F401443

General Info

Members Datasets Scaffolds Average Seq Length
311 145 291 372

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_11455_c1|nmdc:mga00v17_11455_c1_3098_4204
Length 368
Sequence MRVLHVFKTYFPDTHGGVEQVIYQLAEGGARHGIESHVFSLSPRGAGREERYGHHTTHRARQDVYVASTGFSLSAIRDFRALVPTMDVVHYHFPWPFMDLLHLARGTSRPSLVTYHSDIVKQSVLLQAYRPLMRHFLGSMDRIVASSPNYATSSPELVRLADKVRVIPFGLDRATYPPADPERIAHWRARLGPRFFLFVGGLRYYKGLDYLLSAVRGTGIELAICGGGAAADSLQGQAEGEGNVHFLGALDDADKMALLTLCEAFVLPSHLRSEAFGVSLLEAAMLGKPLVCCEIGTGTTYINRDGETGLVVPPADVPALRAALMRLWNDPALAARLGAGARARFDAVFQGDAMVDAYAELYRELAHR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231007 Pseudomonas sp. GM18 Isolate Nodule
3 2511231021 Pseudomonas sp. GM78 Isolate Nodule
4 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
5 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
6 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
7 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
8 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
9 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
10 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
11 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
12 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
13 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
14 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
15 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
16 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
17 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
24 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
25 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
26 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
48 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
49 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
50 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
51 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
52 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
53 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
54 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
55 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
56 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
57 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
58 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
59 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
60 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
61 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
62 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
63 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
68 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
69 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
70 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
71 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
72 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
75 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
76 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
81 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
85 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
86 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
87 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
88 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
91 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
92 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
95 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
96 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
97 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
103 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
117 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
118 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
142 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
143 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
144 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
145 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.57
Metatranscriptomes 0
Isolates 6.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 1.29
Rhizoplane 2.89
Rhizosphere 84.24
Stem 0
Stem Tuber 0
Unclassified 10.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1747262 2162886007 Bacteria 2886
2 rootH2_10233728 3300003320 Bacteria 2090
3 Ga0065714_10065083 3300005288 Bacteria 13163
4 Ga0065714_10111645 3300005288 Bacteria 1465
5 Ga0065704_10000395 3300005289 Bacteria 23814
6 Ga0070665_100172505 3300005548 Bacteria 2164
7 Ga0075364_10078697 3300006051 Bacteria 2178
8 Ga0079104_1000592 3300006946 Bacteria 36135
9 Ga0105251_10000011 3300009011 Bacteria 180176
10 Ga0105251_10001437 3300009011 Bacteria 20475
11 Ga0105251_10001634 3300009011 Bacteria 18983
12 Ga0105251_10004810 3300009011 Bacteria 9034
13 Ga0105244_10000665 3300009036 Bacteria 30168
14 Ga0105244_10013987 3300009036 Bacteria 4659
15 Ga0105244_10029314 3300009036 Unclassified 2943
16 Ga0105244_10067529 3300009036 Bacteria 1788
17 Ga0105250_10001630 3300009092 Bacteria 11995
18 Ga0105250_10014274 3300009092 Bacteria 3267
19 Ga0105241_10000005 3300009174 Bacteria 384203
20 Ga0157373_10000625 3300013100 Bacteria 27712
21 Ga0157373_10015923 3300013100 Bacteria 5490
22 Ga0157373_10099305 3300013100 Bacteria 2049
23 Ga0157371_10000490 3300013102 Bacteria 48023
24 Ga0157371_10001819 3300013102 Bacteria 21490
