F400595

General Info

Members Datasets Scaffolds Average Seq Length
310 159 310 191

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100002809|Ga0070707_1000028099
Length 199
Sequence MRLISALLFISVSIAAFANLVASAGSKTSAENKAAVESLDRKLSYIQQNGALAHPNSAPTQLTEHEVNAYLASGHVRLPAGVQSLRLRGEPGVITANCRVDFDEFKAGHHSSNPLLSVFSGVHDVVVVAHAHGAGHEGFVHVDSVSLDGVEIPHFALELFVEKYIQPRYPGIGIDSRFALPDKIDTATVGQHQLAVTQK

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.52
Rhizosphere 93.55
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1029052 3300001915 Bacteria 832
2 Ga0070670_100031411 3300005331 Bacteria 4573
3 Ga0068869_100039959 3300005334 Bacteria 3352
4 Ga0068869_100364143 3300005334 Unclassified 1181
5 Ga0070680_100015385 3300005336 Bacteria 5996
6 Ga0070680_100190246 3300005336 Unclassified 1729
7 Ga0070680_100573961 3300005336 Bacteria 967
8 Ga0068868_100008024 3300005338 Bacteria 7547
9 Ga0068868_100033451 3300005338 Bacteria 3963
10 Ga0070691_10049562 3300005341 Unclassified 2001
11 Ga0070661_100049961 3300005344 Unclassified 3061
12 Ga0070675_100148097 3300005354 Unclassified 2011
13 Ga0070671_101039939 3300005355 Unclassified 718
14 Ga0070673_100144616 3300005364 Bacteria 2009
15 Ga0070659_100410425 3300005366 Unclassified 1144
16 Ga0070709_10199723 3300005434 Bacteria 1415
17 Ga0070709_10313978 3300005434 Unclassified 1148
18 Ga0070709_10326552 3300005434 Bacteria 1128
19 Ga0070709_10455006 3300005434 Bacteria 965
20 Ga0070714_100019969 3300005435 Bacteria 5466
21 Ga0070714_100034801 3300005435 Bacteria 4219
22 Ga0070714_100083991 3300005435 Bacteria 2778
23 Ga0070714_100336951 3300005435 Bacteria 1414
24 Ga0070714_100857522 3300005435 Unclassified 881
25 Ga0070713_100011859 3300005436 Bacteria 6369
26 Ga0070713_100025952 3300005436 Bacteria 4591
27 Ga0070713_100036722 3300005436 Bacteria 3956
28 Ga0070713_100251027 3300005436 Bacteria 1613
29 Ga0070713_100304575 3300005436 Bacteria 1468
30 Ga0070713_100313715 3300005436 Unclassified 1447
31 Ga0070713_100435761 3300005436 Bacteria 1229
32 Ga0070710_10021716 3300005437 Unclassified 3350
33 Ga0070710_10063353 3300005437 Bacteria 2112
34 Ga0070711_100000388 3300005439 Bacteria 22701
35 Ga0070711_100194660 3300005439 Bacteria 1560
36 Ga0070708_100025471 3300005445 Bacteria 5057
37 Ga0070708_100052204 3300005445 Unclassified 3625
38 Ga0070708_100054167 3300005445 Bacteria 3562
39 Ga0070681_10000275 3300005458 Bacteria 41301
40 Ga0070681_10072478 3300005458 Unclassified 3407
41 Ga0070681_10562644 3300005458 Bacteria 1054
42 Ga0068867_100032929 3300005459 Bacteria 3750
43 Ga0070685_10065388 3300005466 Unclassified 2140
44 Ga0070706_100073783 3300005467 Bacteria 3159
45 Ga0070707_100002809 3300005468 Bacteria 16553
46 Ga0070707_100114383 3300005468 Bacteria 2618
47 Ga0070707_100202396 3300005468 Bacteria 1935
48 Ga0070699_100563360 3300005518 Bacteria 1037
49 Ga0070679_100105161 3300005530 Unclassified 2809
50 Ga0070684_100109471 3300005535 Unclassified 2476
51 Ga0070684_100326183 3300005535 Bacteria 1411
52 Ga0070697_100000017 3300005536 Bacteria 141440
53 Ga0070697_100225224 3300005536 Bacteria 1598
54 Ga0068853_100244231 3300005539 Unclassified 1646
55 Ga0068855_100000874 3300005563 Bacteria 37439
56 Ga0068855_100004089 3300005563 Bacteria 17795
57 Ga0070664_100028691 3300005564 Bacteria 4632
58 Ga0068857_100001992 3300005577 Bacteria 16555
59 Ga0068857_100005771 3300005577 Bacteria 10583
60 Ga0068854_100000450 3300005578 Bacteria 25444
61 Ga0068856_100004485 3300005614 Bacteria 13888
62 Ga0068856_100015387 3300005614 Bacteria 7393
63 Ga0070702_100073986 3300005615 Bacteria 2020
64 Ga0068859_100018386 3300005617 Bacteria 7026
65 Ga0068864_100002790 3300005618 Bacteria 14425
66 Ga0068864_100529981 3300005618 Unclassified 1136
67 Ga0068866_10019344 3300005718 Bacteria 3098
68 Ga0068861_100051327 3300005719 Unclassified 3131
69 Ga0068851_10134135 3300005834 Unclassified 1341
70 Ga0068870_10049176 3300005840 Bacteria 2223
71 Ga0068863_100061767 3300005841 Bacteria 3543
72 Ga0068858_100059600 3300005842 Bacteria 3528
73 Ga0068858_100197938 3300005842 Unclassified 1899
74 Ga0068860_100475878 3300005843 Unclassified 1244
75 Ga0070717_10001663 3300006028 Bacteria 15455
76 Ga0070717_10007045 3300006028 Bacteria 8325
77 Ga0070717_10020560 3300006028 Bacteria 5194
78 Ga0070717_10053386 3300006028 Bacteria 3331
79 Ga0070716_100037299 3300006173 Bacteria 2685
80 Ga0070716_100356369 3300006173 Unclassified 1037
81 Ga0070716_100362817 3300006173 Unclassified 1029
82 Ga0070716_100600482 3300006173 Unclassified 828
