F400595
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 310 | 159 | 310 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100002809|Ga0070707_1000028099 |
| Length | 199 |
| Sequence | MRLISALLFISVSIAAFANLVASAGSKTSAENKAAVESLDRKLSYIQQNGALAHPNSAPTQLTEHEVNAYLASGHVRLPAGVQSLRLRGEPGVITANCRVDFDEFKAGHHSSNPLLSVFSGVHDVVVVAHAHGAGHEGFVHVDSVSLDGVEIPHFALELFVEKYIQPRYPGIGIDSRFALPDKIDTATVGQHQLAVTQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 104 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 105 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 106 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 107 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 108 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 109 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 110 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 111 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 112 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 115 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 117 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 120 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 121 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 122 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 123 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 124 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 125 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 126 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 127 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 128 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 129 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 145 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 146 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 147 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 148 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 149 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.52 |
| Rhizosphere | 93.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1029052 | 3300001915 | Bacteria | 832 |
| 2 | Ga0070670_100031411 | 3300005331 | Bacteria | 4573 |
| 3 | Ga0068869_100039959 | 3300005334 | Bacteria | 3352 |
| 4 | Ga0068869_100364143 | 3300005334 | Unclassified | 1181 |
| 5 | Ga0070680_100015385 | 3300005336 | Bacteria | 5996 |
| 6 | Ga0070680_100190246 | 3300005336 | Unclassified | 1729 |
| 7 | Ga0070680_100573961 | 3300005336 | Bacteria | 967 |
| 8 | Ga0068868_100008024 | 3300005338 | Bacteria | 7547 |
| 9 | Ga0068868_100033451 | 3300005338 | Bacteria | 3963 |
| 10 | Ga0070691_10049562 | 3300005341 | Unclassified | 2001 |
| 11 | Ga0070661_100049961 | 3300005344 | Unclassified | 3061 |
| 12 | Ga0070675_100148097 | 3300005354 | Unclassified | 2011 |
| 13 | Ga0070671_101039939 | 3300005355 | Unclassified | 718 |
| 14 | Ga0070673_100144616 | 3300005364 | Bacteria | 2009 |
| 15 | Ga0070659_100410425 | 3300005366 | Unclassified | 1144 |
| 16 | Ga0070709_10199723 | 3300005434 | Bacteria | 1415 |
| 17 | Ga0070709_10313978 | 3300005434 | Unclassified | 1148 |
| 18 | Ga0070709_10326552 | 3300005434 | Bacteria | 1128 |
| 19 | Ga0070709_10455006 | 3300005434 | Bacteria | 965 |
| 20 | Ga0070714_100019969 | 3300005435 | Bacteria | 5466 |
| 21 | Ga0070714_100034801 | 3300005435 | Bacteria | 4219 |
| 22 | Ga0070714_100083991 | 3300005435 | Bacteria | 2778 |
| 23 | Ga0070714_100336951 | 3300005435 | Bacteria | 1414 |
| 24 | Ga0070714_100857522 | 3300005435 | Unclassified | 881 |
| 25 | Ga0070713_100011859 | 3300005436 | Bacteria | 6369 |
| 26 | Ga0070713_100025952 | 3300005436 | Bacteria | 4591 |
| 27 | Ga0070713_100036722 | 3300005436 | Bacteria | 3956 |
| 28 | Ga0070713_100251027 | 3300005436 | Bacteria | 1613 |
| 29 | Ga0070713_100304575 | 3300005436 | Bacteria | 1468 |
| 30 | Ga0070713_100313715 | 3300005436 | Unclassified | 1447 |
| 31 | Ga0070713_100435761 | 3300005436 | Bacteria | 1229 |
| 32 | Ga0070710_10021716 | 3300005437 | Unclassified | 3350 |
| 33 | Ga0070710_10063353 | 3300005437 | Bacteria | 2112 |
| 34 | Ga0070711_100000388 | 3300005439 | Bacteria | 22701 |
| 35 | Ga0070711_100194660 | 3300005439 | Bacteria | 1560 |
| 36 | Ga0070708_100025471 | 3300005445 | Bacteria | 5057 |
| 37 | Ga0070708_100052204 | 3300005445 | Unclassified | 3625 |
| 38 | Ga0070708_100054167 | 3300005445 | Bacteria | 3562 |
| 39 | Ga0070681_10000275 | 3300005458 | Bacteria | 41301 |
| 40 | Ga0070681_10072478 | 3300005458 | Unclassified | 3407 |
| 41 | Ga0070681_10562644 | 3300005458 | Bacteria | 1054 |
| 42 | Ga0068867_100032929 | 3300005459 | Bacteria | 3750 |
| 43 | Ga0070685_10065388 | 3300005466 | Unclassified | 2140 |
| 44 | Ga0070706_100073783 | 3300005467 | Bacteria | 3159 |
| 45 | Ga0070707_100002809 | 3300005468 | Bacteria | 16553 |
| 46 | Ga0070707_100114383 | 3300005468 | Bacteria | 2618 |
| 47 | Ga0070707_100202396 | 3300005468 | Bacteria | 1935 |
| 48 | Ga0070699_100563360 | 3300005518 | Bacteria | 1037 |
| 49 | Ga0070679_100105161 | 3300005530 | Unclassified | 2809 |
| 50 | Ga0070684_100109471 | 3300005535 | Unclassified | 2476 |
| 51 | Ga0070684_100326183 | 3300005535 | Bacteria | 1411 |
| 52 | Ga0070697_100000017 | 3300005536 | Bacteria | 141440 |
| 53 | Ga0070697_100225224 | 3300005536 | Bacteria | 1598 |
| 54 | Ga0068853_100244231 | 3300005539 | Unclassified | 1646 |
| 55 | Ga0068855_100000874 | 3300005563 | Bacteria | 37439 |
| 56 | Ga0068855_100004089 | 3300005563 | Bacteria | 17795 |
| 57 | Ga0070664_100028691 | 3300005564 | Bacteria | 4632 |
| 58 | Ga0068857_100001992 | 3300005577 | Bacteria | 16555 |
| 59 | Ga0068857_100005771 | 3300005577 | Bacteria | 10583 |
| 60 | Ga0068854_100000450 | 3300005578 | Bacteria | 25444 |