25 Ga0157371_10014898 3300013102 Bacteria 5852
26 Ga0157371_10038562 3300013102 Bacteria 3418
27 Ga0157370_10001663 3300013104 Bacteria 27396
28 Ga0157370_10008848 3300013104 Bacteria 10824
29 Ga0157369_10001654 3300013105 Bacteria 27182
30 Ga0157369_10007046 3300013105 Bacteria 12963
31 Ga0157369_10135114 3300013105 Bacteria 2612
32 Ga0157369_10170876 3300013105 Bacteria 2290
33 Ga0157369_10478186 3300013105 Bacteria 1289
34 Ga0163162_10012657 3300013306 Bacteria 8238
35 Ga0163162_10074991 3300013306 Bacteria 3443
36 Ga0157372_10011438 3300013307 Bacteria 9437
37 Ga0157372_10047277 3300013307 Bacteria 4781
38 Ga0182008_10000912 3300014497 Bacteria 20556
39 Ga0182008_10001622 3300014497 Bacteria 14896
40 Ga0182008_10002216 3300014497 Bacteria 12317
41 Ga0182008_10058556 3300014497 Bacteria 1901
42 Ga0182006_1016485 3300015261 Bacteria 3151
43 Ga0163161_10006386 3300017792 Bacteria 8160
44 Ga0207696_1001711 3300025711 Bacteria 11378
45 Ga0207696_1004745 3300025711 Bacteria 5787
46 Ga0207696_1005418 3300025711 Bacteria 5298
47 Ga0207655_1001324 3300025728 Bacteria 23396
48 Ga0207655_1013512 3300025728 Bacteria 4684
49 Ga0207655_1015237 3300025728 Bacteria 4286
50 Ga0207655_1032915 3300025728 Bacteria 2360
51 Ga0207655_1064783 3300025728 Unclassified 1391
52 Ga0207713_1000024 3300025735 Bacteria 339156
53 Ga0207713_1000026 3300025735 Bacteria 319032
54 Ga0207713_1000073 3300025735 Bacteria 181519
55 Ga0207713_1014592 3300025735 Bacteria 4073
56 Ga0207713_1017857 3300025735 Bacteria 3534
57 Ga0207654_10000007 3300025911 Bacteria 384211
58 Ga0207668_10018611 3300025972 Bacteria 4375
59 Ga0209281_1000667 3300027111 Bacteria 36058
60 Ga0268266_10038753 3300028379 Bacteria 4057
61 Ga0268256_1000815 3300030500 Bacteria 22341
62 Ga0307408_100003953 3300031548 Bacteria 10096
63 Ga0307412_10000345 3300031911 Bacteria 29071
64 Ga0307412_10000861 3300031911 Bacteria 17469
65 Ga0307412_10005164 3300031911 Bacteria 7313
66 Ga0439438_000002 3300041405 Bacteria 618223
67 Ga0439438_001039 3300041405 Bacteria 12369
68 Ga0439447_000084 3300041407 Bacteria 33114
69 Ga0439466_0000001 3300041411 Bacteria 647258
70 Ga0439445_0003111 3300042004 Bacteria 3720
71 Ga0439432_000295 3300042006 Bacteria 17930
72 Ga0439432_001153 3300042006 Bacteria 10014
73 Ga0439451_016659 3300042009 Bacteria 1479
74 Ga0439452_000154 3300042010 Bacteria 51036
75 Ga0439452_000168 3300042010 Bacteria 48709
76 Ga0439456_000154 3300042013 Bacteria 20418
77 Ga0439456_000727 3300042013 Bacteria 6764
78 Ga0439463_000990 3300042016 Bacteria 7748
79 Ga0450904_000187 3300042139 Bacteria 13562
80 Ga0450907_000032 3300042146 Bacteria 64022
81 Ga0439446_0024955 3300042156 Bacteria 1708
82 Ga0439434_0000037 3300042435 Bacteria 32174
83 Ga0439460_0002250 3300042461 Bacteria 4638
84 Ga0450916_001187 3300042530 Bacteria 2565
85 Ga0466969_0010939 3300044656 Bacteria 4805
86 Ga0466966_0108733 3300044684 Bacteria 1710
87 Ga0466961_0151564 3300044693 Bacteria 1447
88 Ga0466970_0112508 3300044765 Bacteria 1487
89 Ga0466959_0016579 3300045049 Bacteria 5386
90 Ga0495617_002667 3300046452 Bacteria 6942
91 Ga0495617_004101 3300046452 Bacteria 5351
92 Ga0495617_006124 3300046452 Bacteria 4236
93 Ga0495627_007177 3300046453 Bacteria 4299
94 Ga0495627_010274 3300046453 Bacteria 3410
95 Ga0495591_000180 3300046458 Bacteria 65553
96 Ga0495591_000210 3300046458 Bacteria 59177
97 Ga0495591_000310 3300046458 Bacteria 44305
98 Ga0495591_000441 3300046458 Bacteria 33842
99 Ga0495591_000449 3300046458 Bacteria 33551
100 Ga0495591_009382 3300046458 Bacteria 3896
101 Ga0495638_0011627 3300046460 Bacteria 6061
102 Ga0495638_0033702 3300046460 Bacteria 3274
103 Ga0495653_0000475 3300046463 Bacteria 31075
104 Ga0495650_0000389 3300046471 Bacteria 75118
105 Ga0495650_0000454 3300046471 Bacteria 64731
106 Ga0495650_0004898 3300046471 Bacteria 8948
107 Ga0495650_0016123 3300046471 Bacteria 3799
108 Ga0495605_0000214 3300046474 Bacteria 71480
109 Ga0495605_0000334 3300046474 Bacteria 47084
110 Ga0495605_0000518 3300046474 Bacteria 32871
111 Ga0495605_0025014 3300046474 Bacteria 3116
112 Ga0495605_0026037 3300046474 Bacteria 3042
113 Ga0495584_0000210 3300046491 Bacteria 42003
114 Ga0495584_0000446 3300046491 Bacteria 28449
115 Ga0495584_0006250 3300046491 Bacteria 6249
116 Ga0495584_0014550 3300046491 Bacteria 4009
117 Ga0495584_0053782 3300046491 Bacteria 2026
118 Ga0495585_0000337 3300046492 Bacteria 45680
119 Ga0495585_0000356 3300046492 Bacteria 44409
120 Ga0495585_0012256 3300046492 Bacteria 5051
121 Ga0495596_0000075 3300046500 Bacteria 69681
122 Ga0495596_0000198 3300046500 Bacteria 41305
123 Ga0495607_0000195 3300046501 Bacteria 64300
124 Ga0495607_0000641 3300046501 Bacteria 33969
125 Ga0495607_0006153 3300046501 Bacteria 8490
126 Ga0495607_0014263 3300046501 Bacteria 5181
127 Ga0495607_0040600 3300046501 Bacteria 2769
128 Ga0495607_0051362 3300046501 Bacteria 2394
129 Ga0495607_0084556 3300046501 Bacteria 1735
130 Ga0495607_0093800 3300046501 Bacteria 1620
131 Ga0495607_0098371 3300046501 Bacteria 1571
132 Ga0495583_0000214 3300046506 Bacteria 97639
133 Ga0495583_0000553 3300046506 Bacteria 52333
134 Ga0495583_0000914 3300046506 Bacteria 34975
135 Ga0495583_0002085 3300046506 Bacteria 18033
136 Ga0495583_0003423 3300046506 Bacteria 12097
137 Ga0495583_0032749 3300046506 Bacteria 2506
138 Ga0495606_0000240 3300046507 Bacteria 96783
