F401287

General Info

Members Datasets Scaffolds Average Seq Length
311 216 622 177

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_101171476|Ga0307409_1011714762
Length 170
Sequence MSVEVAADAATRGPEPSPIALTVNGETHVVALEPRVSLLDALREHLQLTGSKKGCDQGTCGACTVWVDGRRVLACLTLAAACEGHEVTTIEGLAAADGELHPMQQAFIDHDAFQCGYCTSGQIMSAVKLLEEGNAATDEEIAEYMSGNICRCAAYPNIRAAIREVRDAAA

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
156 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0.96
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 9.65
Rhizosphere 88.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_101171476 3300031995 Bacteria 791
2 JGI25160J50197_1003429 3300003354 Bacteria 7101
3 JGI25407J50210_10043879 3300003373 Bacteria 1142
4 Ga0070658_10133516 3300005327 Bacteria 2070
5 Ga0070658_10336557 3300005327 Bacteria 1290
6 Ga0070658_10643178 3300005327 Bacteria 920
7 Ga0070683_100015207 3300005329 Bacteria 6756
8 Ga0070683_100127012 3300005329 Bacteria 2411
9 Ga0070670_100053255 3300005331 Bacteria 3475
10 Ga0070680_100295538 3300005336 Bacteria 1373
11 Ga0070682_100284013 3300005337 Bacteria 1207
12 Ga0068868_100329895 3300005338 Bacteria 1302
13 Ga0070660_101215617 3300005339 Bacteria 639
14 Ga0070689_100203766 3300005340 Bacteria 1616
15 Ga0070687_100383999 3300005343 Bacteria 916
16 Ga0070661_100078900 3300005344 Bacteria 2429
17 Ga0070661_100248401 3300005344 Bacteria 1372
18 Ga0070668_100302775 3300005347 Bacteria 1341
19 Ga0070674_100207800 3300005356 Bacteria 1516
20 Ga0070688_100010385 3300005365 Bacteria 5133
21 Ga0070688_100351823 3300005365 Bacteria 1079
22 Ga0070659_100049213 3300005366 Bacteria 3314
23 Ga0070659_100284061 3300005366 Bacteria 1377
24 Ga0070659_100475981 3300005366 Bacteria 1062
25 Ga0070667_100667762 3300005367 Bacteria 960
26 Ga0070703_10084108 3300005406 Bacteria 1090
27 Ga0070709_10004471 3300005434 Bacteria 7542
28 Ga0070709_10079979 3300005434 Bacteria 2130
29 Ga0070714_100012040 3300005435 Bacteria 6885
30 Ga0070714_100054687 3300005435 Bacteria 3410
31 Ga0070714_100200832 3300005435 Bacteria 1824
32 Ga0070713_100029959 3300005436 Bacteria 4316
33 Ga0070713_100097512 3300005436 Bacteria 2540
34 Ga0070713_100135887 3300005436 Bacteria 2172
35 Ga0070710_10018293 3300005437 Bacteria 3603
36 Ga0070710_10042241 3300005437 Bacteria 2520
37 Ga0070710_10149952 3300005437 Bacteria 1437
38 Ga0070711_100217717 3300005439 Bacteria 1482
39 Ga0070711_100274476 3300005439 Bacteria 1331
40 Ga0070711_100405279 3300005439 Bacteria 1108
41 Ga0070705_100057961 3300005440 Bacteria 2287
42 Ga0070705_100208341 3300005440 Bacteria 1346
43 Ga0070694_100052906 3300005444 Bacteria 2746
44 Ga0070708_100000483 3300005445 Bacteria 30274
45 Ga0070708_100671644 3300005445 Bacteria 976
46 Ga0070662_100117159 3300005457 Bacteria 2037
47 Ga0070681_10371828 3300005458 Bacteria 1340
48 Ga0070681_10881638 3300005458 Bacteria 813
49 Ga0068867_100211563 3300005459 Bacteria 1558
50 Ga0070685_10004995 3300005466 Bacteria 6716