| 61 | Ga0068856_100004485 | 3300005614 | Bacteria | 13888 |
| 62 | Ga0068856_100015387 | 3300005614 | Bacteria | 7393 |
| 63 | Ga0070702_100073986 | 3300005615 | Bacteria | 2020 |
| 64 | Ga0068859_100018386 | 3300005617 | Bacteria | 7026 |
| 65 | Ga0068864_100002790 | 3300005618 | Bacteria | 14425 |
| 66 | Ga0068864_100529981 | 3300005618 | Unclassified | 1136 |
| 67 | Ga0068866_10019344 | 3300005718 | Bacteria | 3098 |
| 68 | Ga0068861_100051327 | 3300005719 | Unclassified | 3131 |
| 69 | Ga0068851_10134135 | 3300005834 | Unclassified | 1341 |
| 70 | Ga0068870_10049176 | 3300005840 | Bacteria | 2223 |
| 71 | Ga0068863_100061767 | 3300005841 | Bacteria | 3543 |
| 72 | Ga0068858_100059600 | 3300005842 | Bacteria | 3528 |
| 73 | Ga0068858_100197938 | 3300005842 | Unclassified | 1899 |
| 74 | Ga0068860_100475878 | 3300005843 | Unclassified | 1244 |
| 75 | Ga0070717_10001663 | 3300006028 | Bacteria | 15455 |
| 76 | Ga0070717_10007045 | 3300006028 | Bacteria | 8325 |
| 77 | Ga0070717_10020560 | 3300006028 | Bacteria | 5194 |
| 78 | Ga0070717_10053386 | 3300006028 | Bacteria | 3331 |
| 79 | Ga0070716_100037299 | 3300006173 | Bacteria | 2685 |
| 80 | Ga0070716_100356369 | 3300006173 | Unclassified | 1037 |
| 81 | Ga0070716_100362817 | 3300006173 | Unclassified | 1029 |
| 82 | Ga0070716_100600482 | 3300006173 | Unclassified | 828 |
| 83 | Ga0070712_100010782 | 3300006175 | Bacteria | 5778 |
| 84 | Ga0070712_100026028 | 3300006175 | Unclassified | 3893 |
| 85 | Ga0070712_100272986 | 3300006175 | Bacteria | 1359 |
| 86 | Ga0070712_100328348 | 3300006175 | Bacteria | 1246 |
| 87 | Ga0097621_100001001 | 3300006237 | Bacteria | 19864 |
| 88 | Ga0097621_100006868 | 3300006237 | Bacteria | 8097 |
| 89 | Ga0068871_100001422 | 3300006358 | Bacteria | 16034 |
| 90 | Ga0075433_10001006 | 3300006852 | Bacteria | 20056 |
| 91 | Ga0075434_100000206 | 3300006871 | Bacteria | 40043 |
| 92 | Ga0075434_100009935 | 3300006871 | Bacteria | 8903 |
| 93 | Ga0075436_100006727 | 3300006914 | Bacteria | 7870 |
| 94 | Ga0075436_100008676 | 3300006914 | Bacteria | 6947 |
| 95 | Ga0075436_100109923 | 3300006914 | Bacteria | 1923 |
| 96 | Ga0097620_100018387 | 3300006931 | Bacteria | 7026 |
| 97 | Ga0075435_100001924 | 3300007076 | Bacteria | 13521 |
| 98 | Ga0075435_100035113 | 3300007076 | Bacteria | 3978 |
| 99 | Ga0075435_100303802 | 3300007076 | Unclassified | 1365 |
| 100 | Ga0075435_100310211 | 3300007076 | Unclassified | 1350 |
| 101 | Ga0105240_10042772 | 3300009093 | Bacteria | 5770 |
| 102 | Ga0105240_10058945 | 3300009093 | Bacteria | 4792 |
| 103 | Ga0105245_10120101 | 3300009098 | Unclassified | 2454 |
| 104 | Ga0105241_10136284 | 3300009174 | Bacteria | 1994 |
| 105 | Ga0105241_10148110 | 3300009174 | Unclassified | 1917 |
| 106 | Ga0105242_10716817 | 3300009176 | Unclassified | 981 |
| 107 | Ga0105248_10994821 | 3300009177 | Bacteria | 947 |
| 108 | Ga0105238_10015345 | 3300009551 | Bacteria | 7758 |
| 109 | Ga0105238_10199850 | 3300009551 | Bacteria | 1974 |
| 110 | Ga0105239_10039115 | 3300010375 | Bacteria | 5197 |
| 111 | Ga0105239_10189442 | 3300010375 | Bacteria | 2303 |
| 112 | Ga0157373_10049391 | 3300013100 | Unclassified | 2998 |
| 113 | Ga0157373_10390738 | 3300013100 | Unclassified | 996 |
| 114 | Ga0157369_10000924 | 3300013105 | Bacteria | 37397 |
| 115 | Ga0157369_10040990 | 3300013105 | Bacteria | 5054 |
| 116 | Ga0157369_10150976 | 3300013105 | Unclassified | 2455 |
| 117 | Ga0157374_10001049 | 3300013296 | Bacteria | 24012 |
| 118 | Ga0157374_10032830 | 3300013296 | Bacteria | 4731 |
| 119 | Ga0157374_11057702 | 3300013296 | Unclassified | 831 |
| 120 | Ga0157378_10000172 | 3300013297 | Bacteria | 61182 |
| 121 | Ga0157378_10018638 | 3300013297 | Bacteria | 6102 |
| 122 | Ga0157372_10000907 | 3300013307 | Bacteria | 32188 |
| 123 | Ga0157372_10003231 | 3300013307 | Bacteria | 17607 |
| 124 | Ga0157372_10006285 | 3300013307 | Bacteria | 12633 |
| 125 | Ga0157372_10008426 | 3300013307 | Bacteria | 10945 |
| 126 | Ga0157372_11072681 | 3300013307 | Unclassified | 932 |
| 127 | Ga0163163_10050776 | 3300014325 | Bacteria | 4086 |
| 128 | Ga0157376_10051397 | 3300014969 | Unclassified | 3423 |
| 129 | Ga0207697_10138747 | 3300025315 | Unclassified | 1054 |
| 130 | Ga0207692_10007734 | 3300025898 | Bacteria | 4416 |
| 131 | Ga0207692_10208363 | 3300025898 | Unclassified | 1153 |
| 132 | Ga0207699_10138475 | 3300025906 | Bacteria | 1597 |
| 133 | Ga0207699_10180749 | 3300025906 | Bacteria | 1418 |
| 134 | Ga0207699_10218754 | 3300025906 | Unclassified | 1299 |
| 135 | Ga0207699_10539353 | 3300025906 | Bacteria | 845 |
| 136 | Ga0207684_10029309 | 3300025910 | Bacteria | 4689 |
| 137 | Ga0207654_10085558 | 3300025911 | Unclassified | 1909 |
| 138 | Ga0207707_10000434 | 3300025912 | Bacteria | 43467 |
| 139 | Ga0207707_10055023 | 3300025912 | Unclassified | 3463 |
| 140 | Ga0207707_11031693 | 3300025912 | Bacteria | 673 |
| 141 | Ga0207695_10040433 | 3300025913 | Bacteria | 4999 |
| 142 | Ga0207695_10050116 | 3300025913 | Bacteria | 4395 |
| 143 | Ga0207695_10184701 | 3300025913 | Unclassified | 2005 |
| 144 | Ga0207693_10000708 | 3300025915 | Bacteria | 29996 |
| 145 | Ga0207693_10015498 | 3300025915 | Bacteria | 6115 |
| 146 | Ga0207693_10042740 | 3300025915 | Bacteria | 3567 |
| 147 | Ga0207663_10001066 | 3300025916 | Bacteria | 12569 |
| 148 | Ga0207663_10066863 | 3300025916 | Bacteria | 2302 |
| 149 | Ga0207660_10021476 | 3300025917 | Bacteria | 4341 |
| 150 | Ga0207657_10074981 | 3300025919 | Bacteria | 2855 |
| 151 | Ga0207649_10122898 | 3300025920 | Bacteria | 1753 |
| 152 | Ga0207652_10163201 | 3300025921 | Unclassified | 1997 |
