F400763

General Info

Members Datasets Scaffolds Average Seq Length
310 178 620 210

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10458295|Ga0207691_104582952
Length 240
Sequence MMPESGTASRWDIGGSYSTGCTLPVEWPPMPRLYRAGDSVEDFCRACKTDRMHTVIAADPQGVPIRVVCGYCDSEHNYRGGPRIGGAPETPVRAPASTASGGAGPRRARDPFPIVSERERIAPAMSGEQDIEMLLRRIIREEAGVSAVTPAEKWRGGTLVLKPGAPGVQEKTWPIETFFHKVVMLRNRLRTLEQQVNAAELPEDLKVKLQSYISGCYGTLTSFNVLFADEEDQFKGAGGD

Samples

Sample ID Description Type Environment
1 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
134 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
137 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
138 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
175 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.06
Nodule 0
Rhizoplane 3.23
Rhizosphere 88.39
Stem 0
Stem Tuber 0
Unclassified 15.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207691_10458295 3300025940 Bacteria 1085
2 Ga0065712_10000364 3300005290 Bacteria 15197
3 Ga0065712_10081042 3300005290 Bacteria 3045
4 Ga0065715_10089447 3300005293 Bacteria 10128
5 Ga0065715_10151225 3300005293 Bacteria 1727
6 Ga0070676_10118697 3300005328 Bacteria 1657
7 Ga0070683_100082726 3300005329 Bacteria 3007
8 Ga0070690_100004599 3300005330 Bacteria 7675
9 Ga0070670_100002347 3300005331 Bacteria 15589
10 Ga0070670_100015527 3300005331 Bacteria 6540
11 Ga0070670_100056920 3300005331 Bacteria 3357
12 Ga0070670_100250498 3300005331 Unclassified 1543
13 Ga0070670_100483613 3300005331 Unclassified 1100
14 Ga0070677_10161346 3300005333 Bacteria 1052
15 Ga0070666_10545684 3300005335 Bacteria 843
16 Ga0070680_100206718 3300005336 Bacteria 1656
17 Ga0068868_100040152 3300005338 Bacteria 3641
18 Ga0068868_100559387 3300005338 Unclassified 1009
19 Ga0070689_100261715 3300005340 Bacteria 1430
20 Ga0070687_100003949 3300005343 Bacteria 5841
21 Ga0070668_100326684 3300005347 Bacteria 1293
22 Ga0070668_100361618 3300005347 Bacteria 1231
23 Ga0070668_100560969 3300005347 Bacteria 995
24 Ga0070669_100073228 3300005353 Unclassified 2537
25 Ga0070675_100018734 3300005354 Bacteria 5510
26 Ga0070675_100065214 3300005354 Bacteria 3011
27 Ga0070675_100308460 3300005354 Bacteria 1396
28 Ga0070675_100658466 3300005354 Unclassified 952
29 Ga0070675_100872551 3300005354 Unclassified 824
30 Ga0070674_100005662 3300005356 Bacteria 7239
31 Ga0070674_100011607 3300005356 Bacteria 5368
32 Ga0070674_100100388 3300005356 Bacteria 2107
33 Ga0070674_100286635 3300005356 Bacteria 1307
34 Ga0070673_100093814 3300005364 Bacteria 2459
35 Ga0070673_100234896 3300005364 Unclassified 1592
36 Ga0070688_100002960 3300005365 Bacteria 8657
37 Ga0070688_100008975 3300005365 Bacteria 5447
38 Ga0070688_100037704 3300005365 Bacteria 2947
39 Ga0070667_100053323 3300005367 Bacteria 3413
40 Ga0070667_100103247 3300005367 Bacteria 2464
41 Ga0070667_100174671 3300005367 Bacteria 1898
42 Ga0070701_10053173 3300005438 Bacteria 2107