83 Ga0070712_100010782 3300006175 Bacteria 5778
84 Ga0070712_100026028 3300006175 Unclassified 3893
85 Ga0070712_100272986 3300006175 Bacteria 1359
86 Ga0070712_100328348 3300006175 Bacteria 1246
87 Ga0097621_100001001 3300006237 Bacteria 19864
88 Ga0097621_100006868 3300006237 Bacteria 8097
89 Ga0068871_100001422 3300006358 Bacteria 16034
90 Ga0075433_10001006 3300006852 Bacteria 20056
91 Ga0075434_100000206 3300006871 Bacteria 40043
92 Ga0075434_100009935 3300006871 Bacteria 8903
93 Ga0075436_100006727 3300006914 Bacteria 7870
94 Ga0075436_100008676 3300006914 Bacteria 6947
95 Ga0075436_100109923 3300006914 Bacteria 1923
96 Ga0097620_100018387 3300006931 Bacteria 7026
97 Ga0075435_100001924 3300007076 Bacteria 13521
98 Ga0075435_100035113 3300007076 Bacteria 3978
99 Ga0075435_100303802 3300007076 Unclassified 1365
100 Ga0075435_100310211 3300007076 Unclassified 1350
101 Ga0105240_10042772 3300009093 Bacteria 5770
102 Ga0105240_10058945 3300009093 Bacteria 4792
103 Ga0105245_10120101 3300009098 Unclassified 2454
104 Ga0105241_10136284 3300009174 Bacteria 1994
105 Ga0105241_10148110 3300009174 Unclassified 1917
106 Ga0105242_10716817 3300009176 Unclassified 981
107 Ga0105248_10994821 3300009177 Bacteria 947
108 Ga0105238_10015345 3300009551 Bacteria 7758
109 Ga0105238_10199850 3300009551 Bacteria 1974
110 Ga0105239_10039115 3300010375 Bacteria 5197
111 Ga0105239_10189442 3300010375 Bacteria 2303
112 Ga0157373_10049391 3300013100 Unclassified 2998
113 Ga0157373_10390738 3300013100 Unclassified 996
114 Ga0157369_10000924 3300013105 Bacteria 37397
115 Ga0157369_10040990 3300013105 Bacteria 5054
116 Ga0157369_10150976 3300013105 Unclassified 2455
117 Ga0157374_10001049 3300013296 Bacteria 24012
118 Ga0157374_10032830 3300013296 Bacteria 4731
119 Ga0157374_11057702 3300013296 Unclassified 831
120 Ga0157378_10000172 3300013297 Bacteria 61182
121 Ga0157378_10018638 3300013297 Bacteria 6102
122 Ga0157372_10000907 3300013307 Bacteria 32188
123 Ga0157372_10003231 3300013307 Bacteria 17607
124 Ga0157372_10006285 3300013307 Bacteria 12633
125 Ga0157372_10008426 3300013307 Bacteria 10945
126 Ga0157372_11072681 3300013307 Unclassified 932
127 Ga0163163_10050776 3300014325 Bacteria 4086
128 Ga0157376_10051397 3300014969 Unclassified 3423
129 Ga0207697_10138747 3300025315 Unclassified 1054
130 Ga0207692_10007734 3300025898 Bacteria 4416
131 Ga0207692_10208363 3300025898 Unclassified 1153
132 Ga0207699_10138475 3300025906 Bacteria 1597
133 Ga0207699_10180749 3300025906 Bacteria 1418
134 Ga0207699_10218754 3300025906 Unclassified 1299
135 Ga0207699_10539353 3300025906 Bacteria 845
136 Ga0207684_10029309 3300025910 Bacteria 4689
137 Ga0207654_10085558 3300025911 Unclassified 1909
138 Ga0207707_10000434 3300025912 Bacteria 43467
139 Ga0207707_10055023 3300025912 Unclassified 3463
140 Ga0207707_11031693 3300025912 Bacteria 673
141 Ga0207695_10040433 3300025913 Bacteria 4999
142 Ga0207695_10050116 3300025913 Bacteria 4395
143 Ga0207695_10184701 3300025913 Unclassified 2005
144 Ga0207693_10000708 3300025915 Bacteria 29996
145 Ga0207693_10015498 3300025915 Bacteria 6115
146 Ga0207693_10042740 3300025915 Bacteria 3567
147 Ga0207663_10001066 3300025916 Bacteria 12569
148 Ga0207663_10066863 3300025916 Bacteria 2302
149 Ga0207660_10021476 3300025917 Bacteria 4341
150 Ga0207657_10074981 3300025919 Bacteria 2855
151 Ga0207649_10122898 3300025920 Bacteria 1753
152 Ga0207652_10163201 3300025921 Unclassified 1997
153 Ga0207646_10246271 3300025922 Unclassified 1614
154 Ga0207694_10005543 3300025924 Bacteria 9677
155 Ga0207650_10028764 3300025925 Bacteria 3988
156 Ga0207659_10156082 3300025926 Unclassified 1787
157 Ga0207687_10171704 3300025927 Unclassified 1673
158 Ga0207700_10013591 3300025928 Bacteria 5304
159 Ga0207700_10020706 3300025928 Bacteria 4474
160 Ga0207700_10074267 3300025928 Bacteria 2630
161 Ga0207700_10374989 3300025928 Bacteria 1243
162 Ga0207700_10421194 3300025928 Bacteria 1173
163 Ga0207664_10194116 3300025929 Bacteria 1749
164 Ga0207664_10271869 3300025929 Bacteria 1485
165 Ga0207664_10348277 3300025929 Bacteria 1311
166 Ga0207664_10379533 3300025929 Unclassified 1255
167 Ga0207664_10828225 3300025929 Unclassified 832
168 Ga0207644_10954148 3300025931 Unclassified 719
169 Ga0207686_10483928 3300025934 Unclassified 957
170 Ga0207665_10014972 3300025939 Bacteria 5095
171 Ga0207665_10248744 3300025939 Bacteria 1313
172 Ga0207665_10462814 3300025939 Unclassified 975
173 Ga0207665_10530998 3300025939 Unclassified 912
174 Ga0207689_10055319 3300025942 Bacteria 3266