| 153 | Ga0207646_10246271 | 3300025922 | Unclassified | 1614 |
| 154 | Ga0207694_10005543 | 3300025924 | Bacteria | 9677 |
| 155 | Ga0207650_10028764 | 3300025925 | Bacteria | 3988 |
| 156 | Ga0207659_10156082 | 3300025926 | Unclassified | 1787 |
| 157 | Ga0207687_10171704 | 3300025927 | Unclassified | 1673 |
| 158 | Ga0207700_10013591 | 3300025928 | Bacteria | 5304 |
| 159 | Ga0207700_10020706 | 3300025928 | Bacteria | 4474 |
| 160 | Ga0207700_10074267 | 3300025928 | Bacteria | 2630 |
| 161 | Ga0207700_10374989 | 3300025928 | Bacteria | 1243 |
| 162 | Ga0207700_10421194 | 3300025928 | Bacteria | 1173 |
| 163 | Ga0207664_10194116 | 3300025929 | Bacteria | 1749 |
| 164 | Ga0207664_10271869 | 3300025929 | Bacteria | 1485 |
| 165 | Ga0207664_10348277 | 3300025929 | Bacteria | 1311 |
| 166 | Ga0207664_10379533 | 3300025929 | Unclassified | 1255 |
| 167 | Ga0207664_10828225 | 3300025929 | Unclassified | 832 |
| 168 | Ga0207644_10954148 | 3300025931 | Unclassified | 719 |
| 169 | Ga0207686_10483928 | 3300025934 | Unclassified | 957 |
| 170 | Ga0207665_10014972 | 3300025939 | Bacteria | 5095 |
| 171 | Ga0207665_10248744 | 3300025939 | Bacteria | 1313 |
| 172 | Ga0207665_10462814 | 3300025939 | Unclassified | 975 |
| 173 | Ga0207665_10530998 | 3300025939 | Unclassified | 912 |
| 174 | Ga0207689_10055319 | 3300025942 | Bacteria | 3266 |
| 175 | Ga0207661_10038919 | 3300025944 | Bacteria | 3730 |
| 176 | Ga0207661_10246332 | 3300025944 | Unclassified | 1587 |
| 177 | Ga0207679_10012015 | 3300025945 | Bacteria | 5630 |
| 178 | Ga0207667_10000813 | 3300025949 | Bacteria | 40503 |
| 179 | Ga0207667_10013976 | 3300025949 | Bacteria | 9170 |
| 180 | Ga0207640_10171669 | 3300025981 | Bacteria | 1617 |
| 181 | Ga0207677_10059963 | 3300026023 | Bacteria | 2627 |
| 182 | Ga0207677_10095391 | 3300026023 | Bacteria | 2174 |
| 183 | Ga0207703_10024797 | 3300026035 | Bacteria | 4719 |
| 184 | Ga0207703_10132733 | 3300026035 | Bacteria | 2152 |
| 185 | Ga0207639_10182117 | 3300026041 | Bacteria | 1788 |
| 186 | Ga0207702_10000207 | 3300026078 | Bacteria | 69989 |
| 187 | Ga0207702_10023680 | 3300026078 | Bacteria | 5092 |
| 188 | Ga0207676_10002218 | 3300026095 | Bacteria | 14001 |
| 189 | Ga0207676_10353189 | 3300026095 | Unclassified | 1360 |
| 190 | Ga0207674_10001055 | 3300026116 | Bacteria | 35889 |
| 191 | Ga0207674_10002939 | 3300026116 | Bacteria | 21171 |
| 192 | Ga0207675_100067401 | 3300026118 | Unclassified | 3346 |
| 193 | Ga0268264_10432114 | 3300028381 | Unclassified | 1272 |
| 194 | Ga0268264_10795072 | 3300028381 | Unclassified | 945 |
| 195 | Ga0265325_10106775 | 3300031241 | Bacteria | 1365 |
| 196 | Ga0373923_0007252 | 3300035111 | Unclassified | 3889 |
| 197 | Ga0373923_0096738 | 3300035111 | Unclassified | 1298 |
| 198 | Ga0373923_0099331 | 3300035111 | Bacteria | 1282 |
| 199 | Ga0373936_0008540 | 3300035113 | Bacteria | 3857 |
| 200 | Ga0373936_0021674 | 3300035113 | Bacteria | 2500 |
| 201 | Ga0373936_0147831 | 3300035113 | Bacteria | 1017 |
| 202 | Ga0373936_0263201 | 3300035113 | Unclassified | 772 |
| 203 | Ga0373945_0002939 | 3300035116 | Bacteria | 5353 |
| 204 | Ga0373945_0016449 | 3300035116 | Bacteria | 2495 |
| 205 | Ga0373956_0168228 | 3300035119 | Unclassified | 1034 |
| 206 | Ga0373943_0038569 | 3300035170 | Bacteria | 2298 |
| 207 | Ga0373943_0047244 | 3300035170 | Unclassified | 2104 |
| 208 | Ga0373943_0048249 | 3300035170 | Bacteria | 2085 |
| 209 | Ga0373943_0526611 | 3300035170 | Unclassified | 692 |
| 210 | Ga0373946_0033163 | 3300035171 | Bacteria | 2077 |
| 211 | Ga0373955_0421570 | 3300035172 | Bacteria | 812 |
| 212 | Ga0373924_0001457 | 3300035410 | Bacteria | 7690 |
| 213 | Ga0373924_0039063 | 3300035410 | Bacteria | 1938 |
| 214 | Ga0373931_0068307 | 3300035691 | Unclassified | 1934 |
| 215 | Ga0373935_0009498 | 3300035692 | Bacteria | 5820 |
| 216 | Ga0373935_0111199 | 3300035692 | Bacteria | 1819 |
| 217 | Ga0373935_0207233 | 3300035692 | Bacteria | 1357 |
| 218 | Ga0373935_0555252 | 3300035692 | Bacteria | 837 |
| 219 | Ga0373927_0049273 | 3300035695 | Bacteria | 2724 |
| 220 | Ga0373927_0077983 | 3300035695 | Bacteria | 2146 |
| 221 | Ga0373927_0175898 | 3300035695 | Unclassified | 1403 |
| 222 | Ga0373927_0259396 | 3300035695 | Bacteria | 1143 |
| 223 | Ga0373927_0286741 | 3300035695 | Bacteria | 1083 |
| 224 | Ga0373927_0738480 | 3300035695 | Unclassified | 650 |
| 225 | Ga0373933_0058376 | 3300035724 | Bacteria | 2321 |
| 226 | Ga0373933_0068251 | 3300035724 | Bacteria | 2159 |
| 227 | Ga0373933_0081363 | 3300035724 | Bacteria | 1987 |
| 228 | Ga0373933_0272353 | 3300035724 | Unclassified | 1093 |
| 229 | Ga0373947_0001410 | 3300035725 | Bacteria | 14808 |
| 230 | Ga0373947_0011889 | 3300035725 | Bacteria | 4986 |
| 231 | Ga0373947_0457806 | 3300035725 | Unclassified | 864 |
| 232 | Ga0373937_0027886 | 3300036401 | Bacteria | 5109 |
| 233 | Ga0373937_0031999 | 3300036401 | Bacteria | 4769 |
| 234 | Ga0373937_0042936 | 3300036401 | Unclassified | 4127 |
| 235 | Ga0373937_0176149 | 3300036401 | Bacteria | 2008 |
| 236 | Ga0373937_0472178 | 3300036401 | Bacteria | 1191 |
| 237 | Ga0373925_0001030 | 3300037068 | Bacteria | 25248 |
| 238 | Ga0373925_0003467 | 3300037068 | Bacteria | 12199 |
| 239 | Ga0373925_0057514 | 3300037068 | Bacteria | 2914 |
| 240 | Ga0373925_0157039 | 3300037068 | Unclassified | 1789 |
| 241 | Ga0373925_0160155 | 3300037068 | Unclassified | 1772 |
| 242 | Ga0373925_1152377 | 3300037068 | Bacteria | 637 |
| 243 | Ga0436364_1440689 | 3300037853 | Unclassified | 787 |
| 244 | Ga0395901_1177503 | 3300038443 | Unclassified | 733 |
| 245 | Ga0436365_1797413 | 3300039437 | Unclassified | 710 |
| 246 | Ga0436363_0788264 | 3300039450 | Bacteria | 979 |
