga0105245_10699073
440 Ga0105247_10179869
441 Ga0114129_10007194
442 Ga0114129_10036864
443 Ga0114129_10100757
444 Ga0114129_10331033
445 Ga0114129_10867227
446 Ga0105241_10009414
447 Ga0105242_10471312
448 Ga0105248_10210940
449 Ga0105248_10325155
450 Ga0105237_10024200
451 Ga0105238_10023408
452 Ga0105249_10004857
453 Ga0105249_10774503
454 Ga0105239_10012504
455 Ga0105239_10026797
456 Ga0105239_10541355
457 Ga0105246_10012907
458 Ga0157370_10035916
459 Ga0157369_10012234
460 Ga0157374_10166172
461 Ga0157374_10480051
462 Ga0157378_10015855
463 Ga0163162_10006226
464 Ga0163162_10051704
465 Ga0157372_10014421
466 Ga0157372_10027373
467 Ga0157372_10130109
468 Ga0157375_10063475
469 Ga0157375_10193611
470 Ga0163163_10002201
471 Ga0163163_10321241
472 Ga0157380_10000640
473 Ga0157380_10069422
474 Ga0157380_10232707
475 Ga0157380_10786091
476 Ga0157377_10004677
477 Ga0157377_10029120
478 Ga0157379_10050880
479 Ga0157376_10073812
480 Ga0207697_10001265
481 Ga0207682_10004962
482 Ga0207682_10007252
483 Ga0207688_10075139
484 Ga0207680_10026007
485 Ga0207645_10003058
486 Ga0207645_10032326
487 Ga0207643_10001525
488 Ga0207643_10038787
489 Ga0207643_10097949
490 Ga0207684_10166164
491 Ga0207654_10037639
492 Ga0207707_10000793
493 Ga0207695_10000964
494 Ga0207695_10005742
495 Ga0207695_10291581
496 Ga0207695_10341353
497 Ga0207671_10025191
498 Ga0207663_10192285
499 Ga0207660_10008265
500 Ga0207662_10001040
501 Ga0207662_10011592
502 Ga0207657_10097575
503 Ga0207657_10164468
504 Ga0207649_10121576
505 Ga0207652_10009744
506 Ga0207681_10077155
507 Ga0207694_10005266
508 Ga0207659_10012611
509 Ga0207659_10035749
510 Ga0207659_10084008
511 Ga0207659_10084432
512 Ga0207659_10141309
513 Ga0207687_10010769
514 Ga0207687_10105450
515 Ga0207687_10560382
516 Ga0207644_10029556
517 Ga0207690_10117303
518 Ga0207706_10010919
519 Ga0207706_10192619
520 Ga0207686_10017621
521 Ga0207709_10103501
522 Ga0207670_10034311
523 Ga0207670_10174390
524 Ga0207669_10000672
525 Ga0207669_10223554
526 Ga0207704_10151064
527 Ga0207691_10004019
528 Ga0207691_10014137
529 Ga0207691_10122766
530 Ga0207711_10235022
531 Ga0207689_10009117
532 Ga0207689_10011380
533 Ga0207661_10010741
534 Ga0207661_10014810
535 Ga0207661_10015364
536 Ga0207679_10014360
537 Ga0207667_10007231
538 Ga0207667_10025979
539 Ga0207712_10019812
540 Ga0207712_10225262
541 Ga0207658_10327452
542 Ga0207703_10334412
543 Ga0207708_10008617
544 Ga0207641_10379922
545 Ga0207648_10016008
546 Ga0207648_10315293
547 Ga0207676_10017720
548 Ga0207676_10152278
549 Ga0207674_10000320
550 Ga0207674_10018287
551 Ga0207674_10092623
552 Ga0207674_10163839
553 Ga0207674_10276451
554 Ga0207675_100007903
555 Ga0207675_100298845
556 Ga0207683_10026394
557 Ga0207683_10031763
558 Ga0207683_10225059
559 Ga0209971_1020725
560 Ga0207428_10009716
561 Ga0207428_10090034
562 Ga0207428_10170656
563 Ga0268265_10002584
564 Ga0268264_10137629
565 Ga0268264_10317304
566 Ga0265330_10064779
567 Ga0265340_10029510
568 Ga0265331_10036632
569 Ga0265316_10006992
570 Ga0265316_10040312
571 Ga0265313_10011578
572 Ga0265314_10003569
573 Ga0307416_100503671
574 Ga0373932_0002999
575 Ga0373953_0033874
576 Ga0373954_0006606
577 Ga0373954_0014664
578 Ga0373957_0091083
579 Ga0373955_0038866
580 Ga0373927_0003188
581 Ga0373933_0191645
582 Ga0373937_0004792
583 Ga0373937_0566230
584 Ga0495639_0121658
585 Ga0495594_0106577
586 Ga0495665_0019045
587 Ga0495586_0041978
588 Ga0495658_0079146
589 Ga0495674_0302662
590 Ga0495675_0078791
591 Ga0495684_0080082
592 Ga0496102_0344726
593 Ga0496104_0426138
594 Ga0496108_0165353
595 Ga0496113_0047209
596 Ga0501041_0177673
597 Ga0501249_024815
598 Ga0501249_048247
599 Ga0501283_016390
600 Ga0501044_0001575
601 nmdc:mga05p37_14944_c1
602 nmdc:mga05p37_198849_c1
603 nmdc:mga05p37_314848_c1
604 nmdc:mga09592_15261_c1
605 nmdc:mga09592_16629_c1
606 nmdc:mga09592_4540_c1
607 nmdc:mga09592_6049_c1
608 nmdc:mga0qj67_2456_c1
609 nmdc:mga0qj67_3237_c1
610 nmdc:mga0qj67_359635_c1
611 nmdc:mga06r32_125051_c1
612 nmdc:mga06r32_27711_c1
613 nmdc:mga06r32_316409_c1
614 nmdc:mga06r32_404687_c1
615 nmdc:mga06r32_6086_c1
616 nmdc:mga08y16_50153_c1
617 nmdc:mga08y16_57893_c1
618 nmdc:mga08y16_597385_c1
619 nmdc:mga0n895_239759_c1
620 nmdc:mga0n895_24503_c1
621 nmdc:mga0n895_403_c1
622 nmdc:mga0rr50_6397_c1
623 nmdc:mga0a205_11163_c1
624 nmdc:mga0a205_28378_c1
625 nmdc:mga0a205_5280_c1
626 Ga0500568_0001879