139 Ga0495606_0016080 3300046507 Bacteria 5727
140 Ga0495606_0028538 3300046507 Bacteria 3934
141 Ga0495610_0048667 3300046512 Bacteria 2080
142 Ga0495616_0005450 3300046513 Bacteria 7825
143 Ga0495620_0009621 3300046515 Bacteria 5131
144 Ga0495620_0022651 3300046515 Bacteria 3020
145 Ga0495630_0052899 3300046517 Bacteria 3040
146 Ga0495630_0130682 3300046517 Unclassified 1907
147 Ga0495631_0008004 3300046518 Bacteria 5343
148 Ga0495631_0012584 3300046518 Bacteria 4128
149 Ga0495631_0013724 3300046518 Bacteria 3925
150 Ga0495632_0000110 3300046519 Bacteria 84473
151 Ga0495632_0000393 3300046519 Bacteria 41065
152 Ga0495632_0012408 3300046519 Bacteria 4917
153 Ga0495632_0012786 3300046519 Bacteria 4818
154 Ga0495632_0061685 3300046519 Bacteria 1819
155 Ga0495637_0000169 3300046520 Bacteria 50531
156 Ga0495637_0000550 3300046520 Bacteria 26965
157 Ga0495637_0000650 3300046520 Bacteria 24221
158 Ga0495637_0001625 3300046520 Bacteria 13045
159 Ga0495637_0004155 3300046520 Bacteria 7533
160 Ga0495637_0006232 3300046520 Bacteria 5995
161 Ga0495637_0014318 3300046520 Bacteria 3741
162 Ga0495637_0019627 3300046520 Bacteria 3122
163 Ga0495643_0087650 3300046522 Bacteria 1610
164 Ga0495643_0109207 3300046522 Bacteria 1408
165 Ga0495644_0008176 3300046523 Bacteria 4025
166 Ga0495644_0012033 3300046523 Bacteria 3324
167 Ga0495648_0000523 3300046524 Bacteria 41360
168 Ga0495648_0000600 3300046524 Bacteria 38533
169 Ga0495648_0001552 3300046524 Bacteria 22438
170 Ga0495648_0018755 3300046524 Bacteria 4883
171 Ga0495648_0060880 3300046524 Bacteria 2244
172 Ga0495666_0012628 3300046526 Bacteria 4210
173 Ga0495642_0007438 3300046528 Bacteria 4196
174 Ga0495654_0000215 3300046530 Bacteria 54353
175 Ga0495654_0000267 3300046530 Bacteria 47487
176 Ga0495654_0000471 3300046530 Bacteria 33535
177 Ga0495654_0003756 3300046530 Bacteria 9194
178 Ga0495654_0019148 3300046530 Bacteria 3580
179 Ga0495609_0000285 3300046538 Bacteria 46837
180 Ga0495609_0000446 3300046538 Bacteria 33826
181 Ga0495609_0035550 3300046538 Bacteria 2255
182 Ga0495597_0000450 3300046542 Bacteria 35268
183 Ga0495597_0015262 3300046542 Bacteria 3638
184 Ga0495622_0006907 3300046557 Bacteria 5272
185 Ga0495622_0012613 3300046557 Bacteria 3916
186 Ga0495622_0029032 3300046557 Bacteria 2584
187 Ga0495622_0052309 3300046557 Bacteria 1895
188 Ga0495633_0018472 3300046558 Bacteria 3541
189 Ga0495656_0014732 3300046615 Bacteria 2937
190 Ga0495668_0000195 3300046616 Bacteria 89153
191 Ga0495668_0007056 3300046616 Bacteria 7238
192 Ga0495668_0037060 3300046616 Bacteria 2730
193 Ga0495625_0000184 3300046660 Bacteria 98137
194 Ga0495625_0001044 3300046660 Bacteria 36377
195 Ga0495625_0055841 3300046660 Bacteria 2814
196 Ga0495661_0000649 3300046665 Bacteria 35207
197 Ga0495661_0001560 3300046665 Bacteria 18884
198 Ga0495661_0003385 3300046665 Bacteria 11801
199 Ga0495661_0004690 3300046665 Bacteria 9817
200 Ga0495661_0038063 3300046665 Bacteria 2999
201 Ga0495661_0056499 3300046665 Bacteria 2348
202 Ga0495588_0006469 3300046674 Bacteria 5279
203 Ga0495646_0027997 3300046680 Bacteria 3532
204 Ga0495669_0000554 3300046684 Bacteria 16597
205 Ga0495670_0001309 3300046691 Bacteria 12119
206 Ga0495670_0025937 3300046691 Bacteria 2901
207 Ga0495671_0001297 3300046692 Bacteria 17067
208 Ga0495671_0003439 3300046692 Bacteria 9726
209 Ga0495671_0027788 3300046692 Bacteria 2918
210 Ga0495671_0044294 3300046692 Bacteria 2231
211 Ga0495671_0074639 3300046692 Bacteria 1664
212 Ga0495649_0000248 3300046694 Bacteria 47881
213 Ga0495649_0052286 3300046694 Bacteria 2214
214 Ga0495589_0015130 3300046794 Bacteria 3973
215 Ga0495589_0096015 3300046794 Bacteria 1437
216 Ga0495600_0033597 3300046809 Bacteria 3330
217 Ga0495660_0000634 3300046810 Bacteria 27391
218 Ga0495660_0002425 3300046810 Bacteria 11883
219 Ga0495660_0002649 3300046810 Bacteria 11341
220 Ga0495660_0002845 3300046810 Bacteria 10873
221 Ga0495660_0003481 3300046810 Bacteria 9713
222 Ga0495660_0019113 3300046810 Bacteria 3934
223 Ga0495636_0033044 3300047318 Bacteria 2123
224 Ga0495672_0000015 3300047320 Bacteria 502855
225 Ga0495672_0000695 3300047320 Bacteria 37258
226 Ga0495672_0012401 3300047320 Bacteria 5950
227 Ga0495672_0013411 3300047320 Bacteria 5656
228 Ga0495676_0000021 3300047321 Bacteria 166180
229 Ga0495676_0000567 3300047321 Bacteria 30353
230 Ga0495680_0012786 3300047322 Bacteria 7360
231 Ga0495683_0000825 3300047323 Bacteria 22072
232 Ga0495683_0001022 3300047323 Bacteria 19483
233 Ga0495683_0004394 3300047323 Bacteria 8015
234 Ga0495683_0009945 3300047323 Bacteria 5050
235 Ga0495675_0031612 3300047444 Bacteria 3379
236 Ga0495677_0005696 3300047445 Bacteria 4723
237 Ga0495679_015655 3300047446 Bacteria 2767
238 Ga0495679_015920 3300047446 Bacteria 2733
239 Ga0495685_003615 3300047447 Bacteria 4945
240 Ga0495673_0000437 3300047469 Bacteria 46445
241 Ga0495673_0005586 3300047469 Bacteria 7573
242 Ga0495673_0008886 3300047469 Bacteria 5602
243 Ga0495673_0029931 3300047469 Bacteria 2564
244 Ga0495681_0000125 3300047470 Bacteria 67542
245 Ga0495681_0000196 3300047470 Bacteria 50863
246 Ga0495681_0001986 3300047470 Bacteria 14932
247 Ga0495681_0002648 3300047470 Bacteria 12698
248 Ga0495681_0005471 3300047470 Bacteria 8490
249 Ga0495681_0007647 3300047470 Bacteria 6873
250 Ga0495681_0013936 3300047470 Bacteria 4638