| 247 | Ga0436363_1050186 | 3300039450 | Unclassified | 1450 |
| 248 | Ga0436363_1180220 | 3300039450 | Unclassified | 695 |
| 249 | Ga0436363_1510164 | 3300039450 | Unclassified | 1799 |
| 250 | Ga0436362_0138585 | 3300039453 | Unclassified | 1190 |
| 251 | Ga0466966_0176025 | 3300044684 | Bacteria | 1299 |
| 252 | Ga0466959_0013041 | 3300045049 | Bacteria | 6019 |
| 253 | Ga0451576_0904064 | 3300045051 | Bacteria | 926 |
| 254 | Ga0466958_0163875 | 3300045836 | Bacteria | 1406 |
| 255 | Ga0466967_0023147 | 3300045976 | Bacteria | 5086 |
| 256 | Ga0495580_0000317 | 3300046472 | Bacteria | 39453 |
| 257 | Ga0495580_0011395 | 3300046472 | Bacteria | 6880 |
| 258 | Ga0495580_0016869 | 3300046472 | Bacteria | 5476 |
| 259 | Ga0495580_0049076 | 3300046472 | Unclassified | 2986 |
| 260 | Ga0495582_0038201 | 3300046473 | Bacteria | 2641 |
| 261 | Ga0495639_0081428 | 3300046475 | Bacteria | 1509 |
| 262 | Ga0495594_0065255 | 3300046499 | Unclassified | 2019 |
| 263 | Ga0495630_0151791 | 3300046517 | Bacteria | 1763 |
| 264 | Ga0495630_0178342 | 3300046517 | Bacteria | 1620 |
| 265 | Ga0495665_0000423 | 3300046531 | Bacteria | 21589 |
| 266 | Ga0495665_0178278 | 3300046531 | Bacteria | 1105 |
| 267 | Ga0495665_0308133 | 3300046531 | Unclassified | 810 |
| 268 | Ga0495667_0293021 | 3300046559 | Unclassified | 1032 |
| 269 | Ga0495588_0228742 | 3300046674 | Bacteria | 981 |
| 270 | Ga0495623_0075487 | 3300046679 | Bacteria | 2093 |
| 271 | Ga0495658_0383402 | 3300046683 | Bacteria | 895 |
| 272 | Ga0495604_0054541 | 3300047317 | Bacteria | 3084 |
| 273 | Ga0495674_0047580 | 3300047319 | Bacteria | 3802 |
| 274 | Ga0495674_0283077 | 3300047319 | Unclassified | 1358 |
| 275 | Ga0495674_0304614 | 3300047319 | Bacteria | 1301 |
| 276 | Ga0495674_1251510 | 3300047319 | Unclassified | 559 |
| 277 | Ga0495675_0020484 | 3300047444 | Bacteria | 4207 |
| 278 | Ga0495593_0099233 | 3300047673 | Unclassified | 1495 |
| 279 | Ga0495602_0062165 | 3300048088 | Bacteria | 3241 |
| 280 | Ga0495602_0126186 | 3300048088 | Bacteria | 2050 |
| 281 | Ga0495602_0176593 | 3300048088 | Unclassified | 1652 |
| 282 | Ga0496102_0010511 | 3300048905 | Bacteria | 7969 |
| 283 | Ga0496102_0147289 | 3300048905 | Bacteria | 2210 |
| 284 | Ga0496102_0379558 | 3300048905 | Unclassified | 1330 |
| 285 | Ga0496104_0062781 | 3300048907 | Bacteria | 3523 |
| 286 | Ga0496104_0117381 | 3300048907 | Bacteria | 2554 |
| 287 | Ga0496105_0087869 | 3300048908 | Unclassified | 2568 |
| 288 | Ga0496106_0641128 | 3300048909 | Bacteria | 849 |
| 289 | Ga0496110_0102539 | 3300048913 | Bacteria | 2566 |
| 290 | Ga0496111_0019131 | 3300048914 | Bacteria | 4752 |
| 291 | Ga0496112_0004611 | 3300048915 | Bacteria | 11724 |
| 292 | Ga0496112_0010363 | 3300048915 | Bacteria | 8452 |
| 293 | Ga0496113_0032988 | 3300048916 | Bacteria | 3766 |
| 294 | Ga0496113_0244213 | 3300048916 | Bacteria | 1433 |
| 295 | Ga0496115_0036681 | 3300048918 | Unclassified | 3883 |
| 296 | Ga0501083_0105449 | 3300049744 | Bacteria | 1856 |
| 297 | Ga0501083_0202952 | 3300049744 | Bacteria | 1293 |
| 298 | nmdc:mga0n895_1948_c1 | 3300050512 | Bacteria | 15852 |
| 299 | nmdc:mga0n895_25254_c1 | 3300050512 | Bacteria | 5611 |
| 300 | nmdc:mga0n895_578480_c1 | 3300050512 | Bacteria | 1127 |
| 301 | nmdc:mga0rr50_153745_c1 | 3300050513 | Bacteria | 1862 |
| 302 | nmdc:mga0rr50_5242_c1 | 3300050513 | Bacteria | 7713 |
| 303 | nmdc:mga0rr50_561568_c1 | 3300050513 | Unclassified | 972 |
| 304 | nmdc:mga08x19_15292_c1 | 3300050514 | Bacteria | 4668 |
| 305 | nmdc:mga08x19_33653_c1 | 3300050514 | Bacteria | 3235 |
| 306 | nmdc:mga08x19_999_c2 | 3300050514 | Bacteria | 7072 |
| 307 | nmdc:mga0a205_700_c1 | 3300050515 | Bacteria | 26835 |
| 308 | Ga0495601_0004885 | 3300053077 | Bacteria | 7782 |
| 309 | Ga0495601_0342255 | 3300053077 | Unclassified | 973 |
| 310 | Ga0495619_0116943 | 3300053085 | Bacteria | 1826 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013100 | Ga0157373_10390738 | Ga0157373_103907382 | 153 |
| 2 | 3300013105 | Ga0157369_10150976 | Ga0157369_101509762 | 153 |
| 3 | 3300013307 | Ga0157372_10003231 | Ga0157372_100032319 | 153 |
| 4 | 3300005445 | Ga0070708_100052204 | Ga0070708_1000522042 | 161 |
| 5 | 3300005468 | Ga0070707_100202396 | Ga0070707_1002023963 | 161 |
| 6 | 3300035695 | Ga0373927_0077983 | Ga0373927_0077983_166_651 | 161 |
| 7 | 3300037068 | Ga0373925_0057514 | Ga0373925_0057514_284_769 | 161 |
| 8 | 3300037068 | Ga0373925_1152377 | Ga0373925_1152377_25_510 | 161 |
| 9 | 3300038443 | Ga0395901_1177503 | Ga0395901_1177503_201_686 | 161 |
| 10 | 3300045976 | Ga0466967_0023147 | Ga0466967_0023147_1894_2379 | 161 |
| 11 | 3300046517 | Ga0495630_0151791 | Ga0495630_0151791_905_1390 | 161 |
| 12 | 3300046531 | Ga0495665_0308133 | Ga0495665_0308133_176_661 | 161 |
| 13 | 3300047319 | Ga0495674_1251510 | Ga0495674_1251510_62_547 | 161 |
| 14 | 3300005435 | Ga0070714_100083991 | Ga0070714_1000839912 | 164 |
| 15 | 3300009093 | Ga0105240_10058945 | Ga0105240_100589452 | 164 |
| 16 | 3300013105 | Ga0157369_10040990 | Ga0157369_100409904 | 164 |
| 17 | 3300025913 | Ga0207695_10050116 | Ga0207695_100501165 | 164 |
| 18 | 3300035724 | Ga0373933_0058376 | Ga0373933_0058376_241_813 | 167 |
| 19 | 3300036401 | Ga0373937_0042936 | Ga0373937_0042936_3531_4103 | 167 |
| 20 | 3300048088 | Ga0495602_0126186 | Ga0495602_0126186_735_1307 | 167 |
| 21 | 3300048088 | Ga0495602_0062165 | Ga0495602_0062165_176_748 | 168 |
| 22 | 3300013307 | Ga0157372_11072681 | Ga0157372_110726813 | 169 |
| 23 | 3300049744 | Ga0501083_0105449 | Ga0501083_0105449_742_1287 | 169 |
| 24 | 3300049744 | Ga0501083_0202952 | Ga0501083_0202952_536_1069 | 169 |