175 Ga0207661_10038919 3300025944 Bacteria 3730
176 Ga0207661_10246332 3300025944 Unclassified 1587
177 Ga0207679_10012015 3300025945 Bacteria 5630
178 Ga0207667_10000813 3300025949 Bacteria 40503
179 Ga0207667_10013976 3300025949 Bacteria 9170
180 Ga0207640_10171669 3300025981 Bacteria 1617
181 Ga0207677_10059963 3300026023 Bacteria 2627
182 Ga0207677_10095391 3300026023 Bacteria 2174
183 Ga0207703_10024797 3300026035 Bacteria 4719
184 Ga0207703_10132733 3300026035 Bacteria 2152
185 Ga0207639_10182117 3300026041 Bacteria 1788
186 Ga0207702_10000207 3300026078 Bacteria 69989
187 Ga0207702_10023680 3300026078 Bacteria 5092
188 Ga0207676_10002218 3300026095 Bacteria 14001
189 Ga0207676_10353189 3300026095 Unclassified 1360
190 Ga0207674_10001055 3300026116 Bacteria 35889
191 Ga0207674_10002939 3300026116 Bacteria 21171
192 Ga0207675_100067401 3300026118 Unclassified 3346
193 Ga0268264_10432114 3300028381 Unclassified 1272
194 Ga0268264_10795072 3300028381 Unclassified 945
195 Ga0265325_10106775 3300031241 Bacteria 1365
196 Ga0373923_0007252 3300035111 Unclassified 3889
197 Ga0373923_0096738 3300035111 Unclassified 1298
198 Ga0373923_0099331 3300035111 Bacteria 1282
199 Ga0373936_0008540 3300035113 Bacteria 3857
200 Ga0373936_0021674 3300035113 Bacteria 2500
201 Ga0373936_0147831 3300035113 Bacteria 1017
202 Ga0373936_0263201 3300035113 Unclassified 772
203 Ga0373945_0002939 3300035116 Bacteria 5353
204 Ga0373945_0016449 3300035116 Bacteria 2495
205 Ga0373956_0168228 3300035119 Unclassified 1034
206 Ga0373943_0038569 3300035170 Bacteria 2298
207 Ga0373943_0047244 3300035170 Unclassified 2104
208 Ga0373943_0048249 3300035170 Bacteria 2085
209 Ga0373943_0526611 3300035170 Unclassified 692
210 Ga0373946_0033163 3300035171 Bacteria 2077
211 Ga0373955_0421570 3300035172 Bacteria 812
212 Ga0373924_0001457 3300035410 Bacteria 7690
213 Ga0373924_0039063 3300035410 Bacteria 1938
214 Ga0373931_0068307 3300035691 Unclassified 1934
215 Ga0373935_0009498 3300035692 Bacteria 5820
216 Ga0373935_0111199 3300035692 Bacteria 1819
217 Ga0373935_0207233 3300035692 Bacteria 1357
218 Ga0373935_0555252 3300035692 Bacteria 837
219 Ga0373927_0049273 3300035695 Bacteria 2724
220 Ga0373927_0077983 3300035695 Bacteria 2146
221 Ga0373927_0175898 3300035695 Unclassified 1403
222 Ga0373927_0259396 3300035695 Bacteria 1143
223 Ga0373927_0286741 3300035695 Bacteria 1083
224 Ga0373927_0738480 3300035695 Unclassified 650
225 Ga0373933_0058376 3300035724 Bacteria 2321
226 Ga0373933_0068251 3300035724 Bacteria 2159
227 Ga0373933_0081363 3300035724 Bacteria 1987
228 Ga0373933_0272353 3300035724 Unclassified 1093
229 Ga0373947_0001410 3300035725 Bacteria 14808
230 Ga0373947_0011889 3300035725 Bacteria 4986
231 Ga0373947_0457806 3300035725 Unclassified 864
232 Ga0373937_0027886 3300036401 Bacteria 5109
233 Ga0373937_0031999 3300036401 Bacteria 4769
234 Ga0373937_0042936 3300036401 Unclassified 4127
235 Ga0373937_0176149 3300036401 Bacteria 2008
236 Ga0373937_0472178 3300036401 Bacteria 1191
237 Ga0373925_0001030 3300037068 Bacteria 25248
238 Ga0373925_0003467 3300037068 Bacteria 12199
239 Ga0373925_0057514 3300037068 Bacteria 2914
240 Ga0373925_0157039 3300037068 Unclassified 1789
241 Ga0373925_0160155 3300037068 Unclassified 1772
242 Ga0373925_1152377 3300037068 Bacteria 637
243 Ga0436364_1440689 3300037853 Unclassified 787
244 Ga0395901_1177503 3300038443 Unclassified 733
245 Ga0436365_1797413 3300039437 Unclassified 710
246 Ga0436363_0788264 3300039450 Bacteria 979
247 Ga0436363_1050186 3300039450 Unclassified 1450
248 Ga0436363_1180220 3300039450 Unclassified 695
249 Ga0436363_1510164 3300039450 Unclassified 1799
250 Ga0436362_0138585 3300039453 Unclassified 1190
251 Ga0466966_0176025 3300044684 Bacteria 1299
252 Ga0466959_0013041 3300045049 Bacteria 6019
253 Ga0451576_0904064 3300045051 Bacteria 926
254 Ga0466958_0163875 3300045836 Bacteria 1406
255 Ga0466967_0023147 3300045976 Bacteria 5086
256 Ga0495580_0000317 3300046472 Bacteria 39453
257 Ga0495580_0011395 3300046472 Bacteria 6880
258 Ga0495580_0016869 3300046472 Bacteria 5476
259 Ga0495580_0049076 3300046472 Unclassified 2986
260 Ga0495582_0038201 3300046473 Bacteria 2641
261 Ga0495639_0081428 3300046475 Bacteria 1509
262 Ga0495594_0065255 3300046499 Unclassified 2019
263 Ga0495630_0151791 3300046517 Bacteria 1763
264 Ga0495630_0178342 3300046517 Bacteria 1620
265 Ga0495665_0000423 3300046531 Bacteria 21589
266 Ga0495665_0178278 3300046531 Bacteria 1105
267 Ga0495665_0308133 3300046531 Unclassified 810
