F400901

General Info

Members Datasets Scaffolds Average Seq Length
310 206 241 195

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0009927|Ga0496117_0009927_7127_7768
Length 213
Sequence MCWKKNLRQSRAMQWSTCTMIRRLRDRLLAPRAPAGYRPGATLGLLSRNLGQVHMQLLEPARGVIDNPALGWRAEVRECVEAHLLMHVVTCEFRLCLPALQGGGVMLEMRHAGAIRRTGLACVYRSGDKARFAQVREQLLNNAQLTAALMPLDFKRLTLECRDGHWWLTLEHMGGSEVVNRMPAFRRYIQISPPQRAHLMACLGLFGQSLPRI

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
5 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
6 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
7 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
8 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
9 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
10 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
11 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
12 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
13 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
14 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
15 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
16 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
17 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
18 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
19 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
20 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
21 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
22 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
23 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
24 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
25 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
26 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
27 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
28 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
29 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
30 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
31 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
32 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
33 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
34 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
35 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
36 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
37 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
38 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
39 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
40 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
41 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
42 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
43 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
44 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
45 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
46 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
47 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
48 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
49 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
50 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
51 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
52 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
53 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
54 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
55 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
56 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
57 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
58 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
59 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
60 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
61 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
62 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
63 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
64 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
65 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
66 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
67 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
68 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
69 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
70 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
71 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
72 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
73 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
74 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
75 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
76 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
77 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