| 25 | 3300009174 | Ga0105241_10136284 | Ga0105241_101362842 | 170 |
| 26 | 3300009176 | Ga0105242_10716817 | Ga0105242_107168171 | 170 |
| 27 | 3300009177 | Ga0105248_10994821 | Ga0105248_109948212 | 170 |
| 28 | 3300009551 | Ga0105238_10199850 | Ga0105238_101998502 | 170 |
| 29 | 3300010375 | Ga0105239_10189442 | Ga0105239_101894422 | 170 |
| 30 | 3300013307 | Ga0157372_10008426 | Ga0157372_100084262 | 170 |
| 31 | 3300014325 | Ga0163163_10050776 | Ga0163163_100507763 | 170 |
| 32 | 3300025942 | Ga0207689_10055319 | Ga0207689_100553191 | 170 |
| 33 | 3300035691 | Ga0373931_0068307 | Ga0373931_0068307_402_938 | 170 |
| 34 | 3300005435 | Ga0070714_100034801 | Ga0070714_1000348012 | 171 |
| 35 | 3300005435 | Ga0070714_100857522 | Ga0070714_1008575221 | 171 |
| 36 | 3300006173 | Ga0070716_100362817 | Ga0070716_1003628171 | 171 |
| 37 | 3300013307 | Ga0157372_10006285 | Ga0157372_1000628511 | 171 |
| 38 | 3300025913 | Ga0207695_10184701 | Ga0207695_101847012 | 171 |
| 39 | 3300025929 | Ga0207664_10379533 | Ga0207664_103795331 | 171 |
| 40 | 3300025939 | Ga0207665_10462814 | Ga0207665_104628142 | 172 |
| 41 | 3300005445 | Ga0070708_100025471 | Ga0070708_1000254713 | 173 |
| 42 | 3300005467 | Ga0070706_100073783 | Ga0070706_1000737832 | 173 |
| 43 | 3300025910 | Ga0207684_10029309 | Ga0207684_100293094 | 173 |
| 44 | 3300035410 | Ga0373924_0039063 | Ga0373924_0039063_419_1018 | 173 |
| 45 | 3300035724 | Ga0373933_0272353 | Ga0373933_0272353_23_631 | 174 |
| 46 | 3300039450 | Ga0436363_0788264 | Ga0436363_0788264_401_961 | 174 |
| 47 | 3300005434 | Ga0070709_10455006 | Ga0070709_104550061 | 175 |
| 48 | 3300005435 | Ga0070714_100019969 | Ga0070714_1000199694 | 175 |
| 49 | 3300005436 | Ga0070713_100011859 | Ga0070713_1000118594 | 175 |
| 50 | 3300005436 | Ga0070713_100313715 | Ga0070713_1003137151 | 175 |
| 51 | 3300006028 | Ga0070717_10007045 | Ga0070717_100070456 | 175 |
| 52 | 3300006028 | Ga0070717_10020560 | Ga0070717_100205602 | 175 |
| 53 | 3300025906 | Ga0207699_10180749 | Ga0207699_101807492 | 175 |
| 54 | 3300025928 | Ga0207700_10020706 | Ga0207700_100207062 | 175 |
| 55 | 3300035113 | Ga0373936_0008540 | Ga0373936_0008540_3197_3772 | 175 |
| 56 | 3300035116 | Ga0373945_0016449 | Ga0373945_0016449_1480_2055 | 175 |
| 57 | 3300035170 | Ga0373943_0047244 | Ga0373943_0047244_1290_1865 | 175 |
| 58 | 3300035692 | Ga0373935_0207233 | Ga0373935_0207233_690_1265 | 175 |
| 59 | 3300035695 | Ga0373927_0259396 | Ga0373927_0259396_550_1125 | 175 |
| 60 | 3300037068 | Ga0373925_0160155 | Ga0373925_0160155_1056_1631 | 175 |
| 61 | 3300005436 | Ga0070713_100025952 | Ga0070713_1000259522 | 176 |
| 62 | 3300006175 | Ga0070712_100328348 | Ga0070712_1003283482 | 176 |
| 63 | 3300025928 | Ga0207700_10074267 | Ga0207700_100742672 | 176 |
| 64 | 3300035695 | Ga0373927_0738480 | Ga0373927_0738480_52_603 | 176 |
| 65 | 3300050512 | nmdc:mga0n895_578480_c1 | nmdc:mga0n895_578480_c1_15_566 | 176 |
| 66 | 3300037853 | Ga0436364_1440689 | Ga0436364_1440689_145_729 | 178 |
| 67 | 3300039437 | Ga0436365_1797413 | Ga0436365_1797413_78_662 | 178 |
| 68 | 3300045051 | Ga0451576_0904064 | Ga0451576_0904064_218_778 | 178 |
| 69 | 3300006173 | Ga0070716_100600482 | Ga0070716_1006004822 | 179 |
| 70 | 3300025939 | Ga0207665_10530998 | Ga0207665_105309982 | 179 |
| 71 | 3300035170 | Ga0373943_0526611 | Ga0373943_0526611_48_623 | 179 |
| 72 | 3300035692 | Ga0373935_0555252 | Ga0373935_0555252_13_588 | 179 |
| 73 | 3300039450 | Ga0436363_1050186 | Ga0436363_1050186_27_599 | 180 |
| 74 | 3300005336 | Ga0070680_100573961 | Ga0070680_1005739611 | 181 |
| 75 | 3300005435 | Ga0070714_100336951 | Ga0070714_1003369512 | 181 |
| 76 | 3300005458 | Ga0070681_10562644 | Ga0070681_105626442 | 181 |
| 77 | 3300005468 | Ga0070707_100002809 | Ga0070707_1000028099 | 181 |
| 78 | 3300005518 | Ga0070699_100563360 | Ga0070699_1005633601 | 181 |
| 79 | 3300005536 | Ga0070697_100000017 | Ga0070697_10000001786 | 181 |
| 80 | 3300005536 | Ga0070697_100225224 | Ga0070697_1002252242 | 181 |
| 81 | 3300006852 | Ga0075433_10001006 | Ga0075433_1000100617 | 181 |
| 82 | 3300006871 | Ga0075434_100000206 | Ga0075434_10000020624 | 181 |
| 83 | 3300006914 | Ga0075436_100006727 | Ga0075436_1000067274 | 181 |
| 84 | 3300006914 | Ga0075436_100008676 | Ga0075436_1000086768 | 181 |
| 85 | 3300007076 | Ga0075435_100001924 | Ga0075435_10000192412 | 181 |
| 86 | 3300007076 | Ga0075435_100303802 | Ga0075435_1003038022 | 181 |
| 87 | 3300007076 | Ga0075435_100310211 | Ga0075435_1003102112 | 181 |
| 88 | 3300013296 | Ga0157374_11057702 | Ga0157374_110577021 | 181 |
| 89 | 3300025912 | Ga0207707_11031693 | Ga0207707_110316931 | 181 |
| 90 | 3300025922 | Ga0207646_10246271 | Ga0207646_102462712 | 181 |
| 91 | 3300025929 | Ga0207664_10348277 | Ga0207664_103482772 | 181 |
| 92 | 3300031241 | Ga0265325_10106775 | Ga0265325_101067752 | 181 |
| 93 | 3300036401 | Ga0373937_0176149 | Ga0373937_0176149_105_686 | 181 |
| 94 | 3300039450 | Ga0436363_1510164 | Ga0436363_1510164_134_694 | 181 |
| 95 | 3300044684 | Ga0466966_0176025 | Ga0466966_0176025_370_939 | 181 |
| 96 | 3300045049 | Ga0466959_0013041 | Ga0466959_0013041_892_1467 | 181 |
| 97 | 3300045836 | Ga0466958_0163875 | Ga0466958_0163875_75_647 | 181 |
| 98 | 3300046472 | Ga0495580_0016869 | Ga0495580_0016869_1292_1870 | 181 |
| 99 | 3300050512 | nmdc:mga0n895_1948_c1 | nmdc:mga0n895_1948_c1_3765_4346 | 181 |
| 100 | 3300050513 | nmdc:mga0rr50_5242_c1 | nmdc:mga0rr50_5242_c1_5279_5860 | 181 |
| 101 | 3300050513 | nmdc:mga0rr50_561568_c1 | nmdc:mga0rr50_561568_c1_120_710 | 181 |
| 102 | 3300050514 | nmdc:mga08x19_15292_c1 | nmdc:mga08x19_15292_c1_481_1062 | 181 |