43 Ga0070701_10202502 3300005438 Bacteria 1174
44 Ga0070705_100424381 3300005440 Bacteria 991
45 Ga0070700_100133167 3300005441 Bacteria 1680
46 Ga0070700_100274000 3300005441 Bacteria 1221
47 Ga0070708_100008038 3300005445 Bacteria 8453
48 Ga0070663_100049620 3300005455 Bacteria 2982
49 Ga0070663_100164308 3300005455 Bacteria 1711
50 Ga0070678_100121955 3300005456 Bacteria 2057
51 Ga0070678_100309192 3300005456 Bacteria 1346
52 Ga0070662_100124743 3300005457 Bacteria 1978
53 Ga0070662_100325615 3300005457 Bacteria 1254
54 Ga0068867_100198756 3300005459 Bacteria 1604
55 Ga0070685_10020352 3300005466 Bacteria 3590
56 Ga0070706_100262369 3300005467 Bacteria 1612
57 Ga0070699_100005740 3300005518 Bacteria 10863
58 Ga0070684_100001447 3300005535 Bacteria 17125
59 Ga0070697_100444440 3300005536 Bacteria 1129
60 Ga0070697_100466066 3300005536 Bacteria 1102
61 Ga0070672_100006483 3300005543 Bacteria 7866
62 Ga0070672_100074266 3300005543 Bacteria 2712
63 Ga0070686_100534459 3300005544 Bacteria 915
64 Ga0070696_100148997 3300005546 Bacteria 1716
65 Ga0070693_100030442 3300005547 Bacteria 2951
66 Ga0070665_100020511 3300005548 Bacteria 6638
67 Ga0070665_100097894 3300005548 Bacteria 2938
68 Ga0070704_100348007 3300005549 Bacteria 1250
69 Ga0070704_101189496 3300005549 Unclassified 695
70 Ga0070664_100002945 3300005564 Bacteria 13769
71 Ga0070664_100008122 3300005564 Bacteria 8486
72 Ga0068857_100122647 3300005577 Bacteria 2341
73 Ga0068857_100274463 3300005577 Bacteria 1550
74 Ga0068857_100315442 3300005577 Bacteria 1443
75 Ga0068852_100476821 3300005616 Bacteria 1239
76 Ga0068859_100022089 3300005617 Bacteria 6379
77 Ga0068859_100049656 3300005617 Bacteria 4213
78 Ga0068859_100637630 3300005617 Bacteria 1158
79 Ga0068864_100232425 3300005618 Bacteria 1706
80 Ga0068864_100795940 3300005618 Bacteria 929
81 Ga0068866_10087967 3300005718 Bacteria 1685
82 Ga0068866_10199939 3300005718 Bacteria 1193
83 Ga0068861_100110509 3300005719 Bacteria 2202
84 Ga0068861_100122351 3300005719 Bacteria 2101
85 Ga0068851_10180852 3300005834 Bacteria 1168
86 Ga0068870_10171417 3300005840 Bacteria 1295
87 Ga0068863_100092457 3300005841 Bacteria 2870
88 Ga0068858_100029490 3300005842 Bacteria 5094
89 Ga0068858_100643532 3300005842 Bacteria 1030
90 Ga0068862_100064959 3300005844 Bacteria 3142
91 Ga0068862_100102661 3300005844 Bacteria 2503
92 Ga0068862_100139886 3300005844 Unclassified 2148
93 Ga0068862_100305154 3300005844 Bacteria 1465
94 Ga0081455_10186263 3300005937 Bacteria 1567
95 Ga0075368_10013719 3300006042 Bacteria 2979
96 Ga0075363_100101695 3300006048 Bacteria 1591
97 Ga0075363_100182451 3300006048 Bacteria 1195
98 Ga0075364_10057016 3300006051 Bacteria 2558
99 Ga0075364_10066476 3300006051 Bacteria 2368
100 Ga0075364_10107190 3300006051 Bacteria 1862
101 Ga0075362_10009124 3300006177 Bacteria 3820
102 Ga0075367_10009993 3300006178 Bacteria 4975
103 Ga0075367_10024102 3300006178 Bacteria 3431