78 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
101 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
125 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
128 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
132 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
133 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
134 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
135 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
145 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
197 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
198 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
199 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
200 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
201 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
202 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
203 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
204 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
205 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
206 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.06
Metatranscriptomes 0
Isolates 21.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.74
Nodule 1.61
Rhizoplane 9.68
Rhizosphere 60.97
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6414 2124908027 Bacteria 11214
2 SwRhRL2b_contig_2359527 2162886007 Bacteria 3276
3 SwRhRL2b_contig_2478255 2162886007 Bacteria 16367
4 SwRhRL2b_contig_40993 2162886007 Bacteria 3874
5 JGI25154J39366_1004262 3300002738 Bacteria 2622
6 Ga0055538_1000066 3300003751 Bacteria 98557
7 Ga0055539_1000102 3300003752 Bacteria 98557
8 Ga0055533_1000110 3300003756 Bacteria 98557
9 Ga0055532_1000138 3300003758 Bacteria 71966
10 Ga0055525_1000187 3300003759 Bacteria 75518
11 Ga0055535_1006983 3300003761 Bacteria 2209
12 Ga0055536_1046194 3300003781 Bacteria 991
13 Ga0055530_10000010 3300003791 Bacteria 173678
14 Ga0055540_1000032 3300003792 Bacteria 173678
15 Ga0055541_1000068 3300003841 Bacteria 98557
16 Ga0065714_10002248 3300005288 Bacteria 43256
17 Ga0065714_10065542 3300005288 Bacteria 9497
18 Ga0065714_10074171 3300005288 Bacteria 3075
19 Ga0065704_10070568 3300005289 Bacteria 20326
20 Ga0065704_10072710 3300005289 Bacteria 8112
21 Ga0065704_10083233 3300005289 Bacteria 3490
22 Ga0065704_10085144 3300005289 Bacteria 3256
23 Ga0070670_100000034 3300005331 Bacteria 158067
24 Ga0070661_100011586 3300005344 Bacteria 6146
25 Ga0070664_100015987 3300005564 Bacteria 6146
26 Ga0075432_10001590 3300006058 Bacteria 7455
27 Ga0079104_1000128 3300006946 Bacteria 108656
28 Ga0099826_10002965 3300006948 Bacteria 11279
29 Ga0105251_10006758 3300009011 Bacteria 7239
30 Ga0105251_10008252 3300009011 Bacteria 6294
31 Ga0105251_10089586 3300009011 Bacteria 1414
32 Ga0105251_10204878 3300009011 Bacteria 888
33 Ga0105244_10000332 3300009036 Bacteria 44727
34 Ga0105244_10002083 3300009036 Bacteria 15391
35 Ga0105244_10005095 3300009036 Bacteria 8827
36 Ga0105244_10009918 3300009036 Bacteria 5812
37 Ga0105244_10010629 3300009036 Bacteria 5568
38 Ga0105244_10019640 3300009036 Bacteria 3767
39 Ga0105244_10043470 3300009036 Bacteria 2318
40 Ga0105250_10065178 3300009092 Bacteria 1468
41 Ga0105243_10015062 3300009148 Bacteria 5852
42 Ga0105243_10130977 3300009148 Bacteria 2127
43 Ga0105242_10071257 3300009176 Bacteria 2884
44 Ga0105237_10000676 3300009545 Bacteria 47156
45 Ga0105246_10016618 3300011119 Bacteria 4661
46 Ga0105246_10117953 3300011119 Bacteria 1962
47 Ga0157373_10005324 3300013100 Bacteria 9666
48 Ga0157373_10015141 3300013100 Bacteria 5641
49 Ga0157371_10007086 3300013102 Bacteria 9114
50 Ga0157370_10071674 3300013104 Bacteria 3269
51 Ga0157369_10002634 3300013105 Bacteria 21461
52 Ga0163162_10066916 3300013306 Bacteria 3643
53 Ga0163162_10344363 3300013306 Bacteria 1623
54 Ga0157375_10000410 3300013308 Bacteria 38871
55 Ga0157375_10003403 3300013308 Bacteria 13790
56 Ga0157375_10227859 3300013308 Bacteria 2022
57 Ga0182008_10034341 3300014497 Bacteria 2544
58 Ga0182008_10105209 3300014497 Bacteria 1396
59 Ga0182006_1000101 3300015261 Bacteria 95777
60 Ga0182006_1044939 3300015261 Bacteria 1721
61 Ga0182007_10000034 3300015262 Bacteria 134262
62 Ga0182007_10009321 3300015262 Bacteria 3967
63 Ga0182005_1009769 3300015265 Bacteria 2778
64 Ga0209435_100872 3300025206 Bacteria 4638
65 Ga0209784_100057 3300025224 Bacteria 167476
66 Ga0209566_100073 3300025225 Bacteria 167476
67 Ga0209674_100095 3300025226 Bacteria 167476
68 Ga0209147_100092 3300025229 Bacteria 167476
69 Ga0209563_100093 3300025230 Bacteria 167476
70 Ga0209258_100300 3300025242 Bacteria 80484