| 103 | 3300050514 | nmdc:mga08x19_999_c2 | nmdc:mga08x19_999_c2_3998_4576 | 181 |
| 104 | 3300050515 | nmdc:mga0a205_700_c1 | nmdc:mga0a205_700_c1_7834_8415 | 181 |
| 105 | 3300005434 | Ga0070709_10199723 | Ga0070709_101997232 | 182 |
| 106 | 3300005436 | Ga0070713_100036722 | Ga0070713_1000367223 | 182 |
| 107 | 3300005437 | Ga0070710_10063353 | Ga0070710_100633532 | 182 |
| 108 | 3300005439 | Ga0070711_100194660 | Ga0070711_1001946602 | 182 |
| 109 | 3300005445 | Ga0070708_100054167 | Ga0070708_1000541672 | 182 |
| 110 | 3300005468 | Ga0070707_100114383 | Ga0070707_1001143832 | 182 |
| 111 | 3300006028 | Ga0070717_10001663 | Ga0070717_100016638 | 182 |
| 112 | 3300006175 | Ga0070712_100026028 | Ga0070712_1000260282 | 182 |
| 113 | 3300006175 | Ga0070712_100272986 | Ga0070712_1002729861 | 182 |
| 114 | 3300006871 | Ga0075434_100009935 | Ga0075434_1000099356 | 182 |
| 115 | 3300025906 | Ga0207699_10539353 | Ga0207699_105393532 | 182 |
| 116 | 3300025915 | Ga0207693_10015498 | Ga0207693_100154983 | 182 |
| 117 | 3300025929 | Ga0207664_10271869 | Ga0207664_102718691 | 182 |
| 118 | 3300025939 | Ga0207665_10248744 | Ga0207665_102487441 | 182 |
| 119 | 3300035111 | Ga0373923_0007252 | Ga0373923_0007252_821_1453 | 182 |
| 120 | 3300035113 | Ga0373936_0147831 | Ga0373936_0147831_159_773 | 182 |
| 121 | 3300035113 | Ga0373936_0263201 | Ga0373936_0263201_61_693 | 182 |
| 122 | 3300035116 | Ga0373945_0002939 | Ga0373945_0002939_3232_3846 | 182 |
| 123 | 3300035119 | Ga0373956_0168228 | Ga0373956_0168228_376_1002 | 182 |
| 124 | 3300035170 | Ga0373943_0048249 | Ga0373943_0048249_589_1203 | 182 |
| 125 | 3300035171 | Ga0373946_0033163 | Ga0373946_0033163_556_1170 | 182 |
| 126 | 3300035410 | Ga0373924_0001457 | Ga0373924_0001457_3559_4173 | 182 |
| 127 | 3300035692 | Ga0373935_0111199 | Ga0373935_0111199_302_934 | 182 |
| 128 | 3300035695 | Ga0373927_0175898 | Ga0373927_0175898_580_1194 | 182 |
| 129 | 3300035724 | Ga0373933_0068251 | Ga0373933_0068251_1223_1849 | 182 |
| 130 | 3300035725 | Ga0373947_0011889 | Ga0373947_0011889_3391_4005 | 182 |
| 131 | 3300035725 | Ga0373947_0457806 | Ga0373947_0457806_31_663 | 182 |
| 132 | 3300036401 | Ga0373937_0031999 | Ga0373937_0031999_1129_1755 | 182 |
| 133 | 3300036401 | Ga0373937_0472178 | Ga0373937_0472178_507_1139 | 182 |
| 134 | 3300037068 | Ga0373925_0003467 | Ga0373925_0003467_10112_10744 | 182 |
| 135 | 3300037068 | Ga0373925_0157039 | Ga0373925_0157039_1081_1695 | 182 |
| 136 | 3300039453 | Ga0436362_0138585 | Ga0436362_0138585_12_575 | 182 |
| 137 | 3300046499 | Ga0495594_0065255 | Ga0495594_0065255_1325_1957 | 182 |
| 138 | 3300047673 | Ga0495593_0099233 | Ga0495593_0099233_869_1483 | 182 |
| 139 | 3300048905 | Ga0496102_0147289 | Ga0496102_0147289_411_1040 | 182 |
| 140 | 3300048907 | Ga0496104_0062781 | Ga0496104_0062781_631_1245 | 182 |
| 141 | 3300048908 | Ga0496105_0087869 | Ga0496105_0087869_1159_1773 | 182 |
| 142 | 3300048913 | Ga0496110_0102539 | Ga0496110_0102539_1170_1784 | 182 |
| 143 | 3300048914 | Ga0496111_0019131 | Ga0496111_0019131_3673_4290 | 182 |
| 144 | 3300048915 | Ga0496112_0004611 | Ga0496112_0004611_10942_11556 | 182 |
| 145 | 3300048916 | Ga0496113_0032988 | Ga0496113_0032988_2526_3140 | 182 |
| 146 | 3300050512 | nmdc:mga0n895_25254_c1 | nmdc:mga0n895_25254_c1_1742_2371 | 182 |
| 147 | 3300053085 | Ga0495619_0116943 | Ga0495619_0116943_1009_1623 | 182 |
| 148 | 3300005437 | Ga0070710_10021716 | Ga0070710_100217162 | 183 |
| 149 | 3300005439 | Ga0070711_100000388 | Ga0070711_10000038814 | 183 |
| 150 | 3300006028 | Ga0070717_10053386 | Ga0070717_100533862 | 183 |
| 151 | 3300006175 | Ga0070712_100010782 | Ga0070712_1000107824 | 183 |
| 152 | 3300025898 | Ga0207692_10208363 | Ga0207692_102083632 | 183 |
| 153 | 3300025906 | Ga0207699_10218754 | Ga0207699_102187542 | 183 |
| 154 | 3300025915 | Ga0207693_10000708 | Ga0207693_1000070817 | 183 |
| 155 | 3300025916 | Ga0207663_10001066 | Ga0207663_1000106611 | 183 |
| 156 | 3300025928 | Ga0207700_10013591 | Ga0207700_100135912 | 183 |
| 157 | 3300047317 | Ga0495604_0054541 | Ga0495604_0054541_2326_2946 | 183 |
| 158 | 3300048905 | Ga0496102_0379558 | Ga0496102_0379558_355_927 | 183 |
| 159 | 3300048907 | Ga0496104_0117381 | Ga0496104_0117381_531_1103 | 183 |
| 160 | 3300048909 | Ga0496106_0641128 | Ga0496106_0641128_224_796 | 183 |
| 161 | 3300048915 | Ga0496112_0010363 | Ga0496112_0010363_3334_3906 | 183 |
| 162 | 3300048916 | Ga0496113_0244213 | Ga0496113_0244213_231_803 | 183 |
| 163 | 3300048918 | Ga0496115_0036681 | Ga0496115_0036681_173_745 | 183 |
| 164 | 3300053077 | Ga0495601_0004885 | Ga0495601_0004885_4808_5428 | 183 |
| 165 | 3300053077 | Ga0495601_0342255 | Ga0495601_0342255_233_853 | 183 |
| 166 | 3300005434 | Ga0070709_10326552 | Ga0070709_103265522 | 184 |
| 167 | 3300005436 | Ga0070713_100251027 | Ga0070713_1002510272 | 184 |
| 168 | 3300006173 | Ga0070716_100037299 | Ga0070716_1000372993 | 184 |
| 169 | 3300006914 | Ga0075436_100109923 | Ga0075436_1001099232 | 184 |
| 170 | 3300007076 | Ga0075435_100035113 | Ga0075435_1000351132 | 184 |
| 171 | 3300025898 | Ga0207692_10007734 | Ga0207692_100077344 | 184 |
| 172 | 3300025906 | Ga0207699_10138475 | Ga0207699_101384752 | 184 |
| 173 | 3300025915 | Ga0207693_10042740 | Ga0207693_100427402 | 184 |
| 174 | 3300025916 | Ga0207663_10066863 | Ga0207663_100668632 | 184 |
| 175 | 3300025928 | Ga0207700_10374989 | Ga0207700_103749892 | 184 |
| 176 | 3300025929 | Ga0207664_10194116 | Ga0207664_101941162 | 184 |
| 177 | 3300025939 | Ga0207665_10014972 | Ga0207665_100149722 | 184 |
| 178 | 3300035111 | Ga0373923_0099331 | Ga0373923_0099331_244_819 | 184 |
| 179 | 3300035113 | Ga0373936_0021674 | Ga0373936_0021674_1649_2224 | 184 |