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02569

Pantoate_ligase

Pantoate-beta-alanine ligase

4

268

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ejc-assembly1.cif.gz_A-2 crystal structure of pantoate--beta-alanine ligase (panc) from thermotoga maritima 0.9751 3 278
3inn-assembly1.cif.gz_A crystal structure of pantoate-beta-alanine-ligase in complex with atp at low occupancy at 2.1 a resolution 0.9669 1 280
2x3f-assembly1.cif.gz_B crystal structure of the methicillin-resistant staphylococcus aureus sar2676, a pantothenate synthetase. 0.9644 1 280
5ucr-assembly1.cif.gz_B crystal structure of a pantoate-beta-alanine ligase from neisseria gonorrhoeae with bound amppnp and alanine 0.9616 1 278
5kwv-assembly1.cif.gz_B crystal structure of a pantoate-beta-alanine ligase from neisseria gonorrhoeae with bound amppnp 0.9611 1 279
ID Description Score Start End Superfamily
3innA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.98 3 177 3.40.50.620
3innA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9691 3 177 3.40.50.620
5hg0A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9688 3 177 3.40.50.620
5hg0A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9633 3 177 3.40.50.620
af_Q9FKB3_2_205_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9479 1 177 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7S2CTR7-F1-model_v4 Pantoate--beta-alanine ligase (EC 6.3.2.1) (Pantoate-activating enzyme) (Pantothenate synthetase) 0.9947 118 212 GO:0004592
GO:0005524
GO:0015940
AF-A0A2J0QPU4-F1-model_v4 deleted 0.985 86 197
AF-A0A658NLZ5-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.9846 128 211 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A3A0HP66-F1-model_v4 deleted 0.9834 27 154
AF-A0A3D1AU54-F1-model_v4 Pantoate--beta-alanine ligase (EC 6.3.2.1) 0.983 82 280 GO:0004592
GO:0005524
GO:0005829
GO:0015940

Map