268 Ga0495667_0293021 3300046559 Unclassified 1032
269 Ga0495588_0228742 3300046674 Bacteria 981
270 Ga0495623_0075487 3300046679 Bacteria 2093
271 Ga0495658_0383402 3300046683 Bacteria 895
272 Ga0495604_0054541 3300047317 Bacteria 3084
273 Ga0495674_0047580 3300047319 Bacteria 3802
274 Ga0495674_0283077 3300047319 Unclassified 1358
275 Ga0495674_0304614 3300047319 Bacteria 1301
276 Ga0495674_1251510 3300047319 Unclassified 559
277 Ga0495675_0020484 3300047444 Bacteria 4207
278 Ga0495593_0099233 3300047673 Unclassified 1495
279 Ga0495602_0062165 3300048088 Bacteria 3241
280 Ga0495602_0126186 3300048088 Bacteria 2050
281 Ga0495602_0176593 3300048088 Unclassified 1652
282 Ga0496102_0010511 3300048905 Bacteria 7969
283 Ga0496102_0147289 3300048905 Bacteria 2210
284 Ga0496102_0379558 3300048905 Unclassified 1330
285 Ga0496104_0062781 3300048907 Bacteria 3523
286 Ga0496104_0117381 3300048907 Bacteria 2554
287 Ga0496105_0087869 3300048908 Unclassified 2568
288 Ga0496106_0641128 3300048909 Bacteria 849
289 Ga0496110_0102539 3300048913 Bacteria 2566
290 Ga0496111_0019131 3300048914 Bacteria 4752
291 Ga0496112_0004611 3300048915 Bacteria 11724
292 Ga0496112_0010363 3300048915 Bacteria 8452
293 Ga0496113_0032988 3300048916 Bacteria 3766
294 Ga0496113_0244213 3300048916 Bacteria 1433
295 Ga0496115_0036681 3300048918 Unclassified 3883
296 Ga0501083_0105449 3300049744 Bacteria 1856
297 Ga0501083_0202952 3300049744 Bacteria 1293
298 nmdc:mga0n895_1948_c1 3300050512 Bacteria 15852
299 nmdc:mga0n895_25254_c1 3300050512 Bacteria 5611
300 nmdc:mga0n895_578480_c1 3300050512 Bacteria 1127
301 nmdc:mga0rr50_153745_c1 3300050513 Bacteria 1862
302 nmdc:mga0rr50_5242_c1 3300050513 Bacteria 7713
303 nmdc:mga0rr50_561568_c1 3300050513 Unclassified 972
304 nmdc:mga08x19_15292_c1 3300050514 Bacteria 4668
305 nmdc:mga08x19_33653_c1 3300050514 Bacteria 3235
306 nmdc:mga08x19_999_c2 3300050514 Bacteria 7072
307 nmdc:mga0a205_700_c1 3300050515 Bacteria 26835
308 Ga0495601_0004885 3300053077 Bacteria 7782
309 Ga0495601_0342255 3300053077 Unclassified 973
310 Ga0495619_0116943 3300053085 Bacteria 1826

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10390738 Ga0157373_103907382 153
2 3300013105 Ga0157369_10150976 Ga0157369_101509762 153
3 3300013307 Ga0157372_10003231 Ga0157372_100032319 153
4 3300005445 Ga0070708_100052204 Ga0070708_1000522042 161
5 3300005468 Ga0070707_100202396 Ga0070707_1002023963 161
6 3300035695 Ga0373927_0077983 Ga0373927_0077983_166_651 161
7 3300037068 Ga0373925_0057514 Ga0373925_0057514_284_769 161
8 3300037068 Ga0373925_1152377 Ga0373925_1152377_25_510 161
9 3300038443 Ga0395901_1177503 Ga0395901_1177503_201_686 161
10 3300045976 Ga0466967_0023147 Ga0466967_0023147_1894_2379 161
11 3300046517 Ga0495630_0151791 Ga0495630_0151791_905_1390 161
12 3300046531 Ga0495665_0308133 Ga0495665_0308133_176_661 161
13 3300047319 Ga0495674_1251510 Ga0495674_1251510_62_547 161
14 3300005435 Ga0070714_100083991 Ga0070714_1000839912 164
15 3300009093 Ga0105240_10058945 Ga0105240_100589452 164
16 3300013105 Ga0157369_10040990 Ga0157369_100409904 164
17 3300025913 Ga0207695_10050116 Ga0207695_100501165 164
18 3300035724 Ga0373933_0058376 Ga0373933_0058376_241_813 167
19 3300036401 Ga0373937_0042936 Ga0373937_0042936_3531_4103 167
20 3300048088 Ga0495602_0126186 Ga0495602_0126186_735_1307 167
21 3300048088 Ga0495602_0062165 Ga0495602_0062165_176_748 168
22 3300013307 Ga0157372_11072681 Ga0157372_110726813 169
23 3300049744 Ga0501083_0105449 Ga0501083_0105449_742_1287 169
24 3300049744 Ga0501083_0202952 Ga0501083_0202952_536_1069 169
25 3300009174 Ga0105241_10136284 Ga0105241_101362842 170
26 3300009176 Ga0105242_10716817 Ga0105242_107168171 170
27 3300009177 Ga0105248_10994821 Ga0105248_109948212 170
28 3300009551 Ga0105238_10199850 Ga0105238_101998502 170
29 3300010375 Ga0105239_10189442 Ga0105239_101894422 170
30 3300013307 Ga0157372_10008426 Ga0157372_100084262 170
31 3300014325 Ga0163163_10050776 Ga0163163_100507763 170
32 3300025942 Ga0207689_10055319 Ga0207689_100553191 170
33 3300035691 Ga0373931_0068307 Ga0373931_0068307_402_938 170
34 3300005435 Ga0070714_100034801 Ga0070714_1000348012 171
35 3300005435 Ga0070714_100857522 Ga0070714_1008575221 171
36 3300006173 Ga0070716_100362817 Ga0070716_1003628171 171
37 3300013307 Ga0157372_10006285 Ga0157372_1000628511 171
38 3300025913 Ga0207695_10184701 Ga0207695_101847012 171
39 3300025929 Ga0207664_10379533 Ga0207664_103795331 171
40 3300025939 Ga0207665_10462814 Ga0207665_104628142 172
41 3300005445 Ga0070708_100025471 Ga0070708_1000254713 173