251 Ga0495686_0115359 3300047472 Bacteria 1606
252 Ga0495626_0000323 3300048091 Bacteria 50382
253 Ga0496100_0065528 3300048903 Bacteria 2407
254 Ga0496102_0000107 3300048905 Bacteria 118250
255 Ga0496105_0082044 3300048908 Bacteria 2663
256 Ga0496106_0000058 3300048909 Bacteria 88804
257 Ga0496107_0075711 3300048910 Bacteria 2450
258 Ga0496116_0010613 3300048919 Bacteria 7703
259 Ga0496116_0026556 3300048919 Bacteria 4232
260 Ga0496116_0112216 3300048919 Bacteria 1598
261 Ga0496117_0001742 3300048920 Bacteria 30028
262 Ga0496117_0002190 3300048920 Bacteria 25452
263 Ga0496117_0016308 3300048920 Bacteria 6276
264 Ga0496117_0034615 3300048920 Bacteria 3803
265 Ga0496118_0002049 3300048921 Bacteria 28483
266 Ga0496118_0002580 3300048921 Bacteria 24199
267 Ga0496118_0012786 3300048921 Bacteria 8013
268 Ga0496119_0004253 3300048922 Bacteria 14348
269 Ga0496119_0008611 3300048922 Bacteria 8931
270 Ga0496120_0000711 3300048923 Bacteria 48821
271 Ga0496121_0001067 3300048924 Bacteria 48503
272 Ga0496121_0003088 3300048924 Bacteria 24103
273 Ga0496121_0015350 3300048924 Bacteria 8035
274 Ga0496123_0025517 3300048926 Bacteria 4453
275 Ga0496124_0000189 3300048927 Bacteria 121800
276 Ga0496124_0000484 3300048927 Bacteria 68281
277 Ga0496124_0012993 3300048927 Bacteria 8164
278 Ga0496125_0002268 3300048928 Bacteria 25521
279 Ga0496125_0023410 3300048928 Bacteria 5701
280 Ga0496125_0053036 3300048928 Bacteria 3329
281 Ga0496126_0001217 3300048929 Bacteria 41904
282 Ga0496126_0054287 3300048929 Bacteria 3630
283 Ga0495678_003386 3300049459 Bacteria 9920
284 Ga0495678_015317 3300049459 Bacteria 3533
285 Ga0495678_023277 3300049459 Unclassified 2696
286 Ga0495678_023287 3300049459 Bacteria 2696
287 Ga0495678_029177 3300049459 Bacteria 2319
288 Ga0495682_0000095 3300049460 Bacteria 77918
289 Ga0501034_0000665 3300049571 Bacteria 52406
290 nmdc:mga00v17_11455_c1 3300050491 Bacteria 4873
291 nmdc:mga00v17_73793_c1 3300050491 Bacteria 2119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10011438 Ga0157372_100114387 336
2 3300048922 Ga0496119_0008611 Ga0496119_0008611_4356_5465 337
3 3300031548 Ga0307408_100003953 Ga0307408_1000039534 355
4 3300031911 Ga0307412_10000345 Ga0307412_1000034515 355
5 3300042013 Ga0439456_000154 Ga0439456_000154_9556_10623 355
6 3300046492 Ga0495585_0000356 Ga0495585_0000356_14266_15333 355
7 3300046810 Ga0495660_0000634 Ga0495660_0000634_15984_17051 355
8 3300049459 Ga0495678_003386 Ga0495678_003386_6856_7923 355
9 3300049459 Ga0495678_023277 Ga0495678_023277_1113_2180 355
10 3300046517 Ga0495630_0052899 Ga0495630_0052899_35_1114 358
11 3300046557 Ga0495622_0052309 Ga0495622_0052309_773_1855 358
12 3300046538 Ga0495609_0035550 Ga0495609_0035550_933_2054 359
13 3300048927 Ga0496124_0000189 Ga0496124_0000189_102436_103557 359
14 iso_pu_bacteria 2511231007 2511273023 365
15 iso_pu_bacteria 2511231021 2511359392 365
16 iso_pu_bacteria 2919155634 2919157460 365
17 iso_pu_bacteria 8015687852 8015692095 365
18 iso_pu_bacteria 8056177738 8056179434 365
19 3300049459 Ga0495678_015317 Ga0495678_015317_1837_2967 367
20 iso_pu_bacteria 2608642108 2608669895 367
21 iso_pu_bacteria 2869551831 2869553485 367
22 iso_pu_bacteria 8056172158 8056173237 367
23 3300005288 Ga0065714_10065083 Ga0065714_100650834 368
24 3300005288 Ga0065714_10111645 Ga0065714_101116451 368
25 3300009011 Ga0105251_10004810 Ga0105251_100048105 368
26 3300009036 Ga0105244_10013987 Ga0105244_100139872 368
27 3300009036 Ga0105244_10067529 Ga0105244_100675292 368
28 3300009092 Ga0105250_10001630 Ga0105250_100016306 368
29 3300013100 Ga0157373_10000625 Ga0157373_1000062517 368
30 3300013102 Ga0157371_10001819 Ga0157371_100018192 368
31 3300013105 Ga0157369_10001654 Ga0157369_100016548 368
32 3300014497 Ga0182008_10000912 Ga0182008_100009129 368
33 3300014497 Ga0182008_10002216 Ga0182008_100022165 368
34 3300015261 Ga0182006_1016485 Ga0182006_10164852 368
35 3300025711 Ga0207696_1001711 Ga0207696_10017115 368
36 3300025728 Ga0207655_1032915 Ga0207655_10329152 368
37 3300025728 Ga0207655_1064783 Ga0207655_10647831 368
38 3300025735 Ga0207713_1014592 Ga0207713_10145923 368
39 3300025735 Ga0207713_1017857 Ga0207713_10178574 368
40 3300031911 Ga0307412_10000861 Ga0307412_1000086115 368
41 3300031911 Ga0307412_10005164 Ga0307412_100051645 368
42 3300042006 Ga0439432_001153 Ga0439432_001153_84_1193 368
43 3300042009 Ga0439451_016659 Ga0439451_016659_302_1411 368
44 3300042010 Ga0439452_000168 Ga0439452_000168_43319_44428 368
45 3300042146 Ga0450907_000032 Ga0450907_000032_20310_21419 368
46 3300042156 Ga0439446_0024955 Ga0439446_0024955_107_1216 368
47 3300042435 Ga0439434_0000037 Ga0439434_0000037_9551_10660 368
48 3300042461 Ga0439460_0002250 Ga0439460_0002250_323_1432 368
49 3300046452 Ga0495617_002667 Ga0495617_002667_2007_3116 368
50 3300046452 Ga0495617_004101 Ga0495617_004101_247_1356 368
51 3300046452 Ga0495617_006124 Ga0495617_006124_2593_3702 368
52 3300046458 Ga0495591_000310 Ga0495591_000310_25986_27095 368
53 3300046458 Ga0495591_009382 Ga0495591_009382_1314_2423 368
54 3300046463 Ga0495653_0000475 Ga0495653_0000475_21410_22519 368
55 3300046471 Ga0495650_0004898 Ga0495650_0004898_3988_5097 368
56 3300046471 Ga0495650_0016123 Ga0495650_0016123_334_1443 368
57 3300046474 Ga0495605_0025014 Ga0495605_0025014_1679_2788 368