71 Ga0209646_1000571 3300025246 Bacteria 15317
72 Ga0209677_100054 3300025253 Bacteria 167476
73 Ga0209759_1017617 3300025256 Bacteria 1755
74 Ga0209676_1002932 3300025292 Bacteria 11137
75 Ga0209676_1035971 3300025292 Bacteria 1447
76 Ga0209050_1000043 3300025298 Bacteria 398654
77 Ga0209051_1000030 3300025303 Bacteria 398654
78 Ga0209257_1014974 3300025304 Bacteria 3273
79 Ga0207696_1000018 3300025711 Bacteria 478605
80 Ga0207696_1026258 3300025711 Bacteria 1804
81 Ga0207655_1000006 3300025728 Bacteria 861092
82 Ga0207655_1000081 3300025728 Bacteria 214272
83 Ga0207655_1000224 3300025728 Bacteria 96252
84 Ga0207655_1000389 3300025728 Bacteria 61370
85 Ga0207655_1034375 3300025728 Bacteria 2280
86 Ga0207655_1088580 3300025728 Bacteria 1095
87 Ga0207713_1003605 3300025735 Bacteria 10438
88 Ga0207713_1005221 3300025735 Bacteria 8194
89 Ga0207713_1005945 3300025735 Bacteria 7530
90 Ga0207713_1019223 3300025735 Bacteria 3352
91 Ga0207713_1088190 3300025735 Bacteria 1097
92 Ga0207671_10002356 3300025914 Bacteria 20333
93 Ga0207649_10000094 3300025920 Bacteria 74264
94 Ga0207649_10000183 3300025920 Bacteria 51125
95 Ga0207650_10000066 3300025925 Bacteria 140329
96 Ga0207686_10007939 3300025934 Bacteria 5722
97 Ga0207709_10039055 3300025935 Bacteria 2832
98 Ga0207709_10056638 3300025935 Bacteria 2427
99 Ga0207709_10069497 3300025935 Bacteria 2229
100 Ga0207679_10000103 3300025945 Bacteria 69609
101 Ga0207640_10455424 3300025981 Bacteria 1055
102 Ga0209281_1000040 3300027111 Bacteria 353441
103 Ga0209282_1257687 3300027666 Bacteria 766
104 Ga0307517_10107185 3300028786 Bacteria 2155
105 Ga0439438_000077 3300041405 Bacteria 45928
106 Ga0439438_000920 3300041405 Bacteria 13124
107 Ga0439438_001295 3300041405 Bacteria 11063
108 Ga0439438_001444 3300041405 Bacteria 10468
109 Ga0439438_005841 3300041405 Bacteria 4459
110 Ga0439447_000928 3300041407 Bacteria 10699
111 Ga0439447_006902 3300041407 Bacteria 3640
112 Ga0439447_035192 3300041407 Bacteria 1242
113 Ga0439466_0001255 3300041411 Bacteria 9870
114 Ga0439466_0009339 3300041411 Bacteria 3665
115 Ga0439466_0034441 3300041411 Bacteria 1717
116 Ga0439466_0035210 3300041411 Bacteria 1693
117 Ga0439432_033711 3300042006 Bacteria 1646
118 Ga0439451_000178 3300042009 Bacteria 11939
119 Ga0439452_007454 3300042010 Bacteria 3349
120 Ga0439452_033218 3300042010 Bacteria 1254
121 Ga0439452_056177 3300042010 Bacteria 890
122 Ga0439456_000028 3300042013 Bacteria 53976
123 Ga0439456_029740 3300042013 Bacteria 1167
124 Ga0439463_038373 3300042016 Bacteria 1215
125 Ga0439463_085561 3300042016 Bacteria 811
126 Ga0450922_007709 3300042124 Bacteria 1012
127 Ga0439446_0021990 3300042156 Bacteria 1805
128 Ga0450909_034249 3300042185 Bacteria 774
129 Ga0466972_0159127 3300044658 Bacteria 1061
130 Ga0466982_0399626 3300044672 Bacteria 744
131 Ga0466965_0261988 3300044683 Bacteria 929
132 Ga0466961_0328184 3300044693 Bacteria 932
133 Ga0466970_0113995 3300044765 Bacteria 1477
134 Ga0466960_0270493 3300044901 Bacteria 949
135 Ga0495627_001357 3300046453 Bacteria 14678
136 Ga0495627_029660 3300046453 Bacteria 1739
137 Ga0495591_000092 3300046458 Bacteria 101358
138 Ga0495591_000507 3300046458 Bacteria 30595
139 Ga0495591_000977 3300046458 Bacteria 19502
140 Ga0495580_0392718 3300046472 Bacteria 936
141 Ga0495605_0006436 3300046474 Bacteria 6750
142 Ga0495639_0000004 3300046475 Bacteria 103675
143 Ga0495639_0184962 3300046475 Bacteria 1015
144 Ga0495594_0095122 3300046499 Bacteria 1672
145 Ga0495607_0005472 3300046501 Bacteria 9085
146 Ga0495607_0026254 3300046501 Bacteria 3615
147 Ga0495583_0053803 3300046506 Bacteria 1825
148 Ga0495606_0000465 3300046507 Bacteria 66730
149 Ga0495610_0007443 3300046512 Bacteria 7283
150 Ga0495610_0074746 3300046512 Bacteria 1571
151 Ga0495610_0076456 3300046512 Bacteria 1548
152 Ga0495620_0000037 3300046515 Bacteria 114491
153 Ga0495620_0001528 3300046515 Bacteria 13747
154 Ga0495620_0011438 3300046515 Bacteria 4630
155 Ga0495632_0000563 3300046519 Bacteria 34530
156 Ga0495632_0016344 3300046519 Bacteria 4131
157 Ga0495637_0015786 3300046520 Bacteria 3539
158 Ga0495637_0016839 3300046520 Bacteria 3414
159 Ga0495643_0000476 3300046522 Bacteria 51006
160 Ga0495643_0000887 3300046522 Bacteria 31854
161 Ga0495643_0169668 3300046522 Bacteria 1067
162 Ga0495648_0000060 3300046524 Bacteria 152166
163 Ga0495648_0000624 3300046524 Bacteria 37947
164 Ga0495654_0007034 3300046530 Bacteria 6333
165 Ga0495654_0013152 3300046530 Bacteria 4432
166 Ga0495609_0061399 3300046538 Bacteria 1660
167 Ga0495597_0000270 3300046542 Bacteria 47151
168 Ga0495622_0000693 3300046557 Bacteria 19066
