F401676

General Info

Members Datasets Scaffolds Average Seq Length
312 166 624 220

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10455581|Ga0105240_104555811
Length 240
Sequence LNIAYLSCPNNSLNWINQIAMEYKFRNPIHGSIATTKYQCTIEWRNGKFVADEPEKTGGQDTGPDPYTLLLSSVASCTLITLRMYIDRKGWDIQNIVVNANLFQTRLRDRLNTFIDRDITFPGAQIAPDQKSRLAEIAGHCPISKIIEGNATVRTFVYHEEDADKQLKYRSDEITVVWKPEFCKHSGRCVTQLPKVFDLKTKPWVTMTGADTQIIIDQVNKCPTGALSFLYNDANKPDTD

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
126 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
129 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
158 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
159 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
160 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
161 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
162 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
163 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
166 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.49
Nodule 0
Rhizoplane 0.64
Rhizosphere 91.03
Stem 0
Stem Tuber 0
Unclassified 12.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10455581 3300009093 Unclassified 1430
2 JGI25406J46586_10048495 3300003203 Bacteria 1439
3 rootH2_10096732 3300003320 Bacteria 1738
4 rootH2_10334251 3300003320 Eukaryota 1190
5 rootL2_10035506 3300003322 Bacteria 8346
6 rootL2_10082011 3300003322 Bacteria 1322
7 rootH1_10016419 3300003323 Bacteria 15747
8 Ga0070658_10059847 3300005327 Bacteria 3101
9 Ga0070658_10948651 3300005327 Unclassified 748
10 Ga0070676_10030000 3300005328 Bacteria 3097
11 Ga0070683_100008006 3300005329 Bacteria 8968
12 Ga0070683_100091450 3300005329 Bacteria 2857
13 Ga0070690_100068293 3300005330 Bacteria 2305
14 Ga0070690_100319558 3300005330 Unclassified 1118
15 Ga0068869_100084728 3300005334 Bacteria 2373
16 Ga0070666_10051848 3300005335 Bacteria 2764
17 Ga0070666_10057147 3300005335 Unclassified 2636
18 Ga0070666_10259454 3300005335 Bacteria 1232
19 Ga0070666_10326855 3300005335 Bacteria 1094
20 Ga0070680_100046827 3300005336 Bacteria 3519
21 Ga0070682_100344913 3300005337 Bacteria 1108
22 Ga0068868_100011227 3300005338 Bacteria 6522
23 Ga0068868_100040877 3300005338 Bacteria 3611
24 Ga0068868_100097694 3300005338 Bacteria 2374
25 Ga0068868_100317887 3300005338 Unclassified 1326
26 Ga0068868_100505317 3300005338 Bacteria 1059
27 Ga0070660_100044195 3300005339 Bacteria 3406
28 Ga0070660_100135853 3300005339 Bacteria 1970
29 Ga0070689_100044642 3300005340 Bacteria 3410
30 Ga0070687_100051649 3300005343 Bacteria 2130
31 Ga0070661_100005701 3300005344 Bacteria 8582
32 Ga0070661_100213684 3300005344 Bacteria 1477
33 Ga0070668_100147265 3300005347 Bacteria 1901
34 Ga0070675_100077486 3300005354 Bacteria 2767
35 Ga0070675_100234474 3300005354 Bacteria 1602
36 Ga0070671_100010752 3300005355 Bacteria 7345
37 Ga0070673_100033176 3300005364 Bacteria 3895
38 Ga0070673_100076677 3300005364 Bacteria 2700
39 Ga0070673_100093867 3300005364 Bacteria 2458
40 Ga0070659_100017142 3300005366 Bacteria 5445
41 Ga0070667_100093303 3300005367 Bacteria 2592
42 Ga0070667_100688404 3300005367 Bacteria 945
43 Ga0070663_100331717 3300005455 Unclassified 1226
44 Ga0070678_100252152 3300005456 Bacteria 1480
45 Ga0070662_100059428 3300005457 Bacteria 2785
46 Ga0070662_100122787 3300005457 Bacteria 1992
47 Ga0070662_100280122 3300005457 Bacteria 1349