58 3300046491 Ga0495584_0000210 Ga0495584_0000210_9448_10557 368
59 3300046491 Ga0495584_0006250 Ga0495584_0006250_2820_3932 368
60 3300046491 Ga0495584_0014550 Ga0495584_0014550_2004_3113 368
61 3300046491 Ga0495584_0053782 Ga0495584_0053782_42_1151 368
62 3300046500 Ga0495596_0000075 Ga0495596_0000075_8565_9674 368
63 3300046501 Ga0495607_0000641 Ga0495607_0000641_21089_22198 368
64 3300046501 Ga0495607_0006153 Ga0495607_0006153_4915_6027 368
65 3300046501 Ga0495607_0014263 Ga0495607_0014263_3811_4920 368
66 3300046507 Ga0495606_0028538 Ga0495606_0028538_2679_3788 368
67 3300046512 Ga0495610_0048667 Ga0495610_0048667_781_1890 368
68 3300046515 Ga0495620_0009621 Ga0495620_0009621_501_1610 368
69 3300046517 Ga0495630_0130682 Ga0495630_0130682_560_1669 368
70 3300046518 Ga0495631_0013724 Ga0495631_0013724_652_1761 368
71 3300046519 Ga0495632_0000393 Ga0495632_0000393_32576_33685 368
72 3300046519 Ga0495632_0012786 Ga0495632_0012786_1799_2908 368
73 3300046519 Ga0495632_0061685 Ga0495632_0061685_186_1295 368
74 3300046520 Ga0495637_0000169 Ga0495637_0000169_34933_36042 368
75 3300046520 Ga0495637_0000650 Ga0495637_0000650_19390_20499 368
76 3300046520 Ga0495637_0001625 Ga0495637_0001625_6830_7942 368
77 3300046520 Ga0495637_0006232 Ga0495637_0006232_900_2009 368
78 3300046520 Ga0495637_0014318 Ga0495637_0014318_689_1798 368
79 3300046523 Ga0495644_0012033 Ga0495644_0012033_1734_2843 368
80 3300046524 Ga0495648_0018755 Ga0495648_0018755_2852_3964 368
81 3300046530 Ga0495654_0000471 Ga0495654_0000471_27323_28432 368
82 3300046530 Ga0495654_0019148 Ga0495654_0019148_141_1250 368
83 3300046538 Ga0495609_0000446 Ga0495609_0000446_26588_27697 368
84 3300046542 Ga0495597_0000450 Ga0495597_0000450_29160_30269 368
85 3300046557 Ga0495622_0012613 Ga0495622_0012613_671_1780 368
86 3300046616 Ga0495668_0000195 Ga0495668_0000195_60841_61950 368
87 3300046660 Ga0495625_0001044 Ga0495625_0001044_16871_17980 368
88 3300046660 Ga0495625_0055841 Ga0495625_0055841_1591_2700 368
89 3300046665 Ga0495661_0000649 Ga0495661_0000649_788_1900 368
90 3300046665 Ga0495661_0001560 Ga0495661_0001560_8583_9692 368
91 3300046665 Ga0495661_0003385 Ga0495661_0003385_10495_11604 368
92 3300046665 Ga0495661_0056499 Ga0495661_0056499_339_1448 368
93 3300046691 Ga0495670_0025937 Ga0495670_0025937_1096_2205 368
94 3300046692 Ga0495671_0027788 Ga0495671_0027788_1159_2268 368
95 3300046692 Ga0495671_0044294 Ga0495671_0044294_790_1899 368
96 3300046692 Ga0495671_0074639 Ga0495671_0074639_135_1244 368
97 3300046694 Ga0495649_0052286 Ga0495649_0052286_907_2016 368
98 3300046794 Ga0495589_0015130 Ga0495589_0015130_183_1292 368
99 3300046809 Ga0495600_0033597 Ga0495600_0033597_1369_2478 368
100 3300046810 Ga0495660_0002425 Ga0495660_0002425_4717_5826 368
101 3300046810 Ga0495660_0003481 Ga0495660_0003481_2055_3164 368
102 3300047320 Ga0495672_0000695 Ga0495672_0000695_26832_27941 368
103 3300047320 Ga0495672_0013411 Ga0495672_0013411_3333_4442 368
104 3300047322 Ga0495680_0012786 Ga0495680_0012786_74_1183 368
105 3300047323 Ga0495683_0000825 Ga0495683_0000825_15224_16333 368
106 3300047323 Ga0495683_0001022 Ga0495683_0001022_10947_12056 368
107 3300047323 Ga0495683_0004394 Ga0495683_0004394_3837_4946 368
108 3300047469 Ga0495673_0029931 Ga0495673_0029931_614_1723 368
109 3300047470 Ga0495681_0000125 Ga0495681_0000125_26707_27816 368
110 3300047470 Ga0495681_0000196 Ga0495681_0000196_8537_9646 368
111 3300047470 Ga0495681_0001986 Ga0495681_0001986_12758_13867 368
112 3300047470 Ga0495681_0005471 Ga0495681_0005471_1772_2881 368
113 3300047470 Ga0495681_0007647 Ga0495681_0007647_2352_3461 368
114 3300047472 Ga0495686_0115359 Ga0495686_0115359_86_1195 368
115 3300048091 Ga0495626_0000323 Ga0495626_0000323_16365_17474 368
116 3300048920 Ga0496117_0001742 Ga0496117_0001742_20188_21297 368
117 3300048921 Ga0496118_0002049 Ga0496118_0002049_7179_8288 368
118 3300049459 Ga0495678_023287 Ga0495678_023287_1165_2277 368
119 3300049571 Ga0501034_0000665 Ga0501034_0000665_44548_45657 368
120 3300050491 nmdc:mga00v17_11455_c1 nmdc:mga00v17_11455_c1_3098_4204 368
121 iso_pu_bacteria 2599185307 2599974568 368
122 iso_pu_bacteria 2728369097 2729148701 368
123 iso_pu_bacteria 2738541271 2738691095 368
124 iso_pu_bacteria 2738543016 2739266768 368
125 iso_pu_bacteria 2842832357 2842836553 368
126 3300003320 rootH2_10233728 rootH2_102337282 369
127 3300013104 Ga0157370_10008848 Ga0157370_100088489 369
128 3300013105 Ga0157369_10170876 Ga0157369_101708762 369
129 3300013306 Ga0163162_10012657 Ga0163162_100126572 369
130 3300013306 Ga0163162_10074991 Ga0163162_100749912 369
131 3300014497 Ga0182008_10058556 Ga0182008_100585562 369
132 3300017792 Ga0163161_10006386 Ga0163161_100063866 369
133 3300042010 Ga0439452_000154 Ga0439452_000154_33344_34453 369
134 3300042013 Ga0439456_000727 Ga0439456_000727_1786_2895 369
135 3300046458 Ga0495591_000441 Ga0495591_000441_15652_16764 369
136 3300046474 Ga0495605_0000518 Ga0495605_0000518_19042_20151 369
137 3300046491 Ga0495584_0000446 Ga0495584_0000446_15134_16243 369
138 3300046506 Ga0495583_0003423 Ga0495583_0003423_931_2040 369
139 3300046522 Ga0495643_0109207 Ga0495643_0109207_263_1372 369
140 3300046530 Ga0495654_0003756 Ga0495654_0003756_526_1638 369
141 3300046557 Ga0495622_0029032 Ga0495622_0029032_741_1853 369
142 3300046691 Ga0495670_0001309 Ga0495670_0001309_5753_6865 369