169 Ga0495622_0015237 3300046557 Bacteria 3573
170 Ga0495622_0186493 3300046557 Bacteria 928
171 Ga0495625_0147028 3300046660 Bacteria 1586
172 Ga0495659_0000013 3300046664 Bacteria 79904
173 Ga0495661_0000154 3300046665 Bacteria 80795
174 Ga0495661_0021500 3300046665 Bacteria 4206
175 Ga0495670_0299242 3300046691 Bacteria 862
176 Ga0495649_0006420 3300046694 Bacteria 7321
177 Ga0495649_0010858 3300046694 Bacteria 5362
178 Ga0495589_0001908 3300046794 Bacteria 11793
179 Ga0495581_0008669 3300047315 Bacteria 5890
180 Ga0495672_0000360 3300047320 Bacteria 58168
181 Ga0495672_0006900 3300047320 Bacteria 8658
182 Ga0495672_0038294 3300047320 Bacteria 2926
183 Ga0495680_0018106 3300047322 Bacteria 5993
184 Ga0495683_0005051 3300047323 Bacteria 7391
185 Ga0495683_0006956 3300047323 Bacteria 6139
186 Ga0495687_000948 3300047443 Bacteria 29881
187 Ga0495679_005577 3300047446 Bacteria 5552
188 Ga0495673_0003093 3300047469 Bacteria 11192
189 Ga0495673_0042242 3300047469 Bacteria 2048
190 Ga0495681_0000361 3300047470 Bacteria 35518
191 Ga0495681_0014214 3300047470 Bacteria 4578
192 Ga0495681_0191531 3300047470 Bacteria 834
193 Ga0495593_0026974 3300047673 Bacteria 3166
194 Ga0495626_0000235 3300048091 Bacteria 64391
195 Ga0495626_0000344 3300048091 Bacteria 48794
196 Ga0496102_1177515 3300048905 Bacteria 686
197 Ga0496104_0870259 3300048907 Bacteria 806
198 Ga0496106_0062201 3300048909 Bacteria 2834
199 Ga0496114_0104915 3300048917 Bacteria 2417
200 Ga0496116_0001463 3300048919 Bacteria 26454
201 Ga0496116_0065876 3300048919 Bacteria 2321
202 Ga0496117_0000218 3300048920 Bacteria 109766
203 Ga0496117_0001878 3300048920 Bacteria 28274
204 Ga0496117_0008401 3300048920 Bacteria 9814
205 Ga0496117_0009927 3300048920 Bacteria 8759
206 Ga0496117_0034929 3300048920 Bacteria 3781
207 Ga0496118_0006637 3300048921 Bacteria 12634
208 Ga0496118_0015200 3300048921 Bacteria 7147
209 Ga0496118_0069228 3300048921 Bacteria 2557
210 Ga0496118_0199923 3300048921 Bacteria 1185
211 Ga0496119_0023728 3300048922 Bacteria 4338
212 Ga0496120_0002344 3300048923 Bacteria 19462
213 Ga0496121_0013174 3300048924 Bacteria 8914
214 Ga0496121_0022617 3300048924 Bacteria 6088
215 Ga0496122_0003902 3300048925 Bacteria 19091
216 Ga0496122_0015321 3300048925 Bacteria 7335
217 Ga0496122_0023958 3300048925 Bacteria 5358
218 Ga0496122_0081282 3300048925 Bacteria 2256
219 Ga0496122_0160523 3300048925 Bacteria 1371
220 Ga0496123_0000136 3300048926 Bacteria 152399
221 Ga0496123_0018713 3300048926 Bacteria 5490
222 Ga0496123_0024351 3300048926 Bacteria 4603
223 Ga0496123_0057024 3300048926 Bacteria 2547
224 Ga0496123_0081813 3300048926 Bacteria 1960
225 Ga0496124_0001627 3300048927 Bacteria 32227
226 Ga0496124_0010006 3300048927 Bacteria 9681
227 Ga0496124_0080977 3300048927 Bacteria 2670
228 Ga0496125_0000615 3300048928 Bacteria 60392
229 Ga0496125_0000842 3300048928 Bacteria 49253
230 Ga0496125_0001504 3300048928 Bacteria 33396
231 Ga0496125_0015544 3300048928 Bacteria 7353
232 Ga0496125_0053361 3300048928 Bacteria 3314
233 Ga0496125_0346823 3300048928 Bacteria 888
234 Ga0496126_0116487 3300048929 Bacteria 2322
235 Ga0495678_000800 3300049459 Bacteria 28178
236 Ga0495678_055936 3300049459 Bacteria 1503
237 Ga0495682_0031390 3300049460 Bacteria 1963
238 Ga0501240_052116 3300049673 Bacteria 704
239 Ga0501269_005526 3300049766 Bacteria 1519
240 Ga0500659_0000437 3300053135 Bacteria 26976
241 Ga0500565_035143 3300053734 Bacteria 678

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042010 Ga0439452_056177 Ga0439452_056177_34_555 173
2 3300046472 Ga0495580_0392718 Ga0495580_0392718_389_910 173
3 3300046520 Ga0495637_0015786 Ga0495637_0015786_2974_3495 173
4 3300025292 Ga0209676_1035971 Ga0209676_10359712 177
5 iso_pu_bacteria 2834028612 2834032952 181
6 3300002738 JGI25154J39366_1004262 JGI25154J39366_10042622 182
7 3300003751 Ga0055538_1000066 Ga0055538_100006641 182
8 3300003752 Ga0055539_1000102 Ga0055539_100010241 182
9 3300003756 Ga0055533_1000110 Ga0055533_100011041 182
10 3300003758 Ga0055532_1000138 Ga0055532_100013816 182
11 3300003759 Ga0055525_1000187 Ga0055525_100018736 182
12 3300003761 Ga0055535_1006983 Ga0055535_10069832 182
13 3300003841 Ga0055541_1000068 Ga0055541_100006866 182
14 3300009036 Ga0105244_10002083 Ga0105244_100020832 182
15 3300013308 Ga0157375_10000410 Ga0157375_1000041028 182
16 3300025206 Ga0209435_100872 Ga0209435_1008722 182
17 3300025224 Ga0209784_100057 Ga0209784_100057103 182
18 3300025225 Ga0209566_100073 Ga0209566_100073103 182
19 3300025226 Ga0209674_100095 Ga0209674_100095103 182
20 3300025229 Ga0209147_100092 Ga0209147_100092103 182