48 Ga0070681_10073590 3300005458 Bacteria 3379
49 Ga0068867_100083138 3300005459 Bacteria 2417
50 Ga0068867_100317772 3300005459 Unclassified 1289
51 Ga0068867_100502443 3300005459 Bacteria 1042
52 Ga0070698_100097547 3300005471 Bacteria 2915
53 Ga0070698_100163178 3300005471 Bacteria 2171
54 Ga0070684_100007184 3300005535 Bacteria 8653
55 Ga0070684_100168486 3300005535 Bacteria 1989
56 Ga0070672_100054056 3300005543 Bacteria 3142
57 Ga0070672_100232563 3300005543 Bacteria 1549
58 Ga0070693_100016310 3300005547 Bacteria 3843
59 Ga0070665_100000016 3300005548 Bacteria 451538
60 Ga0070665_100146685 3300005548 Bacteria 2362
61 Ga0068855_100010491 3300005563 Bacteria 11175
62 Ga0068855_100031725 3300005563 Bacteria 6308
63 Ga0068855_100066093 3300005563 Unclassified 4216
64 Ga0070664_100018351 3300005564 Bacteria 5746
65 Ga0070664_100217834 3300005564 Bacteria 1707
66 Ga0070664_100541748 3300005564 Bacteria 1076
67 Ga0070664_100715625 3300005564 Unclassified 933
68 Ga0068857_100018269 3300005577 Bacteria 6151
69 Ga0068857_100021952 3300005577 Bacteria 5618
70 Ga0068857_100039866 3300005577 Bacteria 4163
71 Ga0068854_100221438 3300005578 Bacteria 1497
72 Ga0068856_100010382 3300005614 Bacteria 9045
73 Ga0068856_100051284 3300005614 Bacteria 4068
74 Ga0068856_100417741 3300005614 Unclassified 1361
75 Ga0070702_100002295 3300005615 Bacteria 8198
76 Ga0068852_100002901 3300005616 Bacteria 11904
77 Ga0068852_100046166 3300005616 Bacteria 3710
78 Ga0068852_100516556 3300005616 Bacteria 1191
79 Ga0068859_100000534 3300005617 Bacteria 37702
80 Ga0068859_100148182 3300005617 Bacteria 2422
81 Ga0068859_100539781 3300005617 Bacteria 1261
82 Ga0068859_100724416 3300005617 Bacteria 1084
83 Ga0068859_101316048 3300005617 Unclassified 796
84 Ga0068864_100025196 3300005618 Bacteria 5008
85 Ga0068864_100142216 3300005618 Bacteria 2165
86 Ga0068851_10010868 3300005834 Bacteria 4256
87 Ga0068851_10011899 3300005834 Bacteria 4092
88 Ga0068863_100062356 3300005841 Bacteria 3526
89 Ga0068863_100145703 3300005841 Bacteria 2265
90 Ga0068863_100297902 3300005841 Bacteria 1564
91 Ga0068858_100030128 3300005842 Bacteria 5039
92 Ga0068858_100316576 3300005842 Bacteria 1491
93 Ga0068860_100000026 3300005843 Bacteria 270483
94 Ga0068860_100097851 3300005843 Bacteria 2798
95 Ga0068860_100633290 3300005843 Bacteria 1076
96 Ga0081539_10001000 3300005985 Bacteria 52492
97 Ga0081539_10020682 3300005985 Bacteria 4433
98 Ga0070712_100266354 3300006175 Bacteria 1375
99 Ga0075366_10343956 3300006195 Unclassified 915
100 Ga0097621_100008605 3300006237 Bacteria 7357
101 Ga0097621_100029372 3300006237 Bacteria 4341
102 Ga0097621_100101035 3300006237 Bacteria 2427
103 Ga0068871_100012171 3300006358 Bacteria 6334
104 Ga0068865_100041007 3300006881 Bacteria 3149
105 Ga0097620_100000534 3300006931 Bacteria 37702
106 Ga0097620_100148176 3300006931 Bacteria 2422
107 Ga0097620_100539854 3300006931 Bacteria 1261
108 Ga0097620_100724416 3300006931 Bacteria 1084
109 Ga0097620_101315851 3300006931 Unclassified 796
110 Ga0105240_10000258 3300009093 Bacteria 105011
111 Ga0105240_10009749 3300009093 Bacteria 13562
112 Ga0105240_10022959 3300009093 Bacteria 8264
113 Ga0111539_10037442 3300009094 Bacteria 5858
114 Ga0111539_10285305 3300009094 Bacteria 1921
115 Ga0105247_10045965 3300009101 Unclassified 2680