104 Ga0075366_10000066 3300006195 Bacteria 39625
105 Ga0075366_10012924 3300006195 Bacteria 4746
106 Ga0075370_10025597 3300006353 Bacteria 3265
107 Ga0068871_100251018 3300006358 Bacteria 1541
108 Ga0068871_100555688 3300006358 Bacteria 1040
109 Ga0075428_100844930 3300006844 Unclassified 972
110 Ga0075431_100024799 3300006847 Bacteria 6149
111 Ga0075431_100142284 3300006847 Bacteria 2473
112 Ga0075433_10298335 3300006852 Unclassified 1427
113 Ga0075433_10321900 3300006852 Bacteria 1368
114 Ga0075434_100009534 3300006871 Bacteria 9059
115 Ga0075429_100087971 3300006880 Bacteria 2708
116 Ga0097620_100022088 3300006931 Bacteria 6379
117 Ga0097620_100049659 3300006931 Bacteria 4213
118 Ga0097620_100637602 3300006931 Bacteria 1158
119 Ga0075435_100213454 3300007076 Bacteria 1638
120 Ga0111539_10000233 3300009094 Bacteria 66233
121 Ga0111539_10048717 3300009094 Bacteria 5057
122 Ga0111539_10058378 3300009094 Bacteria 4578
123 Ga0111539_10255604 3300009094 Bacteria 2040
124 Ga0111539_10600382 3300009094 Unclassified 1282
125 Ga0111539_11010058 3300009094 Unclassified 967
126 Ga0111539_11409019 3300009094 Unclassified 808
127 Ga0105245_10204366 3300009098 Bacteria 1898
128 Ga0105247_10161887 3300009101 Unclassified 1482
129 Ga0114129_10010845 3300009147 Bacteria 12982
130 Ga0114129_10043267 3300009147 Bacteria 6336
131 Ga0114129_10059424 3300009147 Bacteria 5345
132 Ga0114129_10178778 3300009147 Bacteria 2889
133 Ga0105248_10102385 3300009177 Bacteria 3227
134 Ga0105248_10226864 3300009177 Bacteria 2103
135 Ga0105248_11214911 3300009177 Unclassified 852
136 Ga0105249_10009808 3300009553 Bacteria 8392
137 Ga0105249_10017346 3300009553 Bacteria 6393
138 Ga0105249_10039962 3300009553 Bacteria 4260
139 Ga0105249_10426156 3300009553 Unclassified 1361
140 Ga0157374_10345915 3300013296 Unclassified 1477
141 Ga0163162_10636315 3300013306 Bacteria 1191
142 Ga0157375_10147327 3300013308 Bacteria 2486
143 Ga0157375_10293819 3300013308 Bacteria 1788
144 Ga0157375_12013715 3300013308 Bacteria 686
145 Ga0163163_10360038 3300014325 Unclassified 1511
146 Ga0163163_10434870 3300014325 Unclassified 1371
147 Ga0163163_10654162 3300014325 Bacteria 1114
148 Ga0157380_10000460 3300014326 Bacteria 24851
149 Ga0157380_10617723 3300014326 Bacteria 1075
150 Ga0157377_10071521 3300014745 Unclassified 2006
151 Ga0157377_10305509 3300014745 Bacteria 1051
152 Ga0157377_10398729 3300014745 Unclassified 936
153 Ga0157379_10214671 3300014968 Bacteria 1742
154 Ga0163161_10466952 3300017792 Unclassified 1023
155 Ga0207697_10003067 3300025315 Bacteria 8378
156 Ga0207697_10076585 3300025315 Bacteria 1406
157 Ga0207682_10145212 3300025893 Bacteria 1067
158 Ga0207642_10433048 3300025899 Bacteria 793
159 Ga0207710_10104062 3300025900 Unclassified 1342
160 Ga0207688_10013222 3300025901 Bacteria 4486
161 Ga0207680_10274438 3300025903 Bacteria 1170
162 Ga0207645_10222578 3300025907 Bacteria 1244
163 Ga0207645_10373661 3300025907 Unclassified 956