51 Ga0070706_100092953 3300005467 Bacteria 2798
52 Ga0070706_100584111 3300005467 Bacteria 1038
53 Ga0070707_100183597 3300005468 Bacteria 2039
54 Ga0070699_100000935 3300005518 Bacteria 27244
55 Ga0070679_100810217 3300005530 Bacteria 879
56 Ga0070684_100002525 3300005535 Bacteria 13499
57 Ga0070684_100123791 3300005535 Bacteria 2327
58 Ga0070684_100135273 3300005535 Bacteria 2226
59 Ga0070697_101135422 3300005536 Bacteria 696
60 Ga0068853_100164970 3300005539 Bacteria 2001
61 Ga0070686_100016190 3300005544 Bacteria 4335
62 Ga0070686_100361541 3300005544 Bacteria 1093
63 Ga0070664_100007490 3300005564 Bacteria 8813
64 Ga0070664_100086852 3300005564 Bacteria 2703
65 Ga0068857_100075017 3300005577 Bacteria 3015
66 Ga0068854_100269393 3300005578 Bacteria 1367
67 Ga0068854_100328242 3300005578 Bacteria 1246
68 Ga0068856_100536773 3300005614 Bacteria 1191
69 Ga0070702_100003054 3300005615 Bacteria 7405
70 Ga0068852_100132775 3300005616 Bacteria 2295
71 Ga0068852_100737659 3300005616 Bacteria 997
72 Ga0068852_101436960 3300005616 Bacteria 712
73 Ga0068859_100004199 3300005617 Bacteria 14704
74 Ga0068864_100028977 3300005618 Bacteria 4684
75 Ga0068864_100115122 3300005618 Bacteria 2398
76 Ga0068866_10252545 3300005718 Bacteria 1080
77 Ga0068861_100019182 3300005719 Bacteria 4885
78 Ga0068861_100248162 3300005719 Bacteria 1517
79 Ga0068851_10244201 3300005834 Bacteria 1016
80 Ga0068863_100201522 3300005841 Bacteria 1915
81 Ga0068863_100412110 3300005841 Bacteria 1323
82 Ga0068858_100958514 3300005842 Bacteria 838
83 Ga0068860_101068874 3300005843 Bacteria 826
84 Ga0068862_100412889 3300005844 Bacteria 1265
85 Ga0068862_100502787 3300005844 Bacteria 1151
86 Ga0081455_10007348 3300005937 Bacteria 11617
87 Ga0081538_10000592 3300005981 Bacteria 40148
88 Ga0081538_10062350 3300005981 Bacteria 2127
89 Ga0070717_10024760 3300006028 Bacteria 4769
90 Ga0070717_10057723 3300006028 Bacteria 3208
91 Ga0070717_10111286 3300006028 Bacteria 2336
92 Ga0070717_10501961 3300006028 Bacteria 1096
93 Ga0070715_10111575 3300006163 Bacteria 1290
94 Ga0070715_10234459 3300006163 Bacteria 951
95 Ga0070716_100032124 3300006173 Bacteria 2860
96 Ga0070716_100227294 3300006173 Bacteria 1257
97 Ga0070712_100024621 3300006175 Bacteria 3991
98 Ga0070712_100044886 3300006175 Bacteria 3049
99 Ga0097621_100416447 3300006237 Bacteria 1205
100 Ga0068871_100142855 3300006358 Bacteria 2036
101 Ga0075434_100134905 3300006871 Bacteria 2488
102 Ga0075434_101043759 3300006871 Bacteria 831
103 Ga0068865_100094590 3300006881 Bacteria 2175
104 Ga0097620_100004199 3300006931 Bacteria 14704
105 Ga0099795_10311987 3300007788 Bacteria 694
106 Ga0111539_10820898 3300009094 Bacteria 1082
107 Ga0105245_10007683 3300009098 Bacteria 9443
108 Ga0105243_10006719 3300009148 Bacteria 8874
109 Ga0105242_10036956 3300009176 Bacteria 3921
110 Ga0105248_10048210 3300009177 Bacteria 4778
111 Ga0105248_10134626 3300009177 Bacteria 2788
112 Ga0105238_10209154 3300009551 Bacteria 1927
113 Ga0105239_10151109 3300010375 Bacteria 2591