116 Ga0114129_10000629 3300009147 Bacteria 43924
117 Ga0105241_10004352 3300009174 Bacteria 10470
118 Ga0105241_10005726 3300009174 Bacteria 9173
119 Ga0105242_10421574 3300009176 Unclassified 1251
120 Ga0105242_11002164 3300009176 Unclassified 843
121 Ga0105248_10255698 3300009177 Bacteria 1972
122 Ga0105237_10000893 3300009545 Bacteria 40252
123 Ga0105237_10007282 3300009545 Bacteria 12138
124 Ga0105237_10041256 3300009545 Bacteria 4655
125 Ga0105238_10071440 3300009551 Bacteria 3468
126 Ga0105249_10025659 3300009553 Bacteria 5308
127 Ga0105249_10178187 3300009553 Bacteria 2066
128 Ga0105249_10945462 3300009553 Unclassified 930
129 Ga0105239_10002218 3300010375 Bacteria 24927
130 Ga0105239_10003942 3300010375 Bacteria 17981
131 Ga0105239_10365861 3300010375 Bacteria 1629
132 Ga0157371_10023846 3300013102 Bacteria 4472
133 Ga0157371_10099492 3300013102 Bacteria 2062
134 Ga0157370_10035775 3300013104 Bacteria 4824
135 Ga0157369_10018223 3300013105 Bacteria 7874
136 Ga0157369_10115223 3300013105 Bacteria 2854
137 Ga0157374_10000455 3300013296 Bacteria 37317
138 Ga0157374_10012289 3300013296 Bacteria 7448
139 Ga0157374_10025442 3300013296 Bacteria 5315
140 Ga0157374_10026412 3300013296 Bacteria 5225
141 Ga0157374_10063712 3300013296 Unclassified 3458
142 Ga0157374_10090168 3300013296 Bacteria 2922
143 Ga0157374_10489440 3300013296 Bacteria 1234
144 Ga0157378_10007374 3300013297 Bacteria 9609
145 Ga0157378_10025160 3300013297 Bacteria 5245
146 Ga0157378_10032201 3300013297 Bacteria 4632
147 Ga0157378_10080867 3300013297 Unclassified 2936
148 Ga0157378_10201174 3300013297 Unclassified 1884
149 Ga0163162_10000394 3300013306 Bacteria 40017
150 Ga0163162_10015440 3300013306 Bacteria 7463
151 Ga0163162_10039516 3300013306 Bacteria 4715
152 Ga0163162_10166347 3300013306 Bacteria 2329
153 Ga0163162_10190363 3300013306 Bacteria 2179
154 Ga0163162_10400838 3300013306 Bacteria 1504
155 Ga0163162_10488564 3300013306 Bacteria 1362
156 Ga0157372_10005574 3300013307 Bacteria 13381
157 Ga0157372_10038498 3300013307 Bacteria 5277
158 Ga0157372_10159861 3300013307 Bacteria 2603
159 Ga0157372_10179995 3300013307 Bacteria 2447
160 Ga0157372_10211014 3300013307 Bacteria 2250
161 Ga0157372_11208605 3300013307 Bacteria 873
162 Ga0157375_10010332 3300013308 Bacteria 8217
163 Ga0157375_10585725 3300013308 Bacteria 1276
164 Ga0157375_10901744 3300013308 Bacteria 1028
165 Ga0163163_10000075 3300014325 Bacteria 109545
166 Ga0163163_10592839 3300014325 Unclassified 1171
167 Ga0157377_10020681 3300014745 Unclassified 3451
168 Ga0157377_10222122 3300014745 Unclassified 1210
169 Ga0157379_10121382 3300014968 Bacteria 2351
170 Ga0157379_10214094 3300014968 Bacteria 1745
171 Ga0157376_10004381 3300014969 Bacteria 9823
172 Ga0157376_10019671 3300014969 Bacteria 5209
173 Ga0157376_10036660 3300014969 Bacteria 3974
174 Ga0157376_10038110 3300014969 Bacteria 3908
175 Ga0157376_10508099 3300014969 Unclassified 1186
176 Ga0157376_10531432 3300014969 Bacteria 1161
177 Ga0163161_10025366 3300017792 Bacteria 4195
178 Ga0163161_10031432 3300017792 Unclassified 3782
179 Ga0163161_10115285 3300017792 Bacteria 2013
180 Ga0209258_108237 3300025242 Bacteria 1482
181 Ga0209646_1003380 3300025246 Bacteria 3171
182 Ga0207656_10006093 3300025321 Bacteria 4316
183 Ga0207680_10025509 3300025903 Bacteria 3261
184 Ga0207680_10110256 3300025903 Bacteria 1784