143 3300046692 Ga0495671_0003439 Ga0495671_0003439_1195_2307 369
144 3300048928 Ga0496125_0023410 Ga0496125_0023410_573_1685 369
145 iso_pu_bacteria 2599185257 2599804061 369
146 iso_pu_bacteria 2671180172 2671770371 369
147 iso_pu_bacteria 2713897148 2715751261 369
148 iso_pu_bacteria 2842843487 2842844666 369
149 iso_pu_bacteria 2919487758 2919489783 369
150 iso_pu_bacteria 2984286254 2984288174 369
151 iso_pu_bacteria 8015394850 8015397721 369
152 3300005548 Ga0070665_100172505 Ga0070665_1001725052 370
153 3300009011 Ga0105251_10001437 Ga0105251_100014372 370
154 3300009174 Ga0105241_10000005 Ga0105241_1000000512 370
155 3300013100 Ga0157373_10015923 Ga0157373_100159235 370
156 3300013102 Ga0157371_10014898 Ga0157371_100148985 370
157 3300013102 Ga0157371_10038562 Ga0157371_100385622 370
158 3300013105 Ga0157369_10478186 Ga0157369_104781861 370
159 3300025711 Ga0207696_1004745 Ga0207696_10047456 370
160 3300025711 Ga0207696_1005418 Ga0207696_10054185 370
161 3300025728 Ga0207655_1013512 Ga0207655_10135125 370
162 3300025728 Ga0207655_1015237 Ga0207655_10152374 370
163 3300025735 Ga0207713_1000026 Ga0207713_10000262 370
164 3300025911 Ga0207654_10000007 Ga0207654_10000007381 370
165 3300025972 Ga0207668_10018611 Ga0207668_100186113 370
166 3300028379 Ga0268266_10038753 Ga0268266_100387533 370
167 3300030500 Ga0268256_1000815 Ga0268256_100081515 370
168 3300041405 Ga0439438_000002 Ga0439438_000002_162523_163638 370
169 3300041411 Ga0439466_0000001 Ga0439466_0000001_200468_201583 370
170 3300042006 Ga0439432_000295 Ga0439432_000295_3279_4394 370
171 3300046474 Ga0495605_0000334 Ga0495605_0000334_38877_39992 370
172 3300046501 Ga0495607_0000195 Ga0495607_0000195_52929_54044 370
173 3300046501 Ga0495607_0084556 Ga0495607_0084556_609_1724 370
174 3300046506 Ga0495583_0000914 Ga0495583_0000914_26814_27929 370
175 3300046524 Ga0495648_0060880 Ga0495648_0060880_832_1947 370
176 3300046810 Ga0495660_0019113 Ga0495660_0019113_1472_2587 370
177 3300047320 Ga0495672_0000015 Ga0495672_0000015_457726_458841 370
178 3300047446 Ga0495679_015920 Ga0495679_015920_721_1836 370
179 3300048908 Ga0496105_0082044 Ga0496105_0082044_405_1520 370
180 3300048909 Ga0496106_0000058 Ga0496106_0000058_46257_47369 370
181 3300048919 Ga0496116_0010613 Ga0496116_0010613_6433_7548 370
182 3300048919 Ga0496116_0026556 Ga0496116_0026556_20_1135 370
183 3300048919 Ga0496116_0112216 Ga0496116_0112216_228_1343 370
184 3300048920 Ga0496117_0016308 Ga0496117_0016308_128_1243 370
185 3300048920 Ga0496117_0034615 Ga0496117_0034615_214_1329 370
186 3300048921 Ga0496118_0012786 Ga0496118_0012786_6771_7886 370
187 3300048922 Ga0496119_0004253 Ga0496119_0004253_2414_3529 370
188 3300048923 Ga0496120_0000711 Ga0496120_0000711_36822_37937 370
189 3300048924 Ga0496121_0001067 Ga0496121_0001067_6097_7209 370
190 3300048926 Ga0496123_0025517 Ga0496123_0025517_925_2040 370
191 3300048927 Ga0496124_0000484 Ga0496124_0000484_52507_53622 370
192 3300048928 Ga0496125_0053036 Ga0496125_0053036_1446_2561 370
193 3300048929 Ga0496126_0054287 Ga0496126_0054287_926_2041 370
194 3300049459 Ga0495678_029177 Ga0495678_029177_269_1384 370
195 3300009011 Ga0105251_10000011 Ga0105251_1000001124 371
196 3300009036 Ga0105244_10000665 Ga0105244_1000066517 371
197 3300009036 Ga0105244_10029314 Ga0105244_100293142 371
198 3300009092 Ga0105250_10014274 Ga0105250_100142742 371
199 3300013100 Ga0157373_10099305 Ga0157373_100993052 371
200 3300013104 Ga0157370_10001663 Ga0157370_1000166312 371
201 3300013105 Ga0157369_10007046 Ga0157369_100070467 371
202 3300013105 Ga0157369_10135114 Ga0157369_101351142 371
203 3300025728 Ga0207655_1001324 Ga0207655_100132412 371
204 3300025735 Ga0207713_1000073 Ga0207713_100007324 371
205 3300041407 Ga0439447_000084 Ga0439447_000084_20233_21351 371
206 3300042004 Ga0439445_0003111 Ga0439445_0003111_413_1531 371
207 3300042016 Ga0439463_000990 Ga0439463_000990_1926_3047 371
208 3300042139 Ga0450904_000187 Ga0450904_000187_1915_3033 371
209 3300044656 Ga0466969_0010939 Ga0466969_0010939_2936_4051 371
210 3300044684 Ga0466966_0108733 Ga0466966_0108733_99_1214 371
211 3300044693 Ga0466961_0151564 Ga0466961_0151564_195_1310 371
212 3300044765 Ga0466970_0112508 Ga0466970_0112508_262_1377 371
213 3300045049 Ga0466959_0016579 Ga0466959_0016579_273_1388 371
214 3300046453 Ga0495627_010274 Ga0495627_010274_1063_2184 371
215 3300046458 Ga0495591_000210 Ga0495591_000210_21143_22261 371
216 3300046458 Ga0495591_000449 Ga0495591_000449_10836_11957 371
217 3300046471 Ga0495650_0000389 Ga0495650_0000389_61695_62930 371
218 3300046474 Ga0495605_0000214 Ga0495605_0000214_41130_42251 371
219 3300046474 Ga0495605_0026037 Ga0495605_0026037_644_1765 371
220 3300046501 Ga0495607_0040600 Ga0495607_0040600_236_1357 371
221 3300046501 Ga0495607_0051362 Ga0495607_0051362_715_1836 371
222 3300046501 Ga0495607_0093800 Ga0495607_0093800_264_1385 371
223 3300046506 Ga0495583_0002085 Ga0495583_0002085_7675_8889 371
224 3300046507 Ga0495606_0000240 Ga0495606_0000240_54013_55191 371
225 3300046513 Ga0495616_0005450 Ga0495616_0005450_1482_2717 371
226 3300046515 Ga0495620_0022651 Ga0495620_0022651_1602_2837 371
227 3300046519 Ga0495632_0012408 Ga0495632_0012408_2899_4134 371
228 3300046520 Ga0495637_0019627 Ga0495637_0019627_348_1469 371