114 Ga0105239_10160270 3300010375 Bacteria 2513
115 Ga0105239_11419889 3300010375 Bacteria 801
116 Ga0157373_10237893 3300013100 Bacteria 1287
117 Ga0157369_10349872 3300013105 Bacteria 1535
118 Ga0157369_11591150 3300013105 Bacteria 664
119 Ga0157378_10257546 3300013297 Bacteria 1673
120 Ga0163162_10096453 3300013306 Bacteria 3045
121 Ga0157372_10246077 3300013307 Bacteria 2075
122 Ga0157375_10043721 3300013308 Bacteria 4347
123 Ga0157375_10604313 3300013308 Bacteria 1256
124 Ga0163163_10003036 3300014325 Bacteria 14219
125 Ga0157380_10318656 3300014326 Bacteria 1440
126 Ga0157377_10140732 3300014745 Bacteria 1483
127 Ga0157379_10120045 3300014968 Bacteria 2364
128 Ga0197907_11480796 3300020069 Bacteria 566
129 Ga0206356_11381172 3300020070 Bacteria 1400
130 Ga0206351_10665610 3300020077 Bacteria 656
131 Ga0207426_1000648 3300025302 Bacteria 43021
132 Ga0207426_1001452 3300025302 Bacteria 19602
133 Ga0207692_10029246 3300025898 Bacteria 2616
134 Ga0207692_10165117 3300025898 Bacteria 1279
135 Ga0207692_10298780 3300025898 Bacteria 979
136 Ga0207688_10067384 3300025901 Bacteria 2025
137 Ga0207685_10186320 3300025905 Bacteria 965
138 Ga0207699_10018591 3300025906 Bacteria 3685
139 Ga0207699_10984640 3300025906 Bacteria 623
140 Ga0207705_10026285 3300025909 Bacteria 4152
141 Ga0207705_10253637 3300025909 Bacteria 1342
142 Ga0207705_10850168 3300025909 Bacteria 707
143 Ga0207684_10095383 3300025910 Bacteria 2538
144 Ga0207684_10302689 3300025910 Bacteria 1378
145 Ga0207693_10380066 3300025915 Bacteria 1105
146 Ga0207663_10552513 3300025916 Bacteria 900
147 Ga0207663_10616040 3300025916 Bacteria 854
148 Ga0207663_10618958 3300025916 Bacteria 852
149 Ga0207660_10457747 3300025917 Bacteria 1032
150 Ga0207662_10268563 3300025918 Bacteria 1125
151 Ga0207657_10174980 3300025919 Bacteria 1737
152 Ga0207649_10118419 3300025920 Bacteria 1782
153 Ga0207646_10005908 3300025922 Bacteria 12777
154 Ga0207687_10144787 3300025927 Bacteria 1807
155 Ga0207687_10693875 3300025927 Bacteria 864
156 Ga0207700_10010168 3300025928 Bacteria 5920
157 Ga0207700_10040051 3300025928 Bacteria 3417
158 Ga0207700_10465606 3300025928 Bacteria 1116
159 Ga0207700_11745339 3300025928 Bacteria 548
160 Ga0207664_10003388 3300025929 Bacteria 10606
161 Ga0207664_10115690 3300025929 Bacteria 2236
162 Ga0207664_10652176 3300025929 Bacteria 946
163 Ga0207690_10058084 3300025932 Bacteria 2615
164 Ga0207706_10061694 3300025933 Bacteria 3301
165 Ga0207686_10552314 3300025934 Bacteria 900
166 Ga0207709_10009526 3300025935 Bacteria 5344
167 Ga0207670_10067605 3300025936 Bacteria 2459
168 Ga0207669_10156136 3300025937 Bacteria 1605
169 Ga0207669_10717900 3300025937 Bacteria 823
170 Ga0207704_10088860 3300025938 Bacteria 2023
171 Ga0207665_10031002 3300025939 Bacteria 3537
172 Ga0207711_10128305 3300025941 Bacteria 2271
173 Ga0207711_10457857 3300025941 Bacteria 1188
174 Ga0207661_10018965 3300025944 Bacteria 5119
175 Ga0207661_10195972 3300025944 Bacteria 1773