185 Ga0207680_10203300 3300025903 Bacteria 1351
186 Ga0207680_10293924 3300025903 Bacteria 1131
187 Ga0207647_10040949 3300025904 Bacteria 2915
188 Ga0207645_10020637 3300025907 Bacteria 4309
189 Ga0207705_10156929 3300025909 Bacteria 1708
190 Ga0207654_10018137 3300025911 Bacteria 3690
191 Ga0207695_10001600 3300025913 Bacteria 36751
192 Ga0207695_10011487 3300025913 Bacteria 10718
193 Ga0207695_10017976 3300025913 Bacteria 8186
194 Ga0207695_10275059 3300025913 Unclassified 1579
195 Ga0207671_10001859 3300025914 Bacteria 23567
196 Ga0207671_10005143 3300025914 Bacteria 12183
197 Ga0207671_10008168 3300025914 Bacteria 8928
198 Ga0207660_10149371 3300025917 Bacteria 1794
199 Ga0207657_10001494 3300025919 Bacteria 25019
200 Ga0207657_10127906 3300025919 Bacteria 2085
201 Ga0207694_10150831 3300025924 Bacteria 1873
202 Ga0207650_10186368 3300025925 Bacteria 1656
203 Ga0207659_10183938 3300025926 Bacteria 1658
204 Ga0207690_10188783 3300025932 Unclassified 1557
205 Ga0207706_10067423 3300025933 Bacteria 3148
206 Ga0207706_10107670 3300025933 Bacteria 2453
207 Ga0207706_10242582 3300025933 Bacteria 1575
208 Ga0207670_10029370 3300025936 Unclassified 3502
209 Ga0207691_10007465 3300025940 Bacteria 10524
210 Ga0207691_10040616 3300025940 Unclassified 4297
211 Ga0207689_10100508 3300025942 Bacteria 2376
212 Ga0207679_10013541 3300025945 Bacteria 5346
213 Ga0207679_10262219 3300025945 Bacteria 1474
214 Ga0207667_10006873 3300025949 Bacteria 13744
215 Ga0207667_10013148 3300025949 Bacteria 9492
216 Ga0207667_10053049 3300025949 Bacteria 4267
217 Ga0207651_10069543 3300025960 Bacteria 2486
218 Ga0207651_10106379 3300025960 Bacteria 2094
219 Ga0207712_10138208 3300025961 Bacteria 1866
220 Ga0207712_10234510 3300025961 Bacteria 1475
221 Ga0207668_10010633 3300025972 Bacteria 5567
222 Ga0207640_10554829 3300025981 Bacteria 966
223 Ga0207658_10153302 3300025986 Bacteria 1880
224 Ga0207658_10582934 3300025986 Bacteria 1003
225 Ga0207677_10031888 3300026023 Bacteria 3380
226 Ga0207677_10036017 3300026023 Bacteria 3220
227 Ga0207677_10619059 3300026023 Bacteria 952
228 Ga0207703_10035122 3300026035 Bacteria 3983
229 Ga0207703_11256325 3300026035 Bacteria 712
230 Ga0207708_10122486 3300026075 Bacteria 2027
231 Ga0207702_10132260 3300026078 Bacteria 2246
232 Ga0207702_10366519 3300026078 Bacteria 1382
233 Ga0207641_10059526 3300026088 Bacteria 3253
234 Ga0207641_11158789 3300026088 Unclassified 772
235 Ga0207648_10210654 3300026089 Bacteria 1725
236 Ga0207648_10215587 3300026089 Bacteria 1705
237 Ga0207648_10886238 3300026089 Bacteria 833
238 Ga0207676_10043068 3300026095 Unclassified 3473
239 Ga0207676_10468474 3300026095 Bacteria 1191
240 Ga0207676_10484887 3300026095 Bacteria 1171
241 Ga0207674_10009390 3300026116 Bacteria 11181
242 Ga0207674_10015934 3300026116 Bacteria 8234
243 Ga0207674_10027953 3300026116 Bacteria 5960
244 Ga0207675_100045820 3300026118 Bacteria 4084
245 Ga0207683_10156695 3300026121 Bacteria 2057
246 Ga0207698_10020992 3300026142 Bacteria 4509
247 Ga0207698_10510320 3300026142 Bacteria 1171
248 Ga0207428_10614584 3300027907 Unclassified 782
249 Ga0268266_10000034 3300028379 Bacteria 354251
250 Ga0268266_10236172 3300028379 Bacteria 1685
251 Ga0268264_10000117 3300028381 Bacteria 195037
252 Ga0268264_10246353 3300028381 Bacteria 1658
253 Ga0307515_10000001 3300028794 Bacteria 4259510