229 3300046524 Ga0495648_0000523 Ga0495648_0000523_38929_40164 371
230 3300046524 Ga0495648_0000600 Ga0495648_0000600_17128_18246 371
231 3300046530 Ga0495654_0000215 Ga0495654_0000215_1023_2258 371
232 3300046538 Ga0495609_0000285 Ga0495609_0000285_8731_9852 371
233 3300046557 Ga0495622_0006907 Ga0495622_0006907_2043_3164 371
234 3300046616 Ga0495668_0037060 Ga0495668_0037060_696_1817 371
235 3300046660 Ga0495625_0000184 Ga0495625_0000184_51984_53219 371
236 3300046692 Ga0495671_0001297 Ga0495671_0001297_777_1898 371
237 3300046694 Ga0495649_0000248 Ga0495649_0000248_46131_47252 371
238 3300046810 Ga0495660_0002845 Ga0495660_0002845_9575_10810 371
239 3300047320 Ga0495672_0012401 Ga0495672_0012401_240_1361 371
240 3300047321 Ga0495676_0000021 Ga0495676_0000021_120344_121465 371
241 3300047446 Ga0495679_015655 Ga0495679_015655_327_1448 371
242 3300047469 Ga0495673_0000437 Ga0495673_0000437_821_2056 371
243 3300047469 Ga0495673_0005586 Ga0495673_0005586_2180_3301 371
244 3300047469 Ga0495673_0008886 Ga0495673_0008886_1256_2377 371
245 3300048903 Ga0496100_0065528 Ga0496100_0065528_1165_2280 371
246 3300048927 Ga0496124_0012993 Ga0496124_0012993_1958_3079 371
247 2162886007 SwRhRL2b_contig_1747262 SwRhRL2b_0810.00005410 372
248 3300005289 Ga0065704_10000395 Ga0065704_1000039519 372
249 3300006051 Ga0075364_10078697 Ga0075364_100786972 372
250 3300006946 Ga0079104_1000592 Ga0079104_100059222 372
251 3300009011 Ga0105251_10001634 Ga0105251_100016342 372
252 3300013102 Ga0157371_10000490 Ga0157371_1000049019 372
253 3300013307 Ga0157372_10047277 Ga0157372_100472771 372
254 3300014497 Ga0182008_10001622 Ga0182008_100016227 372
255 3300025735 Ga0207713_1000024 Ga0207713_1000024325 372
256 3300027111 Ga0209281_1000667 Ga0209281_100066713 372
257 3300041405 Ga0439438_001039 Ga0439438_001039_1963_3084 372
258 3300042530 Ga0450916_001187 Ga0450916_001187_1364_2518 372
259 3300046453 Ga0495627_007177 Ga0495627_007177_791_1936 372
260 3300046458 Ga0495591_000180 Ga0495591_000180_13911_15041 372
261 3300046460 Ga0495638_0011627 Ga0495638_0011627_3915_5060 372
262 3300046460 Ga0495638_0033702 Ga0495638_0033702_957_2087 372
263 3300046471 Ga0495650_0000454 Ga0495650_0000454_63471_64601 372
264 3300046492 Ga0495585_0000337 Ga0495585_0000337_34798_35931 372
265 3300046492 Ga0495585_0012256 Ga0495585_0012256_992_2137 372
266 3300046500 Ga0495596_0000198 Ga0495596_0000198_28015_29154 372
267 3300046501 Ga0495607_0098371 Ga0495607_0098371_192_1337 372
268 3300046506 Ga0495583_0000214 Ga0495583_0000214_8318_9466 372
269 3300046506 Ga0495583_0000553 Ga0495583_0000553_2831_3961 372
270 3300046506 Ga0495583_0032749 Ga0495583_0032749_893_2038 372
271 3300046507 Ga0495606_0016080 Ga0495606_0016080_38_1183 372
272 3300046518 Ga0495631_0008004 Ga0495631_0008004_3696_4841 372
273 3300046518 Ga0495631_0012584 Ga0495631_0012584_1399_2544 372
274 3300046519 Ga0495632_0000110 Ga0495632_0000110_16689_17819 372
275 3300046520 Ga0495637_0000550 Ga0495637_0000550_2507_3634 372
276 3300046520 Ga0495637_0004155 Ga0495637_0004155_5588_6718 372
277 3300046522 Ga0495643_0087650 Ga0495643_0087650_390_1535 372
278 3300046523 Ga0495644_0008176 Ga0495644_0008176_2756_3901 372
279 3300046524 Ga0495648_0001552 Ga0495648_0001552_6141_7271 372
280 3300046526 Ga0495666_0012628 Ga0495666_0012628_2162_3289 372
281 3300046528 Ga0495642_0007438 Ga0495642_0007438_2620_3765 372
282 3300046530 Ga0495654_0000267 Ga0495654_0000267_29754_30878 372
283 3300046542 Ga0495597_0015262 Ga0495597_0015262_1721_2866 372
284 3300046558 Ga0495633_0018472 Ga0495633_0018472_520_1659 372
285 3300046615 Ga0495656_0014732 Ga0495656_0014732_449_1594 372
286 3300046616 Ga0495668_0007056 Ga0495668_0007056_5084_6229 372
287 3300046665 Ga0495661_0004690 Ga0495661_0004690_463_1593 372
288 3300046665 Ga0495661_0038063 Ga0495661_0038063_476_1621 372
289 3300046674 Ga0495588_0006469 Ga0495588_0006469_441_1586 372
290 3300046680 Ga0495646_0027997 Ga0495646_0027997_2046_3173 372
291 3300046684 Ga0495669_0000554 Ga0495669_0000554_9391_10530 372
292 3300046794 Ga0495589_0096015 Ga0495589_0096015_235_1380 372
293 3300046810 Ga0495660_0002649 Ga0495660_0002649_5622_6752 372
294 3300047318 Ga0495636_0033044 Ga0495636_0033044_590_1738 372
295 3300047321 Ga0495676_0000567 Ga0495676_0000567_24453_25583 372
296 3300047323 Ga0495683_0009945 Ga0495683_0009945_3564_4709 372
297 3300047444 Ga0495675_0031612 Ga0495675_0031612_1598_2725 372
298 3300047445 Ga0495677_0005696 Ga0495677_0005696_2317_3462 372
299 3300047447 Ga0495685_003615 Ga0495685_003615_138_1277 372
300 3300047470 Ga0495681_0002648 Ga0495681_0002648_5398_6528 372
301 3300047470 Ga0495681_0013936 Ga0495681_0013936_620_1765 372
302 3300048905 Ga0496102_0000107 Ga0496102_0000107_62277_63425 372
303 3300048910 Ga0496107_0075711 Ga0496107_0075711_1238_2383 372
304 3300048920 Ga0496117_0002190 Ga0496117_0002190_22073_23191 372
305 3300048921 Ga0496118_0002580 Ga0496118_0002580_20635_21753 372
306 3300048924 Ga0496121_0003088 Ga0496121_0003088_20635_21753 372
307 3300048924 Ga0496121_0015350 Ga0496121_0015350_4378_5523 372
308 3300048928 Ga0496125_0002268 Ga0496125_0002268_21856_22974 372
309 3300048929 Ga0496126_0001217 Ga0496126_0001217_6240_7385 372
310 3300049460 Ga0495682_0000095 Ga0495682_0000095_29588_30712 372
311 3300050491 nmdc:mga00v17_73793_c1 nmdc:mga00v17_73793_c1_735_1865 372