176 Ga0207679_10007652 3300025945 Bacteria 6862
177 Ga0207668_10206804 3300025972 Bacteria 1567
178 Ga0207677_10053972 3300026023 Bacteria 2739
179 Ga0207703_10226570 3300026035 Bacteria 1674
180 Ga0207639_10258437 3300026041 Bacteria 1522
181 Ga0207678_10113385 3300026067 Bacteria 2313
182 Ga0207708_10010187 3300026075 Bacteria 6980
183 Ga0207702_10405384 3300026078 Bacteria 1316
184 Ga0207702_10464847 3300026078 Bacteria 1229
185 Ga0207641_10329715 3300026088 Bacteria 1449
186 Ga0207648_10100324 3300026089 Bacteria 2536
187 Ga0207676_10031427 3300026095 Bacteria 3994
188 Ga0207676_10033302 3300026095 Bacteria 3892
189 Ga0207676_10040557 3300026095 Bacteria 3568
190 Ga0207674_10013941 3300026116 Bacteria 8891
191 Ga0207675_100019398 3300026118 Bacteria 6344
192 Ga0207683_10219832 3300026121 Bacteria 1731
193 Ga0207698_10082781 3300026142 Bacteria 2595
194 Ga0268265_10039918 3300028380 Bacteria 3463
195 Ga0268264_10493523 3300028381 Bacteria 1193
196 Ga0307405_10287447 3300031731 Bacteria 1241
197 Ga0307410_10151130 3300031852 Bacteria 1729
198 Ga0307410_11240837 3300031852 Bacteria 650
199 Ga0373926_0000093 3300035083 Bacteria 17364
200 Ga0373934_0008444 3300035086 Bacteria 3839
201 Ga0373934_0202575 3300035086 Bacteria 817
202 Ga0373944_0001310 3300035089 Bacteria 6259
203 Ga0373923_0012716 3300035111 Bacteria 3120
204 Ga0373939_0216601 3300035114 Bacteria 731
205 Ga0373945_0000121 3300035116 Bacteria 19191
206 Ga0373953_0000776 3300035117 Bacteria 8898
207 Ga0373954_0020540 3300035118 Bacteria 2988
208 Ga0373956_0002074 3300035119 Bacteria 8311
209 Ga0373957_0016075 3300035120 Bacteria 2586
210 Ga0373943_0000454 3300035170 Bacteria 17387
211 Ga0373946_0011902 3300035171 Bacteria 3250
212 Ga0373955_0059676 3300035172 Bacteria 2101
213 Ga0373924_0000648 3300035410 Bacteria 10820
214 Ga0373935_0000226 3300035692 Bacteria 27564
215 Ga0373927_0002823 3300035695 Bacteria 12675
216 Ga0373947_0016021 3300035725 Bacteria 4307
217 Ga0373925_0005544 3300037068 Bacteria 9398
218 Ga0373925_0347112 3300037068 Bacteria 1204
219 Ga0395900_0008117 3300037418 Bacteria 10810
220 Ga0395900_1203069 3300037418 Bacteria 673
221 Ga0395898_0522218 3300037466 Bacteria 1129
222 Ga0395898_0781775 3300037466 Bacteria 895
223 Ga0395905_0678425 3300037471 Bacteria 933
224 Ga0436363_0031311 3300039450 Bacteria 1157
225 Ga0436363_0559267 3300039450 Bacteria 1955
226 Ga0439450_036441 3300042008 Bacteria 1126
227 Ga0439463_017840 3300042016 Bacteria 1763
228 Ga0439463_156988 3300042016 Bacteria 590
229 Ga0439458_0019547 3300042157 Bacteria 1560
230 Ga0439440_0010228 3300042993 Bacteria 1957
231 Ga0466963_0035622 3300044694 Bacteria 3243
232 Ga0466963_0467693 3300044694 Bacteria 890
233 Ga0466968_0241249 3300044735 Bacteria 856
234 Ga0466960_0399645 3300044901 Bacteria 791
235 Ga0466967_0753874 3300045976 Bacteria 966
236 Ga0466967_0941650 3300045976 Bacteria 859
237 Ga0495603_0000297 3300046455 Bacteria 26417
238 Ga0495629_0203465 3300046459 Bacteria 1368