42 3300005467 Ga0070706_100073783 Ga0070706_1000737832 173
43 3300025910 Ga0207684_10029309 Ga0207684_100293094 173
44 3300035410 Ga0373924_0039063 Ga0373924_0039063_419_1018 173
45 3300035724 Ga0373933_0272353 Ga0373933_0272353_23_631 174
46 3300039450 Ga0436363_0788264 Ga0436363_0788264_401_961 174
47 3300005434 Ga0070709_10455006 Ga0070709_104550061 175
48 3300005435 Ga0070714_100019969 Ga0070714_1000199694 175
49 3300005436 Ga0070713_100011859 Ga0070713_1000118594 175
50 3300005436 Ga0070713_100313715 Ga0070713_1003137151 175
51 3300006028 Ga0070717_10007045 Ga0070717_100070456 175
52 3300006028 Ga0070717_10020560 Ga0070717_100205602 175
53 3300025906 Ga0207699_10180749 Ga0207699_101807492 175
54 3300025928 Ga0207700_10020706 Ga0207700_100207062 175
55 3300035113 Ga0373936_0008540 Ga0373936_0008540_3197_3772 175
56 3300035116 Ga0373945_0016449 Ga0373945_0016449_1480_2055 175
57 3300035170 Ga0373943_0047244 Ga0373943_0047244_1290_1865 175
58 3300035692 Ga0373935_0207233 Ga0373935_0207233_690_1265 175
59 3300035695 Ga0373927_0259396 Ga0373927_0259396_550_1125 175
60 3300037068 Ga0373925_0160155 Ga0373925_0160155_1056_1631 175
61 3300005436 Ga0070713_100025952 Ga0070713_1000259522 176
62 3300006175 Ga0070712_100328348 Ga0070712_1003283482 176
63 3300025928 Ga0207700_10074267 Ga0207700_100742672 176
64 3300035695 Ga0373927_0738480 Ga0373927_0738480_52_603 176
65 3300050512 nmdc:mga0n895_578480_c1 nmdc:mga0n895_578480_c1_15_566 176
66 3300037853 Ga0436364_1440689 Ga0436364_1440689_145_729 178
67 3300039437 Ga0436365_1797413 Ga0436365_1797413_78_662 178
68 3300045051 Ga0451576_0904064 Ga0451576_0904064_218_778 178
69 3300006173 Ga0070716_100600482 Ga0070716_1006004822 179
70 3300025939 Ga0207665_10530998 Ga0207665_105309982 179
71 3300035170 Ga0373943_0526611 Ga0373943_0526611_48_623 179
72 3300035692 Ga0373935_0555252 Ga0373935_0555252_13_588 179
73 3300039450 Ga0436363_1050186 Ga0436363_1050186_27_599 180
74 3300005336 Ga0070680_100573961 Ga0070680_1005739611 181
75 3300005435 Ga0070714_100336951 Ga0070714_1003369512 181
76 3300005458 Ga0070681_10562644 Ga0070681_105626442 181
77 3300005468 Ga0070707_100002809 Ga0070707_1000028099 181
78 3300005518 Ga0070699_100563360 Ga0070699_1005633601 181
79 3300005536 Ga0070697_100000017 Ga0070697_10000001786 181
80 3300005536 Ga0070697_100225224 Ga0070697_1002252242 181
81 3300006852 Ga0075433_10001006 Ga0075433_1000100617 181
82 3300006871 Ga0075434_100000206 Ga0075434_10000020624 181
83 3300006914 Ga0075436_100006727 Ga0075436_1000067274 181
84 3300006914 Ga0075436_100008676 Ga0075436_1000086768 181
85 3300007076 Ga0075435_100001924 Ga0075435_10000192412 181
86 3300007076 Ga0075435_100303802 Ga0075435_1003038022 181
87 3300007076 Ga0075435_100310211 Ga0075435_1003102112 181
88 3300013296 Ga0157374_11057702 Ga0157374_110577021 181
89 3300025912 Ga0207707_11031693 Ga0207707_110316931 181
90 3300025922 Ga0207646_10246271 Ga0207646_102462712 181
91 3300025929 Ga0207664_10348277 Ga0207664_103482772 181
92 3300031241 Ga0265325_10106775 Ga0265325_101067752 181
93 3300036401 Ga0373937_0176149 Ga0373937_0176149_105_686 181
94 3300039450 Ga0436363_1510164 Ga0436363_1510164_134_694 181
95 3300044684 Ga0466966_0176025 Ga0466966_0176025_370_939 181
96 3300045049 Ga0466959_0013041 Ga0466959_0013041_892_1467 181
97 3300045836 Ga0466958_0163875 Ga0466958_0163875_75_647 181
98 3300046472 Ga0495580_0016869 Ga0495580_0016869_1292_1870 181
99 3300050512 nmdc:mga0n895_1948_c1 nmdc:mga0n895_1948_c1_3765_4346 181
100 3300050513 nmdc:mga0rr50_5242_c1 nmdc:mga0rr50_5242_c1_5279_5860 181
101 3300050513 nmdc:mga0rr50_561568_c1 nmdc:mga0rr50_561568_c1_120_710 181
102 3300050514 nmdc:mga08x19_15292_c1 nmdc:mga08x19_15292_c1_481_1062 181
103 3300050514 nmdc:mga08x19_999_c2 nmdc:mga08x19_999_c2_3998_4576 181
104 3300050515 nmdc:mga0a205_700_c1 nmdc:mga0a205_700_c1_7834_8415 181
105 3300005434 Ga0070709_10199723 Ga0070709_101997232 182
106 3300005436 Ga0070713_100036722 Ga0070713_1000367223 182
107 3300005437 Ga0070710_10063353 Ga0070710_100633532 182
108 3300005439 Ga0070711_100194660 Ga0070711_1001946602 182
109 3300005445 Ga0070708_100054167 Ga0070708_1000541672 182
110 3300005468 Ga0070707_100114383 Ga0070707_1001143832 182
111 3300006028 Ga0070717_10001663 Ga0070717_100016638 182
112 3300006175 Ga0070712_100026028 Ga0070712_1000260282 182
113 3300006175 Ga0070712_100272986 Ga0070712_1002729861 182
114 3300006871 Ga0075434_100009935 Ga0075434_1000099356 182
115 3300025906 Ga0207699_10539353 Ga0207699_105393532 182