164 Ga0207684_10432706 3300025910 Bacteria 1130
165 Ga0207660_10456388 3300025917 Bacteria 1034
166 Ga0207646_10123112 3300025922 Bacteria 2331
167 Ga0207646_10676458 3300025922 Unclassified 924
168 Ga0207681_10107147 3300025923 Bacteria 2026
169 Ga0207681_10173374 3300025923 Unclassified 1637
170 Ga0207681_10245704 3300025923 Bacteria 1395
171 Ga0207650_10004057 3300025925 Bacteria 10011
172 Ga0207650_10017319 3300025925 Bacteria 5043
173 Ga0207659_10050256 3300025926 Bacteria 2961
174 Ga0207659_10053382 3300025926 Bacteria 2882
175 Ga0207659_10061816 3300025926 Bacteria 2701
176 Ga0207659_10234559 3300025926 Bacteria 1481
177 Ga0207659_10363288 3300025926 Unclassified 1204
178 Ga0207644_10050471 3300025931 Bacteria 2982
179 Ga0207690_10617603 3300025932 Bacteria 886
180 Ga0207706_10174406 3300025933 Bacteria 1889
181 Ga0207709_10219266 3300025935 Bacteria 1371
182 Ga0207709_10631353 3300025935 Unclassified 851
183 Ga0207670_10529595 3300025936 Bacteria 960
184 Ga0207669_10017354 3300025937 Bacteria 3689
185 Ga0207669_10053808 3300025937 Bacteria 2427
186 Ga0207669_10243513 3300025937 Bacteria 1334
187 Ga0207691_10003826 3300025940 Bacteria 14603
188 Ga0207691_10044444 3300025940 Bacteria 4090
189 Ga0207711_10192820 3300025941 Bacteria 1857
190 Ga0207689_10007495 3300025942 Bacteria 9565
191 Ga0207689_10482902 3300025942 Bacteria 1037
192 Ga0207679_10005397 3300025945 Bacteria 8007
193 Ga0207651_10144244 3300025960 Bacteria 1844
194 Ga0207712_10090090 3300025961 Bacteria 2256
195 Ga0207712_10294864 3300025961 Bacteria 1329
196 Ga0207712_10764466 3300025961 Bacteria 847
197 Ga0207668_10034432 3300025972 Bacteria 3364
198 Ga0207668_10054539 3300025972 Bacteria 2775
199 Ga0207668_10095646 3300025972 Bacteria 2193
200 Ga0207668_10346553 3300025972 Bacteria 1241
201 Ga0207658_10132478 3300025986 Unclassified 2005
202 Ga0207677_10075404 3300026023 Bacteria 2397
203 Ga0207677_10149173 3300026023 Bacteria 1801
204 Ga0207703_10085253 3300026035 Bacteria 2643
205 Ga0207639_10973824 3300026041 Unclassified 794
206 Ga0207678_10040065 3300026067 Bacteria 4063
207 Ga0207678_10042702 3300026067 Bacteria 3926
208 Ga0207678_10150705 3300026067 Bacteria 1985
209 Ga0207708_10409736 3300026075 Bacteria 1122
210 Ga0207641_10132405 3300026088 Bacteria 2240
211 Ga0207641_10906979 3300026088 Unclassified 875
212 Ga0207648_10080886 3300026089 Bacteria 2834
213 Ga0207676_10165056 3300026095 Bacteria 1923
214 Ga0207676_10503957 3300026095 Bacteria 1150
215 Ga0207676_10953108 3300026095 Bacteria 844
216 Ga0207674_10027842 3300026116 Bacteria 5971
217 Ga0207674_10133655 3300026116 Bacteria 2443
218 Ga0207675_100010427 3300026118 Bacteria 8704
219 Ga0207675_100130601 3300026118 Bacteria 2382
220 Ga0207675_100136153 3300026118 Bacteria 2331
221 Ga0207675_100246091 3300026118 Bacteria 1729
222 Ga0207675_100509316 3300026118 Bacteria 1199
223 Ga0207675_101082294 3300026118 Bacteria 821