239 Ga0495641_0004093 3300046461 Bacteria 10519
240 Ga0495651_0007411 3300046462 Bacteria 8390
241 Ga0495653_0009339 3300046463 Bacteria 8020
242 Ga0495582_0001696 3300046473 Bacteria 12427
243 Ga0495639_0000194 3300046475 Bacteria 31899
244 Ga0495662_0003867 3300046476 Bacteria 7556
245 Ga0495594_0003982 3300046499 Bacteria 7596
246 Ga0495594_0296943 3300046499 Bacteria 920
247 Ga0495618_0030414 3300046514 Bacteria 3372
248 Ga0495630_0011838 3300046517 Bacteria 6321
249 Ga0495666_0005710 3300046526 Bacteria 6271
250 Ga0495665_0000344 3300046531 Bacteria 23510
251 Ga0495640_0000875 3300046533 Bacteria 23101
252 Ga0495586_0025025 3300046535 Bacteria 3193
253 Ga0495587_0373464 3300046536 Bacteria 793
254 Ga0495645_0005068 3300046543 Bacteria 9026
255 Ga0495622_0053470 3300046557 Bacteria 1874
256 Ga0495667_0018406 3300046559 Bacteria 4717
257 Ga0495588_0119816 3300046674 Bacteria 1387
258 Ga0495657_0014859 3300046675 Bacteria 5712
259 Ga0495647_0056457 3300046681 Bacteria 1539
260 Ga0495658_0001020 3300046683 Bacteria 14801
261 Ga0495613_0009876 3300046689 Bacteria 7096
262 Ga0495624_0006286 3300046690 Bacteria 8449
263 Ga0495600_0005606 3300046809 Bacteria 7578
264 Ga0495581_0002560 3300047315 Bacteria 10327
265 Ga0495581_0421187 3300047315 Bacteria 778
266 Ga0495674_0004649 3300047319 Bacteria 13196
267 Ga0495676_0026244 3300047321 Bacteria 5017
268 Ga0495676_0658335 3300047321 Bacteria 679
269 Ga0495675_0000440 3300047444 Bacteria 27746
270 Ga0495684_0003332 3300047471 Bacteria 12609
271 Ga0495593_0000314 3300047673 Bacteria 26641
272 Ga0495602_0061937 3300048088 Bacteria 3248
273 Ga0495614_0002177 3300048089 Bacteria 8677
274 Ga0496100_0038824 3300048903 Bacteria 3020
275 Ga0496101_0179982 3300048904 Bacteria 1628
276 Ga0496102_0050080 3300048905 Bacteria 3802
277 Ga0496102_1058049 3300048905 Bacteria 731
278 Ga0496104_0066619 3300048907 Bacteria 3419
279 Ga0496104_0213723 3300048907 Bacteria 1840
280 Ga0496104_0394395 3300048907 Bacteria 1296
281 Ga0496105_0028717 3300048908 Bacteria 4551
282 Ga0496105_0595246 3300048908 Bacteria 859
283 Ga0496106_0021125 3300048909 Bacteria 4833
284 Ga0496107_0031427 3300048910 Bacteria 3789
285 Ga0496108_0080356 3300048911 Bacteria 2761
286 Ga0496108_0090538 3300048911 Bacteria 2600
287 Ga0496108_0849554 3300048911 Bacteria 786
288 Ga0496109_0004884 3300048912 Bacteria 11196
289 Ga0496110_0021163 3300048913 Bacteria 5499
290 Ga0496110_0381794 3300048913 Bacteria 1284
291 Ga0496111_0011089 3300048914 Bacteria 6065
292 Ga0496112_0079962 3300048915 Bacteria 3233
293 Ga0496112_0097954 3300048915 Bacteria 2902
294 Ga0496112_0165919 3300048915 Bacteria 2174
295 Ga0496112_0496323 3300048915 Bacteria 1156
296 Ga0496112_0812309 3300048915 Bacteria 859
297 Ga0496113_0013983 3300048916 Bacteria 5460
298 Ga0496113_0022156 3300048916 Bacteria 4489
299 Ga0496113_0025933 3300048916 Bacteria 4186
300 Ga0496113_0272047 3300048916 Bacteria 1354
301 Ga0496113_0448224 3300048916 Bacteria 1037
302 Ga0496113_0921304 3300048916 Bacteria 691