254 Ga0265327_10000051 3300031251 Bacteria 257963
255 Ga0265327_10000415 3300031251 Bacteria 78296
256 Ga0307513_10172369 3300031456 Bacteria 2039
257 Ga0307509_10162271 3300031507 Bacteria 2130
258 Ga0307509_10237153 3300031507 Bacteria 1621
259 Ga0373947_0449308 3300035725 Bacteria 873
260 Ga0373937_0199050 3300036401 Bacteria 1883
261 Ga0439436_0003852 3300041404 Unclassified 4594
262 Ga0439439_0018376 3300041406 Bacteria 1726
263 Ga0451853_0674528 3300041512 Bacteria 4587
264 Ga0439457_000390 3300042014 Bacteria 12410
265 Ga0439462_0007637 3300042015 Bacteria 2712
266 Ga0466969_0000072 3300044656 Bacteria 53055
267 Ga0466972_0000006 3300044658 Bacteria 282264
268 Ga0466972_0000166 3300044658 Bacteria 52364
269 Ga0466972_0030102 3300044658 Bacteria 2672
270 Ga0466972_0058681 3300044658 Bacteria 1847
271 Ga0466966_0006994 3300044684 Bacteria 7471
272 Ga0466968_0088365 3300044735 Bacteria 1370
273 Ga0466968_0094936 3300044735 Unclassified 1326
274 Ga0466970_0000310 3300044765 Bacteria 23765
275 Ga0466957_0000358 3300044842 Bacteria 22387
276 Ga0466957_0001044 3300044842 Bacteria 14285
277 Ga0466960_0125457 3300044901 Unclassified 1349
278 Ga0466959_0000012 3300045049 Bacteria 168961
279 Ga0495638_0028259 3300046460 Unclassified 3623
280 Ga0495630_0021929 3300046517 Unclassified 4717
281 Ga0495630_0355186 3300046517 Bacteria 1122
282 Ga0495632_0118769 3300046519 Bacteria 1237
283 Ga0495648_0009981 3300046524 Bacteria 7283
284 Ga0495633_0042718 3300046558 Bacteria 2152
285 Ga0495635_0078948 3300046663 Bacteria 2253
286 Ga0495658_0007485 3300046683 Bacteria 5408
287 Ga0495624_0197758 3300046690 Bacteria 1222
288 Ga0495674_0053991 3300047319 Unclassified 3530
289 Ga0495672_0050970 3300047320 Bacteria 2440
290 Ga0495676_0098379 3300047321 Bacteria 2171
291 Ga0495687_000135 3300047443 Bacteria 113460
292 Ga0495684_0277415 3300047471 Bacteria 1210
293 Ga0496115_0046282 3300048918 Bacteria 3476
294 Ga0496115_0518868 3300048918 Bacteria 956
295 Ga0501046_0545257 3300049580 Bacteria 827
296 Ga0501047_0270323 3300049581 Bacteria 1546
297 Ga0501225_0012117 3300049705 Bacteria 2422
298 nmdc:mga05p37_25179_c1 3300050507 Bacteria 7236
299 nmdc:mga08y16_22544_c1 3300050511 Bacteria 6648
300 Ga0500578_0000541 3300053086 Bacteria 45881
301 Ga0500578_0078847 3300053086 Bacteria 2096
302 Ga0500644_0062582 3300053088 Archaea 1316
303 Ga0500646_0041626 3300053090 Archaea 1295
304 Ga0500583_0000010 3300053092 Bacteria 160546
305 Ga0500583_0021715 3300053092 Unclassified 2675
306 Ga0500642_0020153 3300053130 Bacteria 2616
307 Ga0500573_0097563 3300053140 Bacteria 1656
308 Ga0500619_038514 3300053154 Unclassified 1499
309 Ga0500622_0019843 3300053156 Bacteria 3568
310 Ga0500622_0089787 3300053156 Bacteria 1526
311 Ga0500636_0082547 3300053177 Bacteria 1850
312 2738728958 2738541278 Bacteria 9755573
313 Ga0105240_10455581
314 JGI25406J46586_10048495
315 rootH2_10096732
316 rootH2_10334251
317 rootL2_10035506
318 rootL2_10082011
319 rootH1_10016419
320 Ga0070658_10059847
321 Ga0070658_10948651
322 Ga0070676_10030000
323 Ga0070683_100008006
324 Ga0070683_100091450
325 Ga0070690_100068293
326 Ga0070690_100319558
327 Ga0068869_100084728
328 Ga0070666_10051848
329 Ga0070666_10057147
330 Ga0070666_10259454
331 Ga0070666_10326855
332 Ga0070680_100046827
333 Ga0070682_100344913
334 Ga0068868_100011227
335 Ga0068868_100040877
336 Ga0068868_100097694