21 3300025230 Ga0209563_100093 Ga0209563_10009367 182
22 3300025242 Ga0209258_100300 Ga0209258_10030049 182
23 3300025246 Ga0209646_1000571 Ga0209646_10005716 182
24 3300025253 Ga0209677_100054 Ga0209677_100054103 182
25 3300025256 Ga0209759_1017617 Ga0209759_10176172 182
26 3300025728 Ga0207655_1034375 Ga0207655_10343752 182
27 3300025981 Ga0207640_10455424 Ga0207640_104554241 182
28 3300028786 Ga0307517_10107185 Ga0307517_101071852 182
29 3300046512 Ga0495610_0074746 Ga0495610_0074746_735_1301 182
30 3300046530 Ga0495654_0013152 Ga0495654_0013152_2779_3336 182
31 3300048920 Ga0496117_0034929 Ga0496117_0034929_480_1037 182
32 3300048924 Ga0496121_0022617 Ga0496121_0022617_3919_4476 182
33 3300048925 Ga0496122_0003902 Ga0496122_0003902_15260_15823 182
34 3300048925 Ga0496122_0160523 Ga0496122_0160523_590_1147 182
35 3300048926 Ga0496123_0024351 Ga0496123_0024351_3208_3771 182
36 3300048926 Ga0496123_0057024 Ga0496123_0057024_361_918 182
37 3300048928 Ga0496125_0000842 Ga0496125_0000842_23009_23572 182
38 iso_pu_bacteria 2597489889 2597870624 182
39 iso_pu_bacteria 2599185179 2599452393 182
40 iso_pu_bacteria 2599185190 2599513227 182
41 iso_pu_bacteria 2599185191 2599518271 182
42 iso_pu_bacteria 2599185290 2599891903 182
43 iso_pu_bacteria 2600255296 2601689943 182
44 iso_pu_bacteria 2643221571 2643871463 182
45 iso_pu_bacteria 2643221713 2644622404 182
46 iso_pu_bacteria 2675903420 2677900798 182
47 iso_pu_bacteria 2721755607 2723249539 182
48 iso_pu_bacteria 2842826826 2842831223 182
49 iso_pu_bacteria 2947233263 2947238574 182
50 iso_pu_bacteria 8054347763 8054348595 182
51 iso_pu_bacteria 8056148874 8056152754 182
52 3300044658 Ga0466972_0159127 Ga0466972_0159127_286_876 183
53 3300044672 Ga0466982_0399626 Ga0466982_0399626_129_719 183
54 3300044683 Ga0466965_0261988 Ga0466965_0261988_181_768 183
55 3300044693 Ga0466961_0328184 Ga0466961_0328184_32_622 183
56 3300044765 Ga0466970_0113995 Ga0466970_0113995_61_651 183
57 3300044901 Ga0466960_0270493 Ga0466960_0270493_46_636 183
58 iso_pu_bacteria 2511231156 2511824520 183
59 iso_pu_bacteria 8020938398 8020942708 184
60 iso_pu_bacteria 8020953355 8020957715 184
61 3300046475 Ga0495639_0000004 Ga0495639_0000004_75644_76240 185
62 3300046499 Ga0495594_0095122 Ga0495594_0095122_350_946 185
63 3300046501 Ga0495607_0026254 Ga0495607_0026254_2866_3450 185
64 3300046557 Ga0495622_0000693 Ga0495622_0000693_18284_18880 185
65 3300009036 Ga0105244_10019640 Ga0105244_100196403 186
66 3300009092 Ga0105250_10065178 Ga0105250_100651782 186
67 iso_pu_bacteria 2738541265 2738669517 186
68 iso_pu_bacteria 2738541282 2738747910 186
69 iso_pu_bacteria 2738541303 2738856952 186
70 3300009036 Ga0105244_10009918 Ga0105244_100099188 187
71 3300011119 Ga0105246_10117953 Ga0105246_101179532 187
72 3300042013 Ga0439456_000028 Ga0439456_000028_27868_28452 187
73 3300046453 Ga0495627_029660 Ga0495627_029660_961_1524 187
74 3300046538 Ga0495609_0061399 Ga0495609_0061399_652_1215 187
75 iso_pu_bacteria 2912963787 2912966052 187
76 iso_pu_bacteria 2939651529 2939656481 187
77 3300025735 Ga0207713_1003605 Ga0207713_10036053 189
78 3300048917 Ga0496114_0104915 Ga0496114_0104915_171_740 189
79 3300048927 Ga0496124_0010006 Ga0496124_0010006_5177_5746 189
80 3300048928 Ga0496125_0053361 Ga0496125_0053361_65_634 189
81 iso_pu_bacteria 2811994881 2812371396 189
82 iso_pu_bacteria 2923519811 2923525510 189
83 2162886007 SwRhRL2b_contig_40993 SwRhRL2b_0028.00002720 190
84 3300005344 Ga0070661_100011586 Ga0070661_1000115865 190
85 3300005564 Ga0070664_100015987 Ga0070664_1000159875 190
86 3300009036 Ga0105244_10005095 Ga0105244_100050957 190
87 3300009036 Ga0105244_10010629 Ga0105244_100106292 190
88 3300009148 Ga0105243_10015062 Ga0105243_100150622 190
89 3300009176 Ga0105242_10071257 Ga0105242_100712572 190
90 3300009545 Ga0105237_10000676 Ga0105237_100006765 190
91 3300011119 Ga0105246_10016618 Ga0105246_100166183 190
92 3300013100 Ga0157373_10015141 Ga0157373_100151414 190
93 3300013104 Ga0157370_10071674 Ga0157370_100716744 190
94 3300013105 Ga0157369_10002634 Ga0157369_1000263420 190
95 3300013308 Ga0157375_10003403 Ga0157375_1000340310 190
96 3300025711 Ga0207696_1026258 Ga0207696_10262582 190
97 3300025728 Ga0207655_1000081 Ga0207655_100008135 190
98 3300025728 Ga0207655_1000389 Ga0207655_10003894 190
99 3300025735 Ga0207713_1088190 Ga0207713_10881902 190
100 3300025914 Ga0207671_10002356 Ga0207671_1000235621 190
101 3300025920 Ga0207649_10000094 Ga0207649_100000944 190
102 3300025920 Ga0207649_10000094 Ga0207649_1000009457 190
103 3300025920 Ga0207649_10000183 Ga0207649_1000018361 190