303 Ga0496115_0124186 3300048918 Bacteria 2126
304 Ga0501034_0852916 3300049571 Bacteria 801
305 Ga0501077_0039644 3300049593 Bacteria 3001
306 Ga0501044_0560416 3300049823 Bacteria 1039
307 nmdc:mga0n895_154877_c1 3300050512 Bacteria 2322
308 nmdc:mga0n895_267008_c1 3300050512 Bacteria 1736
309 nmdc:mga0n895_544952_c1 3300050512 Bacteria 1166
310 nmdc:mga0a205_601196_c1 3300050515 Bacteria 953
311 8056063556 8056060235 Bacteria 7259403
312 Ga0307409_101171476
313 JGI25160J50197_1003429
314 JGI25407J50210_10043879
315 Ga0070658_10133516
316 Ga0070658_10336557
317 Ga0070658_10643178
318 Ga0070683_100015207
319 Ga0070683_100127012
320 Ga0070670_100053255
321 Ga0070680_100295538
322 Ga0070682_100284013
323 Ga0068868_100329895
324 Ga0070660_101215617
325 Ga0070689_100203766
326 Ga0070687_100383999
327 Ga0070661_100078900
328 Ga0070661_100248401
329 Ga0070668_100302775
330 Ga0070674_100207800
331 Ga0070688_100010385
332 Ga0070688_100351823
333 Ga0070659_100049213
334 Ga0070659_100284061
335 Ga0070659_100475981
336 Ga0070667_100667762
337 Ga0070703_10084108
338 Ga0070709_10004471
339 Ga0070709_10079979
340 Ga0070714_100012040
341 Ga0070714_100054687
342 Ga0070714_100200832
343 Ga0070713_100029959
344 Ga0070713_100097512
345 Ga0070713_100135887
346 Ga0070710_10018293
347 Ga0070710_10042241
348 Ga0070710_10149952
349 Ga0070711_100217717
350 Ga0070711_100274476
351 Ga0070711_100405279
352 Ga0070705_100057961
353 Ga0070705_100208341
354 Ga0070694_100052906
355 Ga0070708_100000483
356 Ga0070708_100671644
357 Ga0070662_100117159
358 Ga0070681_10371828
359 Ga0070681_10881638
360 Ga0068867_100211563
361 Ga0070685_10004995
362 Ga0070706_100092953
363 Ga0070706_100584111
364 Ga0070707_100183597
365 Ga0070699_100000935
366 Ga0070679_100810217
367 Ga0070684_100002525
368 Ga0070684_100123791
369 Ga0070684_100135273
370 Ga0070697_101135422
371 Ga0068853_100164970
372 Ga0070686_100016190
373 Ga0070686_100361541
374 Ga0070664_100007490
375 Ga0070664_100086852
376 Ga0068857_100075017
377 Ga0068854_100269393
378 Ga0068854_100328242
379 Ga0068856_100536773
380 Ga0070702_100003054
381 Ga0068852_100132775
382 Ga0068852_100737659
383 Ga0068852_101436960
384 Ga0068859_100004199
385 Ga0068864_100028977
386 Ga0068864_100115122
387 Ga0068866_10252545
388 Ga0068861_100019182
389 Ga0068861_100248162
390 Ga0068851_10244201
391 Ga0068863_100201522
392 Ga0068863_100412110
393 Ga0068858_100958514
394 Ga0068860_101068874
395 Ga0068862_100412889
396 Ga0068862_100502787
397 Ga0081455_10007348
398 Ga0081538_10000592
399 Ga0081538_10062350
400 Ga0070717_10024760
401 Ga0070717_10057723
402 Ga0070717_10111286
403 Ga0070717_10501961
404 Ga0070715_10111575
405 Ga0070715_10234459
406 Ga0070716_100032124
407 Ga0070716_100227294
408 Ga0070712_100024621
409 Ga0070712_100044886
410 Ga0097621_100416447
411 Ga0068871_100142855
412 Ga0075434_100134905
413 Ga0075434_101043759
414 Ga0068865_100094590
415 Ga0097620_100004199
416 Ga0099795_10311987
417 Ga0111539_10820898
418 Ga0105245_10007683