116 3300025915 Ga0207693_10015498 Ga0207693_100154983 182
117 3300025929 Ga0207664_10271869 Ga0207664_102718691 182
118 3300025939 Ga0207665_10248744 Ga0207665_102487441 182
119 3300035111 Ga0373923_0007252 Ga0373923_0007252_821_1453 182
120 3300035113 Ga0373936_0147831 Ga0373936_0147831_159_773 182
121 3300035113 Ga0373936_0263201 Ga0373936_0263201_61_693 182
122 3300035116 Ga0373945_0002939 Ga0373945_0002939_3232_3846 182
123 3300035119 Ga0373956_0168228 Ga0373956_0168228_376_1002 182
124 3300035170 Ga0373943_0048249 Ga0373943_0048249_589_1203 182
125 3300035171 Ga0373946_0033163 Ga0373946_0033163_556_1170 182
126 3300035410 Ga0373924_0001457 Ga0373924_0001457_3559_4173 182
127 3300035692 Ga0373935_0111199 Ga0373935_0111199_302_934 182
128 3300035695 Ga0373927_0175898 Ga0373927_0175898_580_1194 182
129 3300035724 Ga0373933_0068251 Ga0373933_0068251_1223_1849 182
130 3300035725 Ga0373947_0011889 Ga0373947_0011889_3391_4005 182
131 3300035725 Ga0373947_0457806 Ga0373947_0457806_31_663 182
132 3300036401 Ga0373937_0031999 Ga0373937_0031999_1129_1755 182
133 3300036401 Ga0373937_0472178 Ga0373937_0472178_507_1139 182
134 3300037068 Ga0373925_0003467 Ga0373925_0003467_10112_10744 182
135 3300037068 Ga0373925_0157039 Ga0373925_0157039_1081_1695 182
136 3300039453 Ga0436362_0138585 Ga0436362_0138585_12_575 182
137 3300046499 Ga0495594_0065255 Ga0495594_0065255_1325_1957 182
138 3300047673 Ga0495593_0099233 Ga0495593_0099233_869_1483 182
139 3300048905 Ga0496102_0147289 Ga0496102_0147289_411_1040 182
140 3300048907 Ga0496104_0062781 Ga0496104_0062781_631_1245 182
141 3300048908 Ga0496105_0087869 Ga0496105_0087869_1159_1773 182
142 3300048913 Ga0496110_0102539 Ga0496110_0102539_1170_1784 182
143 3300048914 Ga0496111_0019131 Ga0496111_0019131_3673_4290 182
144 3300048915 Ga0496112_0004611 Ga0496112_0004611_10942_11556 182
145 3300048916 Ga0496113_0032988 Ga0496113_0032988_2526_3140 182
146 3300050512 nmdc:mga0n895_25254_c1 nmdc:mga0n895_25254_c1_1742_2371 182
147 3300053085 Ga0495619_0116943 Ga0495619_0116943_1009_1623 182
148 3300005437 Ga0070710_10021716 Ga0070710_100217162 183
149 3300005439 Ga0070711_100000388 Ga0070711_10000038814 183
150 3300006028 Ga0070717_10053386 Ga0070717_100533862 183
151 3300006175 Ga0070712_100010782 Ga0070712_1000107824 183
152 3300025898 Ga0207692_10208363 Ga0207692_102083632 183
153 3300025906 Ga0207699_10218754 Ga0207699_102187542 183
154 3300025915 Ga0207693_10000708 Ga0207693_1000070817 183
155 3300025916 Ga0207663_10001066 Ga0207663_1000106611 183
156 3300025928 Ga0207700_10013591 Ga0207700_100135912 183
157 3300047317 Ga0495604_0054541 Ga0495604_0054541_2326_2946 183
158 3300048905 Ga0496102_0379558 Ga0496102_0379558_355_927 183
159 3300048907 Ga0496104_0117381 Ga0496104_0117381_531_1103 183
160 3300048909 Ga0496106_0641128 Ga0496106_0641128_224_796 183
161 3300048915 Ga0496112_0010363 Ga0496112_0010363_3334_3906 183
162 3300048916 Ga0496113_0244213 Ga0496113_0244213_231_803 183
163 3300048918 Ga0496115_0036681 Ga0496115_0036681_173_745 183
164 3300053077 Ga0495601_0004885 Ga0495601_0004885_4808_5428 183
165 3300053077 Ga0495601_0342255 Ga0495601_0342255_233_853 183
166 3300005434 Ga0070709_10326552 Ga0070709_103265522 184
167 3300005436 Ga0070713_100251027 Ga0070713_1002510272 184
168 3300006173 Ga0070716_100037299 Ga0070716_1000372993 184
169 3300006914 Ga0075436_100109923 Ga0075436_1001099232 184
170 3300007076 Ga0075435_100035113 Ga0075435_1000351132 184
171 3300025898 Ga0207692_10007734 Ga0207692_100077344 184
172 3300025906 Ga0207699_10138475 Ga0207699_101384752 184
173 3300025915 Ga0207693_10042740 Ga0207693_100427402 184
174 3300025916 Ga0207663_10066863 Ga0207663_100668632 184
175 3300025928 Ga0207700_10374989 Ga0207700_103749892 184
176 3300025929 Ga0207664_10194116 Ga0207664_101941162 184
177 3300025939 Ga0207665_10014972 Ga0207665_100149722 184
178 3300035111 Ga0373923_0099331 Ga0373923_0099331_244_819 184
179 3300035113 Ga0373936_0021674 Ga0373936_0021674_1649_2224 184
180 3300035170 Ga0373943_0038569 Ga0373943_0038569_175_750 184
181 3300035692 Ga0373935_0009498 Ga0373935_0009498_1437_2012 184
182 3300035695 Ga0373927_0286741 Ga0373927_0286741_277_852 184
183 3300035725 Ga0373947_0001410 Ga0373947_0001410_4903_5478 184
184 3300037068 Ga0373925_0001030 Ga0373925_0001030_18083_18658 184
185 3300046472 Ga0495580_0011395 Ga0495580_0011395_947_1522 184
186 3300046473 Ga0495582_0038201 Ga0495582_0038201_1899_2474 184
187 3300046475 Ga0495639_0081428 Ga0495639_0081428_74_649 184