104 3300025934 Ga0207686_10007939 Ga0207686_100079392 190
105 3300025945 Ga0207679_10000103 Ga0207679_100001035 190
106 3300046522 Ga0495643_0000887 Ga0495643_0000887_26242_26814 190
107 3300048920 Ga0496117_0008401 Ga0496117_0008401_4351_4923 190
108 3300048921 Ga0496118_0015200 Ga0496118_0015200_670_1242 190
109 3300048925 Ga0496122_0023958 Ga0496122_0023958_3385_3957 190
110 3300048926 Ga0496123_0000136 Ga0496123_0000136_93970_94542 190
111 3300048928 Ga0496125_0015544 Ga0496125_0015544_338_928 190
112 3300048928 Ga0496125_0346823 Ga0496125_0346823_65_637 190
113 3300042013 Ga0439456_029740 Ga0439456_029740_162_779 193
114 iso_pu_bacteria 3007419365 3007421731 193
115 2124908027 MRS2a_Contig_6414 MRS2a_00304880 194
116 2162886007 SwRhRL2b_contig_2359527 SwRhRL2b_0053.00002730 194
117 2162886007 SwRhRL2b_contig_2478255 SwRhRL2b_0171.00008970 194
118 3300003781 Ga0055536_1046194 Ga0055536_10461941 194
119 3300003791 Ga0055530_10000010 Ga0055530_10000010149 194
120 3300003792 Ga0055540_1000032 Ga0055540_1000032149 194
121 3300005288 Ga0065714_10002248 Ga0065714_100022483 194
122 3300005288 Ga0065714_10065542 Ga0065714_100655428 194
123 3300005288 Ga0065714_10074171 Ga0065714_100741712 194
124 3300005289 Ga0065704_10070568 Ga0065704_100705686 194
125 3300005289 Ga0065704_10072710 Ga0065704_100727103 194
126 3300005289 Ga0065704_10083233 Ga0065704_100832332 194
127 3300005289 Ga0065704_10085144 Ga0065704_100851442 194
128 3300005331 Ga0070670_100000034 Ga0070670_10000003435 194
129 3300006058 Ga0075432_10001590 Ga0075432_100015902 194
130 3300006946 Ga0079104_1000128 Ga0079104_100012882 194
131 3300006948 Ga0099826_10002965 Ga0099826_100029659 194
132 3300009011 Ga0105251_10006758 Ga0105251_100067585 194
133 3300009011 Ga0105251_10008252 Ga0105251_100082524 194
134 3300009011 Ga0105251_10089586 Ga0105251_100895862 194
135 3300009011 Ga0105251_10204878 Ga0105251_102048782 194
136 3300009036 Ga0105244_10000332 Ga0105244_1000033234 194
137 3300009036 Ga0105244_10043470 Ga0105244_100434702 194
138 3300009148 Ga0105243_10130977 Ga0105243_101309772 194
139 3300013100 Ga0157373_10005324 Ga0157373_100053248 194
140 3300013102 Ga0157371_10007086 Ga0157371_100070867 194
141 3300013306 Ga0163162_10066916 Ga0163162_100669163 194
142 3300013306 Ga0163162_10344363 Ga0163162_103443632 194
143 3300013308 Ga0157375_10227859 Ga0157375_102278592 194
144 3300014497 Ga0182008_10034341 Ga0182008_100343412 194
145 3300014497 Ga0182008_10105209 Ga0182008_101052091 194
146 3300015261 Ga0182006_1000101 Ga0182006_100010166 194
147 3300015261 Ga0182006_1044939 Ga0182006_10449392 194
148 3300015262 Ga0182007_10000034 Ga0182007_1000003466 194
149 3300015262 Ga0182007_10009321 Ga0182007_100093215 194
150 3300015265 Ga0182005_1009769 Ga0182005_10097692 194
151 3300025292 Ga0209676_1002932 Ga0209676_10029322 194
152 3300025298 Ga0209050_1000043 Ga0209050_10000432 194
153 3300025303 Ga0209051_1000030 Ga0209051_1000030347 194
154 3300025304 Ga0209257_1014974 Ga0209257_10149743 194
155 3300025711 Ga0207696_1000018 Ga0207696_1000018294 194
156 3300025728 Ga0207655_1000006 Ga0207655_1000006669 194
157 3300025728 Ga0207655_1000224 Ga0207655_100022449 194
158 3300025728 Ga0207655_1088580 Ga0207655_10885802 194
159 3300025735 Ga0207713_1005221 Ga0207713_10052215 194
160 3300025735 Ga0207713_1005945 Ga0207713_10059456 194
161 3300025735 Ga0207713_1019223 Ga0207713_10192234 194
162 3300025925 Ga0207650_10000066 Ga0207650_1000006635 194
163 3300025935 Ga0207709_10039055 Ga0207709_100390553 194
164 3300025935 Ga0207709_10056638 Ga0207709_100566382 194
165 3300025935 Ga0207709_10069497 Ga0207709_100694972 194
166 3300027111 Ga0209281_1000040 Ga0209281_1000040265 194
167 3300027666 Ga0209282_1257687 Ga0209282_12576871 194
168 3300041405 Ga0439438_000077 Ga0439438_000077_34678_35298 194
169 3300041405 Ga0439438_000920 Ga0439438_000920_5162_5782 194
170 3300041405 Ga0439438_001295 Ga0439438_001295_4896_5516 194
171 3300041405 Ga0439438_001444 Ga0439438_001444_1306_1890 194
172 3300041405 Ga0439438_005841 Ga0439438_005841_994_1614 194
173 3300041407 Ga0439447_000928 Ga0439447_000928_4133_4753 194
174 3300041407 Ga0439447_006902 Ga0439447_006902_780_1400 194
175 3300041407 Ga0439447_035192 Ga0439447_035192_159_743 194
176 3300041411 Ga0439466_0001255 Ga0439466_0001255_5728_6312 194
177 3300041411 Ga0439466_0009339 Ga0439466_0009339_1264_1848 194
178 3300041411 Ga0439466_0034441 Ga0439466_0034441_151_771 194
179 3300041411 Ga0439466_0035210 Ga0439466_0035210_234_854 194
180 3300042006 Ga0439432_033711 Ga0439432_033711_456_1076 194
181 3300042009 Ga0439451_000178 Ga0439451_000178_5916_6500 194