419 Ga0105243_10006719
420 Ga0105242_10036956
421 Ga0105248_10048210
422 Ga0105248_10134626
423 Ga0105238_10209154
424 Ga0105239_10151109
425 Ga0105239_10160270
426 Ga0105239_11419889
427 Ga0157373_10237893
428 Ga0157369_10349872
429 Ga0157369_11591150
430 Ga0157378_10257546
431 Ga0163162_10096453
432 Ga0157372_10246077
433 Ga0157375_10043721
434 Ga0157375_10604313
435 Ga0163163_10003036
436 Ga0157380_10318656
437 Ga0157377_10140732
438 Ga0157379_10120045
439 Ga0197907_11480796
440 Ga0206356_11381172
441 Ga0206351_10665610
442 Ga0207426_1000648
443 Ga0207426_1001452
444 Ga0207692_10029246
445 Ga0207692_10165117
446 Ga0207692_10298780
447 Ga0207688_10067384
448 Ga0207685_10186320
449 Ga0207699_10018591
450 Ga0207699_10984640
451 Ga0207705_10026285
452 Ga0207705_10253637
453 Ga0207705_10850168
454 Ga0207684_10095383
455 Ga0207684_10302689
456 Ga0207693_10380066
457 Ga0207663_10552513
458 Ga0207663_10616040
459 Ga0207663_10618958
460 Ga0207660_10457747
461 Ga0207662_10268563
462 Ga0207657_10174980
463 Ga0207649_10118419
464 Ga0207646_10005908
465 Ga0207687_10144787
466 Ga0207687_10693875
467 Ga0207700_10010168
468 Ga0207700_10040051
469 Ga0207700_10465606
470 Ga0207700_11745339
471 Ga0207664_10003388
472 Ga0207664_10115690
473 Ga0207664_10652176
474 Ga0207690_10058084
475 Ga0207706_10061694
476 Ga0207686_10552314
477 Ga0207709_10009526
478 Ga0207670_10067605
479 Ga0207669_10156136
480 Ga0207669_10717900
481 Ga0207704_10088860
482 Ga0207665_10031002
483 Ga0207711_10128305
484 Ga0207711_10457857
485 Ga0207661_10018965
486 Ga0207661_10195972
487 Ga0207679_10007652
488 Ga0207668_10206804
489 Ga0207677_10053972
490 Ga0207703_10226570
491 Ga0207639_10258437
492 Ga0207678_10113385
493 Ga0207708_10010187
494 Ga0207702_10405384
495 Ga0207702_10464847
496 Ga0207641_10329715
497 Ga0207648_10100324
498 Ga0207676_10031427
499 Ga0207676_10033302
500 Ga0207676_10040557
501 Ga0207674_10013941
502 Ga0207675_100019398
503 Ga0207683_10219832
504 Ga0207698_10082781
505 Ga0268265_10039918
506 Ga0268264_10493523
507 Ga0307405_10287447
508 Ga0307410_10151130
509 Ga0307410_11240837
510 Ga0373926_0000093
511 Ga0373934_0008444
512 Ga0373934_0202575
513 Ga0373944_0001310
514 Ga0373923_0012716
515 Ga0373939_0216601
516 Ga0373945_0000121
517 Ga0373953_0000776
518 Ga0373954_0020540
519 Ga0373956_0002074
520 Ga0373957_0016075
521 Ga0373943_0000454
522 Ga0373946_0011902
523 Ga0373955_0059676
524 Ga0373924_0000648
525 Ga0373935_0000226
526 Ga0373927_0002823
527 Ga0373947_0016021
528 Ga0373925_0005544
529 Ga0373925_0347112
530 Ga0395900_0008117
531 Ga0395900_1203069
532 Ga0395898_0522218
533 Ga0395898_0781775
534 Ga0395905_0678425
535 Ga0436363_0031311
536 Ga0436363_0559267
537 Ga0439450_036441
538 Ga0439463_017840
539 Ga0439463_156988
540 Ga0439458_0019547
541 Ga0439440_0010228
542 Ga0466963_0035622
543 Ga0466963_0467693
544 Ga0466968_0241249
545 Ga0466960_0399645
546 Ga0466967_0753874
547 Ga0466967_0941650
548 Ga0495603_0000297
549 Ga0495629_0203465
550 Ga0495641_0004093