224 Ga0207675_101226295 3300026118 Bacteria 770
225 Ga0207683_10286202 3300026121 Bacteria 1507
226 Ga0207698_10585632 3300026142 Bacteria 1098
227 Ga0207428_10000279 3300027907 Bacteria 68820
228 Ga0207428_10051857 3300027907 Bacteria 3278
229 Ga0268266_10058707 3300028379 Unclassified 3313
230 Ga0268266_10169768 3300028379 Bacteria 1979
231 Ga0268265_10059207 3300028380 Bacteria 2929
232 Ga0268265_10277354 3300028380 Bacteria 1498
233 Ga0268265_10315882 3300028380 Bacteria 1412
234 Ga0268264_10054613 3300028381 Unclassified 3336
235 Ga0307405_10303056 3300031731 Bacteria 1213
236 Ga0307416_100139297 3300032002 Bacteria 2202
237 Ga0307411_10923095 3300032005 Bacteria 777
238 Ga0373939_0056874 3300035114 Unclassified 1232
239 Ga0373941_0052746 3300035115 Bacteria 1298
240 Ga0373953_0387261 3300035117 Unclassified 615
241 Ga0439439_0062359 3300041406 Bacteria 991
242 Ga0451807_0452566 3300041486 Unclassified 716
243 Ga0451853_1222113 3300041512 Unclassified 1411
244 Ga0439448_0114803 3300042005 Unclassified 922
245 Ga0450896_001789 3300042133 Bacteria 2708
246 Ga0439446_0045761 3300042156 Bacteria 1298
247 Ga0450908_010480 3300042184 Bacteria 1710
248 Ga0439460_0079052 3300042461 Bacteria 1030
249 Ga0450918_004896 3300042531 Bacteria 2420
250 Ga0466967_0108975 3300045976 Bacteria 2542
251 Ga0495594_0214369 3300046499 Bacteria 1098
252 Ga0495586_0123985 3300046535 Bacteria 1444
253 Ga0495599_0136600 3300046678 Bacteria 1522
254 Ga0496104_0098183 3300048907 Bacteria 2803
255 Ga0496105_0057172 3300048908 Bacteria 3221
256 Ga0496108_0044963 3300048911 Bacteria 3687
257 Ga0496108_0429219 3300048911 Bacteria 1154
258 Ga0496109_0030556 3300048912 Bacteria 4828
259 Ga0496110_0000334 3300048913 Bacteria 31443
260 Ga0496111_0005495 3300048914 Bacteria 8135
261 Ga0496112_0064399 3300048915 Unclassified 3617
262 Ga0496113_0091691 3300048916 Bacteria 2343
263 Ga0501036_0299207 3300049572 Bacteria 1346
264 Ga0501036_0460816 3300049572 Bacteria 1059
265 Ga0501038_0205234 3300049574 Bacteria 1580
266 Ga0501071_0088198 3300049587 Bacteria 2276
267 Ga0501075_0499355 3300049591 Bacteria 928
268 Ga0501077_0089011 3300049593 Bacteria 1957
269 Ga0501081_0032389 3300049743 Bacteria 3546
270 Ga0501081_0705975 3300049743 Bacteria 757
271 nmdc:mga03683_38364_c2 3300050489 Bacteria 864
272 nmdc:mga03n38_306465_c1 3300050490 Bacteria 854
273 nmdc:mga00v17_28868_c1 3300050491 Bacteria 3252
274 nmdc:mga0yw44_64488_c1 3300050492 Bacteria 2255
275 nmdc:mga0k408_2845_c1 3300050493 Bacteria 9182
276 nmdc:mga0k408_339709_c1 3300050493 Bacteria 895
277 nmdc:mga0k408_557_c1 3300050493 Bacteria 20509
278 nmdc:mga06z11_124799_c1 3300050494 Bacteria 1440
279 nmdc:mga06z11_19610_c1 3300050494 Bacteria 3113
280 nmdc:mga06z11_62290_c1 3300050494 Bacteria 1948
281 nmdc:mga04h51_5263_c1 3300050495 Bacteria 3286
282 nmdc:mga07m45_34309_c1 3300050496 Bacteria 2820
283 nmdc:mga05p37_1386846_c1 3300050507 Unclassified 709