182 3300042010 Ga0439452_007454 Ga0439452_007454_1825_2445 194
183 3300042010 Ga0439452_033218 Ga0439452_033218_478_1062 194
184 3300042016 Ga0439463_038373 Ga0439463_038373_485_1078 194
185 3300042016 Ga0439463_085561 Ga0439463_085561_77_661 194
186 3300042124 Ga0450922_007709 Ga0450922_007709_211_795 194
187 3300042156 Ga0439446_0021990 Ga0439446_0021990_792_1412 194
188 3300042185 Ga0450909_034249 Ga0450909_034249_65_685 194
189 3300046453 Ga0495627_001357 Ga0495627_001357_3169_3753 194
190 3300046458 Ga0495591_000092 Ga0495591_000092_50922_51506 194
191 3300046458 Ga0495591_000507 Ga0495591_000507_3499_4092 194
192 3300046458 Ga0495591_000977 Ga0495591_000977_13945_14529 194
193 3300046474 Ga0495605_0006436 Ga0495605_0006436_1309_1893 194
194 3300046475 Ga0495639_0184962 Ga0495639_0184962_356_976 194
195 3300046501 Ga0495607_0005472 Ga0495607_0005472_5103_5696 194
196 3300046506 Ga0495583_0053803 Ga0495583_0053803_324_908 194
197 3300046507 Ga0495606_0000465 Ga0495606_0000465_26409_26993 194
198 3300046512 Ga0495610_0007443 Ga0495610_0007443_5765_6349 194
199 3300046512 Ga0495610_0076456 Ga0495610_0076456_558_1151 194
200 3300046515 Ga0495620_0000037 Ga0495620_0000037_74196_74780 194
201 3300046515 Ga0495620_0001528 Ga0495620_0001528_5622_6206 194
202 3300046515 Ga0495620_0011438 Ga0495620_0011438_1119_1703 194
203 3300046519 Ga0495632_0000563 Ga0495632_0000563_23409_23993 194
204 3300046519 Ga0495632_0016344 Ga0495632_0016344_2474_3067 194
205 3300046520 Ga0495637_0016839 Ga0495637_0016839_2574_3158 194
206 3300046522 Ga0495643_0000476 Ga0495643_0000476_26786_27370 194
207 3300046522 Ga0495643_0169668 Ga0495643_0169668_289_873 194
208 3300046524 Ga0495648_0000060 Ga0495648_0000060_136160_136780 194
209 3300046524 Ga0495648_0000624 Ga0495648_0000624_5545_6129 194
210 3300046530 Ga0495654_0007034 Ga0495654_0007034_5452_6036 194
211 3300046542 Ga0495597_0000270 Ga0495597_0000270_29555_30139 194
212 3300046557 Ga0495622_0015237 Ga0495622_0015237_1113_1733 194
213 3300046557 Ga0495622_0186493 Ga0495622_0186493_158_742 194
214 3300046660 Ga0495625_0147028 Ga0495625_0147028_365_949 194
215 3300046664 Ga0495659_0000013 Ga0495659_0000013_73101_73685 194
216 3300046665 Ga0495661_0000154 Ga0495661_0000154_26228_26812 194
217 3300046665 Ga0495661_0021500 Ga0495661_0021500_27_611 194
218 3300046691 Ga0495670_0299242 Ga0495670_0299242_190_810 194
219 3300046694 Ga0495649_0006420 Ga0495649_0006420_1137_1721 194
220 3300046694 Ga0495649_0010858 Ga0495649_0010858_3770_4390 194
221 3300046794 Ga0495589_0001908 Ga0495589_0001908_6757_7341 194
222 3300047315 Ga0495581_0008669 Ga0495581_0008669_249_833 194
223 3300047320 Ga0495672_0000360 Ga0495672_0000360_32013_32597 194
224 3300047320 Ga0495672_0006900 Ga0495672_0006900_6993_7613 194
225 3300047320 Ga0495672_0038294 Ga0495672_0038294_2165_2752 194
226 3300047322 Ga0495680_0018106 Ga0495680_0018106_5365_5949 194
227 3300047323 Ga0495683_0005051 Ga0495683_0005051_2225_2809 194
228 3300047323 Ga0495683_0006956 Ga0495683_0006956_471_1055 194
229 3300047443 Ga0495687_000948 Ga0495687_000948_5919_6503 194
230 3300047446 Ga0495679_005577 Ga0495679_005577_3132_3716 194
231 3300047469 Ga0495673_0003093 Ga0495673_0003093_4560_5180 194
232 3300047469 Ga0495673_0042242 Ga0495673_0042242_413_997 194
233 3300047470 Ga0495681_0000361 Ga0495681_0000361_17454_18074 194
234 3300047470 Ga0495681_0014214 Ga0495681_0014214_745_1329 194
235 3300047470 Ga0495681_0191531 Ga0495681_0191531_116_700 194
236 3300047673 Ga0495593_0026974 Ga0495593_0026974_2014_2598 194
237 3300048091 Ga0495626_0000235 Ga0495626_0000235_31842_32426 194
238 3300048091 Ga0495626_0000344 Ga0495626_0000344_24374_24958 194
239 3300048905 Ga0496102_1177515 Ga0496102_1177515_73_657 194
240 3300048907 Ga0496104_0870259 Ga0496104_0870259_180_764 194
241 3300048909 Ga0496106_0062201 Ga0496106_0062201_56_640 194
242 3300048919 Ga0496116_0001463 Ga0496116_0001463_9979_10563 194
243 3300048919 Ga0496116_0065876 Ga0496116_0065876_38_622 194
244 3300048920 Ga0496117_0000218 Ga0496117_0000218_82801_83385 194
245 3300048920 Ga0496117_0001878 Ga0496117_0001878_22026_22610 194
246 3300048920 Ga0496117_0009927 Ga0496117_0009927_7127_7768 194
247 3300048921 Ga0496118_0006637 Ga0496118_0006637_4935_5519 194
248 3300048921 Ga0496118_0069228 Ga0496118_0069228_1076_1660 194
249 3300048921 Ga0496118_0199923 Ga0496118_0199923_250_834 194
250 3300048922 Ga0496119_0023728 Ga0496119_0023728_3028_3612 194
251 3300048923 Ga0496120_0002344 Ga0496120_0002344_17787_18371 194
252 3300048924 Ga0496121_0013174 Ga0496121_0013174_6006_6590 194