551 Ga0495651_0007411
552 Ga0495653_0009339
553 Ga0495582_0001696
554 Ga0495639_0000194
555 Ga0495662_0003867
556 Ga0495594_0003982
557 Ga0495594_0296943
558 Ga0495618_0030414
559 Ga0495630_0011838
560 Ga0495666_0005710
561 Ga0495665_0000344
562 Ga0495640_0000875
563 Ga0495586_0025025
564 Ga0495587_0373464
565 Ga0495645_0005068
566 Ga0495622_0053470
567 Ga0495667_0018406
568 Ga0495588_0119816
569 Ga0495657_0014859
570 Ga0495647_0056457
571 Ga0495658_0001020
572 Ga0495613_0009876
573 Ga0495624_0006286
574 Ga0495600_0005606
575 Ga0495581_0002560
576 Ga0495581_0421187
577 Ga0495674_0004649
578 Ga0495676_0026244
579 Ga0495676_0658335
580 Ga0495675_0000440
581 Ga0495684_0003332
582 Ga0495593_0000314
583 Ga0495602_0061937
584 Ga0495614_0002177
585 Ga0496100_0038824
586 Ga0496101_0179982
587 Ga0496102_0050080
588 Ga0496102_1058049
589 Ga0496104_0066619
590 Ga0496104_0213723
591 Ga0496104_0394395
592 Ga0496105_0028717
593 Ga0496105_0595246
594 Ga0496106_0021125
595 Ga0496107_0031427
596 Ga0496108_0080356
597 Ga0496108_0090538
598 Ga0496108_0849554
599 Ga0496109_0004884
600 Ga0496110_0021163
601 Ga0496110_0381794
602 Ga0496111_0011089
603 Ga0496112_0079962
604 Ga0496112_0097954
605 Ga0496112_0165919
606 Ga0496112_0496323
607 Ga0496112_0812309
608 Ga0496113_0013983
609 Ga0496113_0022156
610 Ga0496113_0025933
611 Ga0496113_0272047
612 Ga0496113_0448224
613 Ga0496113_0921304
614 Ga0496115_0124186
615 Ga0501034_0852916
616 Ga0501077_0039644
617 Ga0501044_0560416
618 nmdc:mga0n895_154877_c1
619 nmdc:mga0n895_267008_c1
620 nmdc:mga0n895_544952_c1
621 nmdc:mga0a205_601196_c1
622 8056063556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

89

163

0.96

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

21

88

0.84

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

22

114

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.8877 23 176
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.867 23 176
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.8621 24 178
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.8612 18 175
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.8575 24 177
ID Description Score Start End Superfamily
5y6qA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9111 101 176 1.10.150.120
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9023 23 96 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8926 23 98 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.891 24 99 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8871 23 99 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2G5J344-F1-model_v4 (2Fe-2S)-binding protein 0.9077 18 173 GO:0016903
GO:0046872
GO:0051537
AF-A0A4Y3V9M2-F1-model_v4 (2Fe-2S)-binding protein 0.9025 23 171 GO:0016903
GO:0046872
GO:0051537
AF-A0A839XGT9-F1-model_v4 deleted 0.9021 22 177
AF-A0A4Q3TXT5-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9017 22 172 GO:0016209
GO:0016903
GO:0046872
GO:0051537
AF-A0A4S1AIG9-F1-model_v4 deleted 0.899 22 176

Map