284 nmdc:mga05p37_4516_c1 3300050507 Bacteria 16267
285 nmdc:mga05p37_49549_c1 3300050507 Bacteria 5166
286 nmdc:mga05p37_66676_c1 3300050507 Bacteria 4427
287 nmdc:mga09592_425613_c1 3300050508 Bacteria 1146
288 nmdc:mga09592_632506_c1 3300050508 Unclassified 915
289 nmdc:mga0qj67_473383_c1 3300050509 Bacteria 1008
290 nmdc:mga0qj67_637698_c1 3300050509 Unclassified 851
291 nmdc:mga06r32_444897_c1 3300050510 Unclassified 1276
292 nmdc:mga06r32_61766_c1 3300050510 Bacteria 3608
293 nmdc:mga06r32_861991_c1 3300050510 Unclassified 864
294 nmdc:mga08y16_176153_c1 3300050511 Bacteria 2221
295 nmdc:mga08y16_391_c1 3300050511 Bacteria 40083
296 nmdc:mga0n895_23854_c1 3300050512 Bacteria 5757
297 nmdc:mga0n895_528057_c1 3300050512 Bacteria 1187
298 nmdc:mga0n895_741580_c1 3300050512 Bacteria 976
299 nmdc:mga0rr50_854147_c1 3300050513 Unclassified 776
300 nmdc:mga08x19_97540_c1 3300050514 Bacteria 1946
301 nmdc:mga0a205_327064_c1 3300050515 Bacteria 1403
302 nmdc:mga0a205_558501_c1 3300050515 Unclassified 1000
303 nmdc:mga0a205_77388_c1 3300050515 Bacteria 3214
304 Ga0500556_0005547 3300053104 Bacteria 3564
305 Ga0590075_000083 3300059424 Bacteria 24188
306 Ga0590077_000452 3300059426 Bacteria 11556
307 Ga0501082_0550213 3300060353 Bacteria 1009
308 Ga0501082_0858717 3300060353 Unclassified 794
309 Ga0530510_0174957 3300061734 Unclassified 1591
310 Ga0530510_0191360 3300061734 Bacteria 1519
311 Ga0207691_10458295
312 Ga0065712_10000364
313 Ga0065712_10081042
314 Ga0065715_10089447
315 Ga0065715_10151225
316 Ga0070676_10118697
317 Ga0070683_100082726
318 Ga0070690_100004599
319 Ga0070670_100002347
320 Ga0070670_100015527
321 Ga0070670_100056920
322 Ga0070670_100250498
323 Ga0070670_100483613
324 Ga0070677_10161346
325 Ga0070666_10545684
326 Ga0070680_100206718
327 Ga0068868_100040152
328 Ga0068868_100559387
329 Ga0070689_100261715
330 Ga0070687_100003949
331 Ga0070668_100326684
332 Ga0070668_100361618
333 Ga0070668_100560969
334 Ga0070669_100073228
335 Ga0070675_100018734
336 Ga0070675_100065214
337 Ga0070675_100308460
338 Ga0070675_100658466
339 Ga0070675_100872551
340 Ga0070674_100005662
341 Ga0070674_100011607
342 Ga0070674_100100388
343 Ga0070674_100286635
344 Ga0070673_100093814
345 Ga0070673_100234896
346 Ga0070688_100002960
347 Ga0070688_100008975
348 Ga0070688_100037704
349 Ga0070667_100053323
350 Ga0070667_100103247
351 Ga0070667_100174671
352 Ga0070701_10053173
353 Ga0070701_10202502
354 Ga0070705_100424381
355 Ga0070700_100133167
356 Ga0070700_100274000
357 Ga0070708_100008038
358 Ga0070663_100049620
359 Ga0070663_100164308
360 Ga0070678_100121955
361 Ga0070678_100309192
362 Ga0070662_100124743
363 Ga0070662_100325615
364 Ga0068867_100198756
365 Ga0070685_10020352
366 Ga0070706_100262369
367 Ga0070699_100005740
368 Ga0070684_100001447
369 Ga0070697_100444440
370 Ga0070697_100466066
371 Ga0070672_100006483
372 Ga0070672_100074266
373 Ga0070686_100534459
374 Ga0070696_100148997