337 Ga0068868_100317887
338 Ga0068868_100505317
339 Ga0070660_100044195
340 Ga0070660_100135853
341 Ga0070689_100044642
342 Ga0070687_100051649
343 Ga0070661_100005701
344 Ga0070661_100213684
345 Ga0070668_100147265
346 Ga0070675_100077486
347 Ga0070675_100234474
348 Ga0070671_100010752
349 Ga0070673_100033176
350 Ga0070673_100076677
351 Ga0070673_100093867
352 Ga0070659_100017142
353 Ga0070667_100093303
354 Ga0070667_100688404
355 Ga0070663_100331717
356 Ga0070678_100252152
357 Ga0070662_100059428
358 Ga0070662_100122787
359 Ga0070662_100280122
360 Ga0070681_10073590
361 Ga0068867_100083138
362 Ga0068867_100317772
363 Ga0068867_100502443
364 Ga0070698_100097547
365 Ga0070698_100163178
366 Ga0070684_100007184
367 Ga0070684_100168486
368 Ga0070672_100054056
369 Ga0070672_100232563
370 Ga0070693_100016310
371 Ga0070665_100000016
372 Ga0070665_100146685
373 Ga0068855_100010491
374 Ga0068855_100031725
375 Ga0068855_100066093
376 Ga0070664_100018351
377 Ga0070664_100217834
378 Ga0070664_100541748
379 Ga0070664_100715625
380 Ga0068857_100018269
381 Ga0068857_100021952
382 Ga0068857_100039866
383 Ga0068854_100221438
384 Ga0068856_100010382
385 Ga0068856_100051284
386 Ga0068856_100417741
387 Ga0070702_100002295
388 Ga0068852_100002901
389 Ga0068852_100046166
390 Ga0068852_100516556
391 Ga0068859_100000534
392 Ga0068859_100148182
393 Ga0068859_100539781
394 Ga0068859_100724416
395 Ga0068859_101316048
396 Ga0068864_100025196
397 Ga0068864_100142216
398 Ga0068851_10010868
399 Ga0068851_10011899
400 Ga0068863_100062356
401 Ga0068863_100145703
402 Ga0068863_100297902
403 Ga0068858_100030128
404 Ga0068858_100316576
405 Ga0068860_100000026
406 Ga0068860_100097851
407 Ga0068860_100633290
408 Ga0081539_10001000
409 Ga0081539_10020682
410 Ga0070712_100266354
411 Ga0075366_10343956
412 Ga0097621_100008605
413 Ga0097621_100029372
414 Ga0097621_100101035
415 Ga0068871_100012171
416 Ga0068865_100041007
417 Ga0097620_100000534
418 Ga0097620_100148176
419 Ga0097620_100539854
420 Ga0097620_100724416
421 Ga0097620_101315851
422 Ga0105240_10000258
423 Ga0105240_10009749
424 Ga0105240_10022959
425 Ga0111539_10037442
426 Ga0111539_10285305
427 Ga0105247_10045965
428 Ga0114129_10000629
429 Ga0105241_10004352
430 Ga0105241_10005726
431 Ga0105242_10421574
432 Ga0105242_11002164
433 Ga0105248_10255698
434 Ga0105237_10000893
435 Ga0105237_10007282
436 Ga0105237_10041256
437 Ga0105238_10071440
438 Ga0105249_10025659
439 Ga0105249_10178187
440 Ga0105249_10945462
441 Ga0105239_10002218
442 Ga0105239_10003942
443 Ga0105239_10365861
444 Ga0157371_10023846
445 Ga0157371_10099492
446 Ga0157370_10035775
447 Ga0157369_10018223
448 Ga0157369_10115223
449 Ga0157374_10000455
450 Ga0157374_10012289
451 Ga0157374_10025442
452 Ga0157374_10026412
453 Ga0157374_10063712
454 Ga0157374_10090168
455 Ga0157374_10489440
456 Ga0157378_10007374
457 Ga0157378_10025160
458 Ga0157378_10032201
459 Ga0157378_10080867
460 Ga0157378_10201174
461 Ga0163162_10000394
462 Ga0163162_10015440
463 Ga0163162_10039516
464 Ga0163162_10166347
465 Ga0163162_10190363
466 Ga0163162_10400838
467 Ga0163162_10488564
468 Ga0157372_10005574
469 Ga0157372_10038498
470 Ga0157372_10159861
471 Ga0157372_10179995
472 Ga0157372_10211014
473 Ga0157372_11208605
474 Ga0157375_10010332
475 Ga0157375_10585725
476 Ga0157375_10901744
477 Ga0163163_10000075
478 Ga0163163_10592839