253 3300048925 Ga0496122_0015321 Ga0496122_0015321_5687_6271 194
254 3300048925 Ga0496122_0081282 Ga0496122_0081282_369_953 194
255 3300048926 Ga0496123_0018713 Ga0496123_0018713_43_627 194
256 3300048926 Ga0496123_0081813 Ga0496123_0081813_947_1531 194
257 3300048927 Ga0496124_0001627 Ga0496124_0001627_26433_27017 194
258 3300048927 Ga0496124_0080977 Ga0496124_0080977_947_1531 194
259 3300048928 Ga0496125_0000615 Ga0496125_0000615_33504_34088 194
260 3300048928 Ga0496125_0001504 Ga0496125_0001504_27976_28617 194
261 3300048929 Ga0496126_0116487 Ga0496126_0116487_1136_1720 194
262 3300049459 Ga0495678_000800 Ga0495678_000800_12997_13581 194
263 3300049459 Ga0495678_055936 Ga0495678_055936_799_1419 194
264 3300049460 Ga0495682_0031390 Ga0495682_0031390_197_781 194
265 3300049673 Ga0501240_052116 Ga0501240_052116_96_680 194
266 3300049766 Ga0501269_005526 Ga0501269_005526_269_853 194
267 3300053135 Ga0500659_0000437 Ga0500659_0000437_992_1633 194
268 3300053734 Ga0500565_035143 Ga0500565_035143_26_610 194
269 iso_pu_bacteria 2511231004 2511253097 194
270 iso_pu_bacteria 2599185188 2599501850 194
271 iso_pu_bacteria 2599185212 2599616564 194
272 iso_pu_bacteria 2599185248 2599769100 194
273 iso_pu_bacteria 2599185289 2599888344 194
274 iso_pu_bacteria 2599185291 2599895928 194
275 iso_pu_bacteria 2599185300 2599931207 194
276 iso_pu_bacteria 2599185305 2599957812 194
277 iso_pu_bacteria 2599185306 2599968907 194
278 iso_pu_bacteria 2599185308 2599980427 194
279 iso_pu_bacteria 2599185311 2599992425 194
280 iso_pu_bacteria 2599185313 2600004100 194
281 iso_pu_bacteria 2599185314 2600014238 194
282 iso_pu_bacteria 2599185315 2600015536 194
283 iso_pu_bacteria 2599185316 2600026923 194
284 iso_pu_bacteria 2599185318 2600038334 194
285 iso_pu_bacteria 2599185321 2600050744 194
286 iso_pu_bacteria 2599185322 2600062663 194
287 iso_pu_bacteria 2599185324 2600072735 194
288 iso_pu_bacteria 2599185325 2600077028 194
289 iso_pu_bacteria 2623620446 2624491894 194
290 iso_pu_bacteria 2643221633 2644185104 194
291 iso_pu_bacteria 2651869719 2652543923 194
292 iso_pu_bacteria 2667528170 2671088620 194
293 iso_pu_bacteria 2667528176 2671125150 194
294 iso_pu_bacteria 2675903515 2678263715 194
295 iso_pu_bacteria 2744054620 2745010046 194
296 iso_pu_bacteria 2791355520 2794594862 194
297 iso_pu_bacteria 2808606382 2808956336 194
298 iso_pu_bacteria 2825651385 2825651907 194
299 iso_pu_bacteria 2913036834 2913039984 194
300 iso_pu_bacteria 2919481497 2919484988 194
301 iso_pu_bacteria 2919697872 2919698060 194
302 iso_pu_bacteria 2923586266 2923586302 194
303 iso_pu_bacteria 2929144301 2929147175 194
304 iso_pu_bacteria 2929189879 2929192471 194
305 iso_pu_bacteria 2931369376 2931369488 194
306 iso_pu_bacteria 2945961074 2945962578 194
307 iso_pu_bacteria 2988728565 2988734115 194
308 iso_pu_bacteria 8019775933 8019778734 194
309 iso_pu_bacteria 8054503363 8054506210 194
310 iso_pu_bacteria 8056131705 8056134137 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11354

DUF3156

Protein of unknown function (DUF3156)

48

210

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x4p-assembly5.cif.gz_C crystal structure of the a.fulgidus cca-adding enzyme in complex with a g70a arginyl-trna minihelix ending in ccac 0.4712 84 154
1uet-assembly1.cif.gz_A divergent evolutions of trinucleotide polymerization revealed by an archaeal cca-adding enzyme structure 0.4676 84 154
4x4o-assembly2.cif.gz_C crystal structure of the a.fulgidus cca-adding enzyme in complex with a g70a arginyl-trna minihelix and ctp 0.3899 77 154
2jgb-assembly1.cif.gz_A structure of human eif4e homologous protein 4ehp with m7gtp 0.3704 71 186
2jgc-assembly1.cif.gz_A structure of the human eif4e homologous protein, 4ehp without ligand bound 0.3687 71 186
ID Description Score Start End Superfamily
2xgaA00 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.518 22 193 3.30.1460.10
af_F1LIL9_48_280_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.5157 35 65 3.80.10.10
2xgaA00 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.505 22 193 3.30.1460.10
af_O53780_84_228_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.4341 17 81 3.40.1000.10
af_I1KQT5_86_192_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.431 25 65 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A3G7X2F6-F1-model_v4 deleted 0.982 22 194
AF-A0A3G7X2F6-F1-model_v4 deleted 0.9764 22 194
AF-G8PWG4-F1-model_v4 deleted 0.9707 9 194
AF-A0A0L6FQN6-F1-model_v4 deleted 0.9691 59 194
AF-G8PWG4-F1-model_v4 deleted 0.9605 9 194

Feature Viewer

pLDDT pTM Quality
89.83 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map