375 Ga0070693_100030442
376 Ga0070665_100020511
377 Ga0070665_100097894
378 Ga0070704_100348007
379 Ga0070704_101189496
380 Ga0070664_100002945
381 Ga0070664_100008122
382 Ga0068857_100122647
383 Ga0068857_100274463
384 Ga0068857_100315442
385 Ga0068852_100476821
386 Ga0068859_100022089
387 Ga0068859_100049656
388 Ga0068859_100637630
389 Ga0068864_100232425
390 Ga0068864_100795940
391 Ga0068866_10087967
392 Ga0068866_10199939
393 Ga0068861_100110509
394 Ga0068861_100122351
395 Ga0068851_10180852
396 Ga0068870_10171417
397 Ga0068863_100092457
398 Ga0068858_100029490
399 Ga0068858_100643532
400 Ga0068862_100064959
401 Ga0068862_100102661
402 Ga0068862_100139886
403 Ga0068862_100305154
404 Ga0081455_10186263
405 Ga0075368_10013719
406 Ga0075363_100101695
407 Ga0075363_100182451
408 Ga0075364_10057016
409 Ga0075364_10066476
410 Ga0075364_10107190
411 Ga0075362_10009124
412 Ga0075367_10009993
413 Ga0075367_10024102
414 Ga0075366_10000066
415 Ga0075366_10012924
416 Ga0075370_10025597
417 Ga0068871_100251018
418 Ga0068871_100555688
419 Ga0075428_100844930
420 Ga0075431_100024799
421 Ga0075431_100142284
422 Ga0075433_10298335
423 Ga0075433_10321900
424 Ga0075434_100009534
425 Ga0075429_100087971
426 Ga0097620_100022088
427 Ga0097620_100049659
428 Ga0097620_100637602
429 Ga0075435_100213454
430 Ga0111539_10000233
431 Ga0111539_10048717
432 Ga0111539_10058378
433 Ga0111539_10255604
434 Ga0111539_10600382
435 Ga0111539_11010058
436 Ga0111539_11409019
437 Ga0105245_10204366
438 Ga0105247_10161887
439 Ga0114129_10010845
440 Ga0114129_10043267
441 Ga0114129_10059424
442 Ga0114129_10178778
443 Ga0105248_10102385
444 Ga0105248_10226864
445 Ga0105248_11214911
446 Ga0105249_10009808
447 Ga0105249_10017346
448 Ga0105249_10039962
449 Ga0105249_10426156
450 Ga0157374_10345915
451 Ga0163162_10636315
452 Ga0157375_10147327
453 Ga0157375_10293819
454 Ga0157375_12013715
455 Ga0163163_10360038
456 Ga0163163_10434870
457 Ga0163163_10654162
458 Ga0157380_10000460
459 Ga0157380_10617723
460 Ga0157377_10071521
461 Ga0157377_10305509
462 Ga0157377_10398729
463 Ga0157379_10214671
464 Ga0163161_10466952
465 Ga0207697_10003067
466 Ga0207697_10076585
467 Ga0207682_10145212
468 Ga0207642_10433048
469 Ga0207710_10104062
470 Ga0207688_10013222
471 Ga0207680_10274438
472 Ga0207645_10222578
473 Ga0207645_10373661
474 Ga0207684_10432706
475 Ga0207660_10456388
476 Ga0207646_10123112
477 Ga0207646_10676458
478 Ga0207681_10107147
479 Ga0207681_10173374
480 Ga0207681_10245704
481 Ga0207650_10004057
482 Ga0207650_10017319
483 Ga0207659_10050256
484 Ga0207659_10053382
485 Ga0207659_10061816
486 Ga0207659_10234559
487 Ga0207659_10363288
488 Ga0207644_10050471
489 Ga0207690_10617603
490 Ga0207706_10174406
491 Ga0207709_10219266
492 Ga0207709_10631353
493 Ga0207670_10529595
494 Ga0207669_10017354
495 Ga0207669_10053808
496 Ga0207669_10243513
497 Ga0207691_10003826
498 Ga0207691_10044444
499 Ga0207711_10192820
500 Ga0207689_10007495