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

180

344

0.95

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

193

330

0.91

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

16

170

0.9

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

15

175

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8346 196 349
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.8158 170 352
4xsp-assembly1.cif.gz_A crystal structure of anabaena alr3699/hepe in complex with udp 0.8146 1 366
3c4q-assembly1.cif.gz_A structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp 0.8124 1 370
3c4q-assembly2.cif.gz_B structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp 0.81 1 370
ID Description Score Start End Superfamily
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9376 195 349 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9145 195 349 3.40.50.2000
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9065 198 349 3.40.50.2000
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8965 192 346 3.40.50.2000
af_Q84QB1_230_385_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8917 192 348 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2X3EGQ9-F1-model_v4 deleted 0.9665 135 368
AF-A0A318JJW7-F1-model_v4 Glycosyl transferase family 1 0.9595 114 369 GO:0016757
AF-A0A7A9WEV0-F1-model_v4 N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans, octacis-undecaprenol 3-alpha-mannosyltransferase WbdC 0.9579 71 372 GO:0016757
AF-A0A2S1JTZ9-F1-model_v4 Glycosyl transferase family 1 0.9554 37 369 GO:0016757
AF-A0A7A9WEV0-F1-model_v4 N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans, octacis-undecaprenol 3-alpha-mannosyltransferase WbdC 0.9548 71 372 GO:0016757

Feature Viewer

pLDDT pTM Quality
88.65 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map