479 Ga0157377_10020681
480 Ga0157377_10222122
481 Ga0157379_10121382
482 Ga0157379_10214094
483 Ga0157376_10004381
484 Ga0157376_10019671
485 Ga0157376_10036660
486 Ga0157376_10038110
487 Ga0157376_10508099
488 Ga0157376_10531432
489 Ga0163161_10025366
490 Ga0163161_10031432
491 Ga0163161_10115285
492 Ga0209258_108237
493 Ga0209646_1003380
494 Ga0207656_10006093
495 Ga0207680_10025509
496 Ga0207680_10110256
497 Ga0207680_10203300
498 Ga0207680_10293924
499 Ga0207647_10040949
500 Ga0207645_10020637
501 Ga0207705_10156929
502 Ga0207654_10018137
503 Ga0207695_10001600
504 Ga0207695_10011487
505 Ga0207695_10017976
506 Ga0207695_10275059
507 Ga0207671_10001859
508 Ga0207671_10005143
509 Ga0207671_10008168
510 Ga0207660_10149371
511 Ga0207657_10001494
512 Ga0207657_10127906
513 Ga0207694_10150831
514 Ga0207650_10186368
515 Ga0207659_10183938
516 Ga0207690_10188783
517 Ga0207706_10067423
518 Ga0207706_10107670
519 Ga0207706_10242582
520 Ga0207670_10029370
521 Ga0207691_10007465
522 Ga0207691_10040616
523 Ga0207689_10100508
524 Ga0207679_10013541
525 Ga0207679_10262219
526 Ga0207667_10006873
527 Ga0207667_10013148
528 Ga0207667_10053049
529 Ga0207651_10069543
530 Ga0207651_10106379
531 Ga0207712_10138208
532 Ga0207712_10234510
533 Ga0207668_10010633
534 Ga0207640_10554829
535 Ga0207658_10153302
536 Ga0207658_10582934
537 Ga0207677_10031888
538 Ga0207677_10036017
539 Ga0207677_10619059
540 Ga0207703_10035122
541 Ga0207703_11256325
542 Ga0207708_10122486
543 Ga0207702_10132260
544 Ga0207702_10366519
545 Ga0207641_10059526
546 Ga0207641_11158789
547 Ga0207648_10210654
548 Ga0207648_10215587
549 Ga0207648_10886238
550 Ga0207676_10043068
551 Ga0207676_10468474
552 Ga0207676_10484887
553 Ga0207674_10009390
554 Ga0207674_10015934
555 Ga0207674_10027953
556 Ga0207675_100045820
557 Ga0207683_10156695
558 Ga0207698_10020992
559 Ga0207698_10510320
560 Ga0207428_10614584
561 Ga0268266_10000034
562 Ga0268266_10236172
563 Ga0268264_10000117
564 Ga0268264_10246353
565 Ga0307515_10000001
566 Ga0265327_10000051
567 Ga0265327_10000415
568 Ga0307513_10172369
569 Ga0307509_10162271
570 Ga0307509_10237153
571 Ga0373947_0449308
572 Ga0373937_0199050
573 Ga0439436_0003852
574 Ga0439439_0018376
575 Ga0451853_0674528
576 Ga0439457_000390
577 Ga0439462_0007637
578 Ga0466969_0000072
579 Ga0466972_0000006
580 Ga0466972_0000166
581 Ga0466972_0030102
582 Ga0466972_0058681
583 Ga0466966_0006994
584 Ga0466968_0088365
585 Ga0466968_0094936
586 Ga0466970_0000310
587 Ga0466957_0000358
588 Ga0466957_0001044
589 Ga0466960_0125457
590 Ga0466959_0000012
591 Ga0495638_0028259
592 Ga0495630_0021929
593 Ga0495630_0355186
594 Ga0495632_0118769
595 Ga0495648_0009981
596 Ga0495633_0042718
597 Ga0495635_0078948
598 Ga0495658_0007485
599 Ga0495624_0197758
600 Ga0495674_0053991
601 Ga0495672_0050970
602 Ga0495676_0098379
603 Ga0495687_000135
604 Ga0495684_0277415
605 Ga0496115_0046282
606 Ga0496115_0518868
607 Ga0501046_0545257
608 Ga0501047_0270323
609 Ga0501225_0012117
610 nmdc:mga05p37_25179_c1
611 nmdc:mga08y16_22544_c1
612 Ga0500578_0000541
613 Ga0500578_0078847
614 Ga0500644_0062582
615 Ga0500646_0041626
616 Ga0500583_0000010
617 Ga0500583_0021715
618 Ga0500642_0020153
619 Ga0500573_0097563
620 Ga0500619_038514
621 Ga0500622_0019843
622 Ga0500622_0089787
623 Ga0500636_0082547
624 2738728958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06902