501 Ga0207689_10482902
502 Ga0207679_10005397
503 Ga0207651_10144244
504 Ga0207712_10090090
505 Ga0207712_10294864
506 Ga0207712_10764466
507 Ga0207668_10034432
508 Ga0207668_10054539
509 Ga0207668_10095646
510 Ga0207668_10346553
511 Ga0207658_10132478
512 Ga0207677_10075404
513 Ga0207677_10149173
514 Ga0207703_10085253
515 Ga0207639_10973824
516 Ga0207678_10040065
517 Ga0207678_10042702
518 Ga0207678_10150705
519 Ga0207708_10409736
520 Ga0207641_10132405
521 Ga0207641_10906979
522 Ga0207648_10080886
523 Ga0207676_10165056
524 Ga0207676_10503957
525 Ga0207676_10953108
526 Ga0207674_10027842
527 Ga0207674_10133655
528 Ga0207675_100010427
529 Ga0207675_100130601
530 Ga0207675_100136153
531 Ga0207675_100246091
532 Ga0207675_100509316
533 Ga0207675_101082294
534 Ga0207675_101226295
535 Ga0207683_10286202
536 Ga0207698_10585632
537 Ga0207428_10000279
538 Ga0207428_10051857
539 Ga0268266_10058707
540 Ga0268266_10169768
541 Ga0268265_10059207
542 Ga0268265_10277354
543 Ga0268265_10315882
544 Ga0268264_10054613
545 Ga0307405_10303056
546 Ga0307416_100139297
547 Ga0307411_10923095
548 Ga0373939_0056874
549 Ga0373941_0052746
550 Ga0373953_0387261
551 Ga0439439_0062359
552 Ga0451807_0452566
553 Ga0451853_1222113
554 Ga0439448_0114803
555 Ga0450896_001789
556 Ga0439446_0045761
557 Ga0450908_010480
558 Ga0439460_0079052
559 Ga0450918_004896
560 Ga0466967_0108975
561 Ga0495594_0214369
562 Ga0495586_0123985
563 Ga0495599_0136600
564 Ga0496104_0098183
565 Ga0496105_0057172
566 Ga0496108_0044963
567 Ga0496108_0429219
568 Ga0496109_0030556
569 Ga0496110_0000334
570 Ga0496111_0005495
571 Ga0496112_0064399
572 Ga0496113_0091691
573 Ga0501036_0299207
574 Ga0501036_0460816
575 Ga0501038_0205234
576 Ga0501071_0088198
577 Ga0501075_0499355
578 Ga0501077_0089011
579 Ga0501081_0032389
580 Ga0501081_0705975
581 nmdc:mga03683_38364_c2
582 nmdc:mga03n38_306465_c1
583 nmdc:mga00v17_28868_c1
584 nmdc:mga0yw44_64488_c1
585 nmdc:mga0k408_2845_c1
586 nmdc:mga0k408_339709_c1
587 nmdc:mga0k408_557_c1
588 nmdc:mga06z11_124799_c1
589 nmdc:mga06z11_19610_c1
590 nmdc:mga06z11_62290_c1
591 nmdc:mga04h51_5263_c1
592 nmdc:mga07m45_34309_c1
593 nmdc:mga05p37_1386846_c1
594 nmdc:mga05p37_4516_c1
595 nmdc:mga05p37_49549_c1
596 nmdc:mga05p37_66676_c1
597 nmdc:mga09592_425613_c1
598 nmdc:mga09592_632506_c1
599 nmdc:mga0qj67_473383_c1
600 nmdc:mga0qj67_637698_c1
601 nmdc:mga06r32_444897_c1
602 nmdc:mga06r32_61766_c1
603 nmdc:mga06r32_861991_c1
604 nmdc:mga08y16_176153_c1
605 nmdc:mga08y16_391_c1
606 nmdc:mga0n895_23854_c1
607 nmdc:mga0n895_528057_c1
608 nmdc:mga0n895_741580_c1
609 nmdc:mga0rr50_854147_c1
610 nmdc:mga08x19_97540_c1
611 nmdc:mga0a205_327064_c1
612 nmdc:mga0a205_558501_c1
613 nmdc:mga0a205_77388_c1
614 Ga0500556_0005547
615 Ga0590075_000083
616 Ga0590077_000452
617 Ga0501082_0550213
618 Ga0501082_0858717
619 Ga0530510_0174957
620 Ga0530510_0191360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map