188 3300046517 Ga0495630_0178342 Ga0495630_0178342_630_1205 184
189 3300046531 Ga0495665_0000423 Ga0495665_0000423_3977_4552 184
190 3300046674 Ga0495588_0228742 Ga0495588_0228742_147_722 184
191 3300046683 Ga0495658_0383402 Ga0495658_0383402_137_712 184
192 3300047319 Ga0495674_0047580 Ga0495674_0047580_122_697 184
193 3300050513 nmdc:mga0rr50_153745_c1 nmdc:mga0rr50_153745_c1_1097_1672 184
194 3300050514 nmdc:mga08x19_33653_c1 nmdc:mga08x19_33653_c1_2237_2812 184
195 3300005434 Ga0070709_10313978 Ga0070709_103139782 185
196 3300006173 Ga0070716_100356369 Ga0070716_1003563692 185
197 3300035695 Ga0373927_0049273 Ga0373927_0049273_1662_2255 185
198 3300046472 Ga0495580_0000317 Ga0495580_0000317_12430_13023 185
199 3300048905 Ga0496102_0010511 Ga0496102_0010511_2223_2813 185
200 3300001915 JGI24741J21665_1029052 JGI24741J21665_10290522 187
201 3300005331 Ga0070670_100031411 Ga0070670_1000314114 187
202 3300005334 Ga0068869_100039959 Ga0068869_1000399591 187
203 3300005334 Ga0068869_100364143 Ga0068869_1003641431 187
204 3300005336 Ga0070680_100015385 Ga0070680_1000153852 187
205 3300005336 Ga0070680_100190246 Ga0070680_1001902462 187
206 3300005338 Ga0068868_100008024 Ga0068868_1000080242 187
207 3300005338 Ga0068868_100033451 Ga0068868_1000334512 187
208 3300005341 Ga0070691_10049562 Ga0070691_100495623 187
209 3300005344 Ga0070661_100049961 Ga0070661_1000499612 187
210 3300005354 Ga0070675_100148097 Ga0070675_1001480972 187
211 3300005355 Ga0070671_101039939 Ga0070671_1010399391 187
212 3300005364 Ga0070673_100144616 Ga0070673_1001446162 187
213 3300005366 Ga0070659_100410425 Ga0070659_1004104252 187
214 3300005436 Ga0070713_100304575 Ga0070713_1003045752 187
215 3300005436 Ga0070713_100435761 Ga0070713_1004357613 187
216 3300005458 Ga0070681_10000275 Ga0070681_1000027523 187
217 3300005458 Ga0070681_10072478 Ga0070681_100724782 187
218 3300005459 Ga0068867_100032929 Ga0068867_1000329293 187
219 3300005466 Ga0070685_10065388 Ga0070685_100653882 187
220 3300005530 Ga0070679_100105161 Ga0070679_1001051612 187
221 3300005535 Ga0070684_100109471 Ga0070684_1001094711 187
222 3300005535 Ga0070684_100326183 Ga0070684_1003261832 187
223 3300005539 Ga0068853_100244231 Ga0068853_1002442312 187
224 3300005563 Ga0068855_100000874 Ga0068855_10000087432 187
225 3300005563 Ga0068855_100004089 Ga0068855_10000408914 187
226 3300005564 Ga0070664_100028691 Ga0070664_1000286915 187
227 3300005577 Ga0068857_100001992 Ga0068857_1000019926 187
228 3300005577 Ga0068857_100005771 Ga0068857_1000057717 187
229 3300005578 Ga0068854_100000450 Ga0068854_1000004502 187
230 3300005614 Ga0068856_100004485 Ga0068856_1000044858 187
231 3300005614 Ga0068856_100015387 Ga0068856_1000153872 187
232 3300005615 Ga0070702_100073986 Ga0070702_1000739862 187
233 3300005617 Ga0068859_100018386 Ga0068859_1000183866 187
234 3300005618 Ga0068864_100002790 Ga0068864_1000027907 187
235 3300005618 Ga0068864_100529981 Ga0068864_1005299811 187
236 3300005718 Ga0068866_10019344 Ga0068866_100193443 187
237 3300005719 Ga0068861_100051327 Ga0068861_1000513272 187
238 3300005834 Ga0068851_10134135 Ga0068851_101341351 187
239 3300005840 Ga0068870_10049176 Ga0068870_100491762 187
240 3300005841 Ga0068863_100061767 Ga0068863_1000617673 187
241 3300005842 Ga0068858_100059600 Ga0068858_1000596002 187
242 3300005842 Ga0068858_100197938 Ga0068858_1001979382 187
243 3300005843 Ga0068860_100475878 Ga0068860_1004758782 187
244 3300006237 Ga0097621_100001001 Ga0097621_10000100115 187
245 3300006237 Ga0097621_100006868 Ga0097621_1000068682 187
246 3300006358 Ga0068871_100001422 Ga0068871_1000014227 187
247 3300006931 Ga0097620_100018387 Ga0097620_1000183876 187
248 3300009093 Ga0105240_10042772 Ga0105240_100427726 187
249 3300009098 Ga0105245_10120101 Ga0105245_101201012 187
250 3300009174 Ga0105241_10148110 Ga0105241_101481101 187
251 3300009551 Ga0105238_10015345 Ga0105238_100153452 187
252 3300010375 Ga0105239_10039115 Ga0105239_100391156 187
253 3300013100 Ga0157373_10049391 Ga0157373_100493912 187
254 3300013105 Ga0157369_10000924 Ga0157369_100009247 187
255 3300013296 Ga0157374_10001049 Ga0157374_100010498 187
256 3300013296 Ga0157374_10032830 Ga0157374_100328304 187
257 3300013297 Ga0157378_10000172 Ga0157378_1000017249 187
258 3300013297 Ga0157378_10018638 Ga0157378_100186384 187
259 3300013307 Ga0157372_10000907 Ga0157372_1000090729 187
260 3300014969 Ga0157376_10051397 Ga0157376_100513973 187
261 3300025315 Ga0207697_10138747 Ga0207697_101387472 187
262 3300025911 Ga0207654_10085558 Ga0207654_100855582 187
263 3300025912 Ga0207707_10000434 Ga0207707_1000043423 187
264 3300025912 Ga0207707_10055023 Ga0207707_100550232 187
265 3300025913 Ga0207695_10040433 Ga0207695_100404332 187
266 3300025917 Ga0207660_10021476 Ga0207660_100214765 187
267 3300025919 Ga0207657_10074981 Ga0207657_100749812 187
268 3300025920 Ga0207649_10122898 Ga0207649_101228982 187
269 3300025921 Ga0207652_10163201 Ga0207652_101632011 187
270 3300025924 Ga0207694_10005543 Ga0207694_100055432 187
271 3300025925 Ga0207650_10028764 Ga0207650_100287644 187
272 3300025926 Ga0207659_10156082 Ga0207659_101560821 187
273 3300025927 Ga0207687_10171704 Ga0207687_101717042 187
274 3300025928 Ga0207700_10421194 Ga0207700_104211942 187
275 3300025929 Ga0207664_10828225 Ga0207664_108282252 187
276 3300025931 Ga0207644_10954148 Ga0207644_109541481 187
277 3300025934 Ga0207686_10483928 Ga0207686_104839281 187
278 3300025944 Ga0207661_10038919 Ga0207661_100389194 187
279 3300025944 Ga0207661_10246332 Ga0207661_102463321 187
280 3300025945 Ga0207679_10012015 Ga0207679_100120152 187
281 3300025949 Ga0207667_10000813 Ga0207667_1000081330 187
282 3300025949 Ga0207667_10013976 Ga0207667_100139762 187
283 3300025981 Ga0207640_10171669 Ga0207640_101716692 187
284 3300026023 Ga0207677_10059963 Ga0207677_100599632 187
285 3300026023 Ga0207677_10095391 Ga0207677_100953912 187
286 3300026035 Ga0207703_10024797 Ga0207703_100247975 187
287 3300026035 Ga0207703_10132733 Ga0207703_101327332 187
288 3300026041 Ga0207639_10182117 Ga0207639_101821172 187
289 3300026078 Ga0207702_10000207 Ga0207702_1000020744 187
290 3300026078 Ga0207702_10023680 Ga0207702_100236802 187
291 3300026095 Ga0207676_10002218 Ga0207676_100022187 187
292 3300026095 Ga0207676_10353189 Ga0207676_103531892 187
293 3300026116 Ga0207674_10001055 Ga0207674_100010559 187
294 3300026116 Ga0207674_10002939 Ga0207674_100029398 187
295 3300026118 Ga0207675_100067401 Ga0207675_1000674011 187
296 3300028381 Ga0268264_10432114 Ga0268264_104321142 187
297 3300028381 Ga0268264_10795072 Ga0268264_107950722 187
298 3300035111 Ga0373923_0096738 Ga0373923_0096738_339_923 187
299 3300035172 Ga0373955_0421570 Ga0373955_0421570_96_791 187
300 3300035724 Ga0373933_0081363 Ga0373933_0081363_1390_1977 187
301 3300036401 Ga0373937_0027886 Ga0373937_0027886_2816_3403 187
302 3300039450 Ga0436363_1180220 Ga0436363_1180220_56_649 187
303 3300046472 Ga0495580_0049076 Ga0495580_0049076_1104_1688 187
304 3300046531 Ga0495665_0178278 Ga0495665_0178278_181_765 187
305 3300046559 Ga0495667_0293021 Ga0495667_0293021_92_679 187
306 3300046679 Ga0495623_0075487 Ga0495623_0075487_157_744 187
307 3300047319 Ga0495674_0283077 Ga0495674_0283077_534_1121 187
308 3300047319 Ga0495674_0304614 Ga0495674_0304614_132_716 187
309 3300047444 Ga0495675_0020484 Ga0495675_0020484_39_626 187
310 3300048088 Ga0495602_0176593 Ga0495602_0176593_867_1454 187

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lyg-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_270605.1) from colwellia psychrerythraea 34h at 1.61 a resolution 0.816 68 118
6cib-assembly2.cif.gz_B the structure of ycao from methanopyrus kandleri bound with amppcp and mg2+ 0.7243 69 116
6ci7-assembly4.cif.gz_D the structure of ycao from methanopyrus kandleri bound with amppcp and mg2+ 0.7161 69 116
6ci7-assembly3.cif.gz_C the structure of ycao from methanopyrus kandleri bound with amppcp and mg2+ 0.712 69 116
3bb9-assembly1.cif.gz_A crystal structure of a putative ketosteroid isomerase (sfri_1973) from shewanella frigidimarina ncimb 400 at 1.80 a resolution 0.6499 67 118
ID Description Score Start End Superfamily
3lygA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7913 68 118 3.10.450.50
af_Q9VX49_71_188_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6764 75 141 2.60.40.10
af_Q4DMN6_24_172_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.6721 70 116 2.40.10.500
af_A0A1D6IKJ9_98_253_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.6618 76 138 3.30.530.20
af_Q8I0K2_88_203_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6211 75 141 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2V9N2P8-F1-model_v4 Uncharacterized protein 0.9373 71 187
AF-A0A2V9N2P8-F1-model_v4 Uncharacterized protein 0.9298 71 187
AF-A0A2V9S089-F1-model_v4 Uncharacterized protein 0.9175 23 187
AF-A0A2V9TKA3-F1-model_v4 Uncharacterized protein 0.9039 28 187
AF-A0A2V9TKA3-F1-model_v4 Uncharacterized protein 0.8934 28 187

Feature Viewer

pLDDT pTM Quality
87.36 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map