Fer4_19

Divergent 4Fe-4S mono-cluster

169

232

0.96

PF02566

OsmC

OsmC-like protein

59

156

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c9g-assembly1.cif.gz_B amp-activated protein kinase bound to pharmacological activator r739 0.7989 78 100
6c9h-assembly1.cif.gz_B non-phosphorylated amp-activated protein kinase bound to pharmacological activator r734 0.7965 78 100
6c9f-assembly1.cif.gz_B amp-activated protein kinase bound to pharmacological activator r734 0.7958 78 100
6c9j-assembly1.cif.gz_B amp-activated protein kinase bound to pharmacological activator r734 0.7955 78 100
4mh4-assembly1.cif.gz_B crystal structure of osmc-like protein from burkholderia cenocepacia j2315 0.7592 37 129
ID Description Score Start End Superfamily
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8041 46 129 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7965 46 127 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7664 39 127 3.30.300.20
af_F1R8J2_479_647_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7362 75 99 2.60.120.200
af_H2KYV6_5_140_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.7315 76 104 2.60.210.10
ID Description Score Start End GO Terms
AF-A0A358XN83-F1-model_v4 Osmotically inducible protein OsmC 0.906 51 137
AF-A0A535AES6-F1-model_v4 Divergent 4Fe-4S mono-cluster domain-containing protein 0.9051 143 210
AF-A0A7Y4X201-F1-model_v4 (4Fe-4S)-binding protein 0.9042 145 209
AF-A0A7I6VJ33-F1-model_v4 deleted 0.9038 144 211
AF-A0A2W0CIC1-F1-model_v4 Divergent 4Fe-4S mono-cluster domain-containing protein 0.9035 141 209

Map