| 180 | 3300035170 | Ga0373943_0038569 | Ga0373943_0038569_175_750 | 184 |
| 181 | 3300035692 | Ga0373935_0009498 | Ga0373935_0009498_1437_2012 | 184 |
| 182 | 3300035695 | Ga0373927_0286741 | Ga0373927_0286741_277_852 | 184 |
| 183 | 3300035725 | Ga0373947_0001410 | Ga0373947_0001410_4903_5478 | 184 |
| 184 | 3300037068 | Ga0373925_0001030 | Ga0373925_0001030_18083_18658 | 184 |
| 185 | 3300046472 | Ga0495580_0011395 | Ga0495580_0011395_947_1522 | 184 |
| 186 | 3300046473 | Ga0495582_0038201 | Ga0495582_0038201_1899_2474 | 184 |
| 187 | 3300046475 | Ga0495639_0081428 | Ga0495639_0081428_74_649 | 184 |
| 188 | 3300046517 | Ga0495630_0178342 | Ga0495630_0178342_630_1205 | 184 |
| 189 | 3300046531 | Ga0495665_0000423 | Ga0495665_0000423_3977_4552 | 184 |
| 190 | 3300046674 | Ga0495588_0228742 | Ga0495588_0228742_147_722 | 184 |
| 191 | 3300046683 | Ga0495658_0383402 | Ga0495658_0383402_137_712 | 184 |
| 192 | 3300047319 | Ga0495674_0047580 | Ga0495674_0047580_122_697 | 184 |
| 193 | 3300050513 | nmdc:mga0rr50_153745_c1 | nmdc:mga0rr50_153745_c1_1097_1672 | 184 |
| 194 | 3300050514 | nmdc:mga08x19_33653_c1 | nmdc:mga08x19_33653_c1_2237_2812 | 184 |
| 195 | 3300005434 | Ga0070709_10313978 | Ga0070709_103139782 | 185 |
| 196 | 3300006173 | Ga0070716_100356369 | Ga0070716_1003563692 | 185 |
| 197 | 3300035695 | Ga0373927_0049273 | Ga0373927_0049273_1662_2255 | 185 |
| 198 | 3300046472 | Ga0495580_0000317 | Ga0495580_0000317_12430_13023 | 185 |
| 199 | 3300048905 | Ga0496102_0010511 | Ga0496102_0010511_2223_2813 | 185 |
| 200 | 3300001915 | JGI24741J21665_1029052 | JGI24741J21665_10290522 | 187 |
| 201 | 3300005331 | Ga0070670_100031411 | Ga0070670_1000314114 | 187 |
| 202 | 3300005334 | Ga0068869_100039959 | Ga0068869_1000399591 | 187 |
| 203 | 3300005334 | Ga0068869_100364143 | Ga0068869_1003641431 | 187 |
| 204 | 3300005336 | Ga0070680_100015385 | Ga0070680_1000153852 | 187 |
| 205 | 3300005336 | Ga0070680_100190246 | Ga0070680_1001902462 | 187 |
| 206 | 3300005338 | Ga0068868_100008024 | Ga0068868_1000080242 | 187 |
| 207 | 3300005338 | Ga0068868_100033451 | Ga0068868_1000334512 | 187 |
| 208 | 3300005341 | Ga0070691_10049562 | Ga0070691_100495623 | 187 |
| 209 | 3300005344 | Ga0070661_100049961 | Ga0070661_1000499612 | 187 |
| 210 | 3300005354 | Ga0070675_100148097 | Ga0070675_1001480972 | 187 |
| 211 | 3300005355 | Ga0070671_101039939 | Ga0070671_1010399391 | 187 |
| 212 | 3300005364 | Ga0070673_100144616 | Ga0070673_1001446162 | 187 |
| 213 | 3300005366 | Ga0070659_100410425 | Ga0070659_1004104252 | 187 |
| 214 | 3300005436 | Ga0070713_100304575 | Ga0070713_1003045752 | 187 |
| 215 | 3300005436 | Ga0070713_100435761 | Ga0070713_1004357613 | 187 |
| 216 | 3300005458 | Ga0070681_10000275 | Ga0070681_1000027523 | 187 |
| 217 | 3300005458 | Ga0070681_10072478 | Ga0070681_100724782 | 187 |
| 218 | 3300005459 | Ga0068867_100032929 | Ga0068867_1000329293 | 187 |
| 219 | 3300005466 | Ga0070685_10065388 | Ga0070685_100653882 | 187 |
| 220 | 3300005530 | Ga0070679_100105161 | Ga0070679_1001051612 | 187 |
| 221 | 3300005535 | Ga0070684_100109471 | Ga0070684_1001094711 | 187 |
| 222 | 3300005535 | Ga0070684_100326183 | Ga0070684_1003261832 | 187 |
| 223 | 3300005539 | Ga0068853_100244231 | Ga0068853_1002442312 | 187 |
| 224 | 3300005563 | Ga0068855_100000874 | Ga0068855_10000087432 | 187 |
| 225 | 3300005563 | Ga0068855_100004089 | Ga0068855_10000408914 | 187 |
| 226 | 3300005564 | Ga0070664_100028691 | Ga0070664_1000286915 | 187 |
| 227 | 3300005577 | Ga0068857_100001992 | Ga0068857_1000019926 | 187 |
| 228 | 3300005577 | Ga0068857_100005771 | Ga0068857_1000057717 | 187 |
| 229 | 3300005578 | Ga0068854_100000450 | Ga0068854_1000004502 | 187 |
| 230 | 3300005614 | Ga0068856_100004485 | Ga0068856_1000044858 | 187 |
| 231 | 3300005614 | Ga0068856_100015387 | Ga0068856_1000153872 | 187 |
| 232 | 3300005615 | Ga0070702_100073986 | Ga0070702_1000739862 | 187 |
| 233 | 3300005617 | Ga0068859_100018386 | Ga0068859_1000183866 | 187 |
| 234 | 3300005618 | Ga0068864_100002790 | Ga0068864_1000027907 | 187 |
| 235 | 3300005618 | Ga0068864_100529981 | Ga0068864_1005299811 | 187 |
| 236 | 3300005718 | Ga0068866_10019344 | Ga0068866_100193443 | 187 |
| 237 | 3300005719 | Ga0068861_100051327 | Ga0068861_1000513272 | 187 |
| 238 | 3300005834 | Ga0068851_10134135 | Ga0068851_101341351 | 187 |
| 239 | 3300005840 | Ga0068870_10049176 | Ga0068870_100491762 | 187 |
| 240 | 3300005841 | Ga0068863_100061767 | Ga0068863_1000617673 | 187 |
| 241 | 3300005842 | Ga0068858_100059600 | Ga0068858_1000596002 | 187 |
| 242 | 3300005842 | Ga0068858_100197938 | Ga0068858_1001979382 | 187 |
| 243 | 3300005843 | Ga0068860_100475878 | Ga0068860_1004758782 | 187 |
| 244 | 3300006237 | Ga0097621_100001001 | Ga0097621_10000100115 | 187 |
| 245 | 3300006237 | Ga0097621_100006868 | Ga0097621_1000068682 | 187 |
| 246 | 3300006358 | Ga0068871_100001422 | Ga0068871_1000014227 | 187 |
| 247 | 3300006931 | Ga0097620_100018387 | Ga0097620_1000183876 | 187 |
| 248 | 3300009093 | Ga0105240_10042772 | Ga0105240_100427726 | 187 |
| 249 | 3300009098 | Ga0105245_10120101 | Ga0105245_101201012 | 187 |
| 250 | 3300009174 | Ga0105241_10148110 | Ga0105241_101481101 | 187 |
| 251 | 3300009551 | Ga0105238_10015345 | Ga0105238_100153452 | 187 |
| 252 | 3300010375 | Ga0105239_10039115 | Ga0105239_100391156 | 187 |
| 253 | 3300013100 | Ga0157373_10049391 | Ga0157373_100493912 | 187 |
| 254 | 3300013105 | Ga0157369_10000924 | Ga0157369_100009247 | 187 |
| 255 | 3300013296 | Ga0157374_10001049 | Ga0157374_100010498 | 187 |
| 256 | 3300013296 | Ga0157374_10032830 | Ga0157374_100328304 | 187 |
| 257 | 3300013297 | Ga0157378_10000172 | Ga0157378_1000017249 | 187 |
| 258 | 3300013297 | Ga0157378_10018638 | Ga0157378_100186384 | 187 |
| 259 | 3300013307 | Ga0157372_10000907 | Ga0157372_1000090729 | 187 |
| 260 | 3300014969 | Ga0157376_10051397 | Ga0157376_100513973 | 187 |
| 261 | 3300025315 | Ga0207697_10138747 | Ga0207697_101387472 | 187 |
| 262 | 3300025911 | Ga0207654_10085558 | Ga0207654_100855582 | 187 |
| 263 | 3300025912 | Ga0207707_10000434 | Ga0207707_1000043423 | 187 |
| 264 | 3300025912 | Ga0207707_10055023 | Ga0207707_100550232 | 187 |
| 265 | 3300025913 | Ga0207695_10040433 | Ga0207695_100404332 | 187 |
| 266 | 3300025917 | Ga0207660_10021476 | Ga0207660_100214765 | 187 |
| 267 | 3300025919 | Ga0207657_10074981 | Ga0207657_100749812 | 187 |
| 268 | 3300025920 | Ga0207649_10122898 | Ga0207649_101228982 | 187 |
| 269 | 3300025921 | Ga0207652_10163201 | Ga0207652_101632011 | 187 |
| 270 | 3300025924 | Ga0207694_10005543 | Ga0207694_100055432 | 187 |
| 271 | 3300025925 | Ga0207650_10028764 | Ga0207650_100287644 | 187 |
| 272 | 3300025926 | Ga0207659_10156082 | Ga0207659_101560821 | 187 |
| 273 | 3300025927 | Ga0207687_10171704 | Ga0207687_101717042 | 187 |
| 274 | 3300025928 | Ga0207700_10421194 | Ga0207700_104211942 | 187 |
| 275 | 3300025929 | Ga0207664_10828225 | Ga0207664_108282252 | 187 |
| 276 | 3300025931 | Ga0207644_10954148 | Ga0207644_109541481 | 187 |
| 277 | 3300025934 | Ga0207686_10483928 | Ga0207686_104839281 | 187 |
| 278 | 3300025944 | Ga0207661_10038919 | Ga0207661_100389194 | 187 |
| 279 | 3300025944 | Ga0207661_10246332 | Ga0207661_102463321 | 187 |
| 280 | 3300025945 | Ga0207679_10012015 | Ga0207679_100120152 | 187 |
| 281 | 3300025949 | Ga0207667_10000813 | Ga0207667_1000081330 | 187 |
| 282 | 3300025949 | Ga0207667_10013976 | Ga0207667_100139762 | 187 |
| 283 | 3300025981 | Ga0207640_10171669 | Ga0207640_101716692 | 187 |
| 284 | 3300026023 | Ga0207677_10059963 | Ga0207677_100599632 | 187 |
| 285 | 3300026023 | Ga0207677_10095391 | Ga0207677_100953912 | 187 |
| 286 | 3300026035 | Ga0207703_10024797 | Ga0207703_100247975 | 187 |
| 287 | 3300026035 | Ga0207703_10132733 | Ga0207703_101327332 | 187 |
| 288 | 3300026041 | Ga0207639_10182117 | Ga0207639_101821172 | 187 |
| 289 | 3300026078 | Ga0207702_10000207 | Ga0207702_1000020744 | 187 |
| 290 | 3300026078 | Ga0207702_10023680 | Ga0207702_100236802 | 187 |
| 291 | 3300026095 | Ga0207676_10002218 | Ga0207676_100022187 | 187 |
| 292 | 3300026095 | Ga0207676_10353189 | Ga0207676_103531892 | 187 |
| 293 | 3300026116 | Ga0207674_10001055 | Ga0207674_100010559 | 187 |
| 294 | 3300026116 | Ga0207674_10002939 | Ga0207674_100029398 | 187 |
| 295 | 3300026118 | Ga0207675_100067401 | Ga0207675_1000674011 | 187 |
| 296 | 3300028381 | Ga0268264_10432114 | Ga0268264_104321142 | 187 |
| 297 | 3300028381 | Ga0268264_10795072 | Ga0268264_107950722 | 187 |
| 298 | 3300035111 | Ga0373923_0096738 | Ga0373923_0096738_339_923 | 187 |
| 299 | 3300035172 | Ga0373955_0421570 | Ga0373955_0421570_96_791 | 187 |
| 300 | 3300035724 | Ga0373933_0081363 | Ga0373933_0081363_1390_1977 | 187 |
| 301 | 3300036401 | Ga0373937_0027886 | Ga0373937_0027886_2816_3403 | 187 |
| 302 | 3300039450 | Ga0436363_1180220 | Ga0436363_1180220_56_649 | 187 |
| 303 | 3300046472 | Ga0495580_0049076 | Ga0495580_0049076_1104_1688 | 187 |
| 304 | 3300046531 | Ga0495665_0178278 | Ga0495665_0178278_181_765 | 187 |
| 305 | 3300046559 | Ga0495667_0293021 | Ga0495667_0293021_92_679 | 187 |
| 306 | 3300046679 | Ga0495623_0075487 | Ga0495623_0075487_157_744 | 187 |
| 307 | 3300047319 | Ga0495674_0283077 | Ga0495674_0283077_534_1121 | 187 |
| 308 | 3300047319 | Ga0495674_0304614 | Ga0495674_0304614_132_716 | 187 |
| 309 | 3300047444 | Ga0495675_0020484 | Ga0495675_0020484_39_626 | 187 |
| 310 | 3300048088 | Ga0495602_0176593 | Ga0495602_0176593_867_1454 | 187 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lyg-assembly1.cif.gz_A-2 | crystal structure of ntf2-like protein of unknown function (yp_270605.1) from colwellia psychrerythraea 34h at 1.61 a resolution | 0.816 | 68 | 118 |
| 6cib-assembly2.cif.gz_B | the structure of ycao from methanopyrus kandleri bound with amppcp and mg2+ | 0.7243 | 69 | 116 |
| 6ci7-assembly4.cif.gz_D | the structure of ycao from methanopyrus kandleri bound with amppcp and mg2+ | 0.7161 | 69 | 116 |
| 6ci7-assembly3.cif.gz_C | the structure of ycao from methanopyrus kandleri bound with amppcp and mg2+ | 0.712 | 69 | 116 |
| 3bb9-assembly1.cif.gz_A | crystal structure of a putative ketosteroid isomerase (sfri_1973) from shewanella frigidimarina ncimb 400 at 1.80 a resolution | 0.6499 | 67 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lygA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7913 | 68 | 118 | 3.10.450.50 |
| af_Q9VX49_71_188_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6764 | 75 | 141 | 2.60.40.10 |
| af_Q4DMN6_24_172_2.40.10.500 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.6721 | 70 | 116 | 2.40.10.500 |
| af_A0A1D6IKJ9_98_253_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.6618 | 76 | 138 | 3.30.530.20 |
| af_Q8I0K2_88_203_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6211 | 75 | 141 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9N2P8-F1-model_v4 | Uncharacterized protein | 0.9373 | 71 | 187 |
|
| AF-A0A2V9N2P8-F1-model_v4 | Uncharacterized protein | 0.9298 | 71 | 187 |
|
| AF-A0A2V9S089-F1-model_v4 | Uncharacterized protein | 0.9175 | 23 | 187 |
|
| AF-A0A2V9TKA3-F1-model_v4 | Uncharacterized protein | 0.9039 | 28 | 187 |
|
| AF-A0A2V9TKA3-F1-model_v4 | Uncharacterized protein | 0.8934 | 28 | 187 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar