F400562
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 310 | 236 | 292 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300005365|Ga0070688_100588751|Ga0070688_1005887513 |
| Length | 123 |
| Sequence | VRSSDLPGPRTTPQGAPAIARGEIWLAALDPTVGSEIQKTRPCVIISPPEMHDFLRTVTVAPMTTGSRPAPYRIPFRFAGKQGLILLDQMRTLDKQRLARPLGAVTANTLWRALAALREMFEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 2 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 3 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 4 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 5 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 6 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 7 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 8 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 9 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 10 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 11 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 12 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 13 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 14 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 19 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 72 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 95 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 96 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 97 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 167 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 168 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 169 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 170 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 171 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 172 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 173 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 174 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 175 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 176 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 177 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 178 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 179 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 213 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 214 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 215 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 216 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 217 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 218 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 219 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 233 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 234 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 235 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 236 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.94 |
| Metatranscriptomes | 2.26 |
| Isolates | 5.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.97 |
| Nodule | 1.29 |
| Rhizoplane | 1.29 |
| Rhizosphere | 77.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10161685 | 3300001979 | Bacteria | 555 |
| 2 | JGI24739J22299_10127011 | 3300001989 | Bacteria | 760 |
| 3 | JGI24737J22298_10183935 | 3300001990 | Bacteria | 617 |
| 4 | JGI24738J21930_10023486 | 3300002075 | Bacteria | 1270 |
| 5 | JGI25156J39149_1001179 | 3300002705 | Bacteria | 11622 |
| 6 | JGI25156J39149_1002755 | 3300002705 | Bacteria | 6109 |
| 7 | rootH1_10017679 | 3300003316 | Bacteria | 2096 |
| 8 | rootH2_10023369 | 3300003320 | Bacteria | 12999 |
| 9 | rootL2_10006463 | 3300003322 | Bacteria | 9895 |
| 10 | rootH1_10365108 | 3300003323 | Bacteria | 1908 |
| 11 | JGI25160J50197_1000111 | 3300003354 | Bacteria | 77225 |
| 12 | Ga0055538_1000013 | 3300003751 | Bacteria | 348596 |
| 13 | Ga0055539_1000018 | 3300003752 | Bacteria | 348596 |
| 14 | Ga0055533_1000022 | 3300003756 | Bacteria | 348596 |
| 15 | Ga0055532_1000082 | 3300003758 | Bacteria | 118619 |
| 16 | Ga0055525_1000024 | 3300003759 | Bacteria | 348596 |
| 17 | Ga0055527_1000039 | 3300003760 | Bacteria | 118619 |
| 18 | Ga0055535_1000012 | 3300003761 | Bacteria | 330206 |
| 19 | Ga0055529_1000112 | 3300003763 | Bacteria | 118619 |
| 20 | Ga0055526_1000635 | 3300003771 | Bacteria | 27287 |
| 21 | Ga0055537_1000158 | 3300003773 | Bacteria | 50485 |
| 22 | Ga0055524_1008762 | 3300003775 | Bacteria | 4176 |
| 23 | Ga0055534_1000319 | 3300003784 | Bacteria | 31908 |
| 24 | Ga0055528_1000143 | 3300003790 | Bacteria | 58169 |
| 25 | Ga0055541_1000013 | 3300003841 | Bacteria | 348596 |
| 26 | Ga0065165_1000453 | 3300005262 | Bacteria | 64295 |
| 27 | Ga0070658_10330058 | 3300005327 | Bacteria | 1303 |
| 28 | Ga0070683_100374815 | 3300005329 | Bacteria | 1356 |
| 29 | Ga0070670_100102903 | 3300005331 | Bacteria | 2460 |
| 30 | Ga0070666_10080107 | 3300005335 | Bacteria | 2231 |
| 31 | Ga0068868_100341280 | 3300005338 | Unclassified | 1281 |
| 32 | Ga0070660_100000239 | 3300005339 | Bacteria | 36635 |
| 33 | Ga0070668_100001440 | 3300005347 | Bacteria | 17174 |
| 34 | Ga0070688_100588751 | 3300005365 | Bacteria | 850 |
| 35 | Ga0070659_100000324 | 3300005366 | Bacteria | 36635 |
| 36 | Ga0070659_100601477 | 3300005366 | Bacteria | 945 |
| 37 | Ga0070667_100000130 | 3300005367 | Bacteria | 95182 |
| 38 | Ga0070709_10393891 | 3300005434 | Bacteria | 1033 |
| 39 | Ga0070714_100345964 | 3300005435 | Unclassified | 1395 |
| 40 | Ga0070714_100387134 | 3300005435 | Bacteria | 1319 |
| 41 | Ga0070713_100085704 | 3300005436 | Bacteria | 2699 |
| 42 | Ga0070713_100402866 | 3300005436 | Bacteria | 1278 |
| 43 | Ga0070710_10122601 | 3300005437 | Unclassified | 1575 |
| 44 | Ga0070663_100029545 | 3300005455 | Bacteria | 3747 |
| 45 | Ga0070706_100189238 | 3300005467 | Bacteria | 1923 |
| 46 | Ga0070699_100379796 | 3300005518 | Bacteria | 1276 |
| 47 | Ga0070665_100438194 | 3300005548 | Bacteria | 1316 |
| 48 | Ga0070665_101087965 | 3300005548 | Bacteria | 811 |
| 49 | Ga0068855_100000645 | 3300005563 | Bacteria | 42677 |
| 50 | Ga0068855_100020370 | 3300005563 | Bacteria | 7956 |
| 51 | Ga0068855_100451545 | 3300005563 | Bacteria | 1403 |
| 52 | Ga0068855_101229621 | 3300005563 | Bacteria | 778 |
| 53 | Ga0068855_101568417 | 3300005563 | Unclassified | 674 |
| 54 | Ga0068855_101672541 | 3300005563 | Bacteria | 650 |
| 55 | Ga0070664_101312122 | 3300005564 | Unclassified | 683 |
| 56 | Ga0068854_100368862 | 3300005578 | Bacteria | 1180 |
| 57 | Ga0068856_100453238 | 3300005614 | Bacteria | 1304 |
| 58 | Ga0068852_100563640 | 3300005616 | Unclassified | 1140 |
| 59 | Ga0068859_101593529 | 3300005617 | Unclassified | 721 |
| 60 | Ga0068851_10560230 | 3300005834 | Bacteria | 691 |
| 61 | Ga0068863_100000029 | 3300005841 | Bacteria | 177191 |
| 62 | Ga0068863_100026173 | 3300005841 | Bacteria | 5567 |
| 63 | Ga0068858_101241116 | 3300005842 | Unclassified | 733 |
| 64 | Ga0068862_101924487 | 3300005844 | Unclassified | 601 |
| 65 | Ga0070717_11717286 | 3300006028 | Unclassified | 568 |
| 66 | Ga0070712_100217272 | 3300006175 | Unclassified | 1511 |
| 67 | Ga0070712_100315650 | 3300006175 | Bacteria | 1269 |
| 68 | Ga0070712_101314074 | 3300006175 | Unclassified | 630 |
| 69 | Ga0097621_100902447 | 3300006237 | Bacteria | 823 |
| 70 | Ga0097620_101593823 | 3300006931 | Unclassified | 721 |
| 71 | Ga0099794_10202786 | 3300007265 | Bacteria | 1016 |
| 72 | Ga0099794_10355761 | 3300007265 | Bacteria | 762 |
| 73 | Ga0105250_10027102 | 3300009092 | Bacteria | 2309 |
| 74 | Ga0105240_10105333 | 3300009093 | Bacteria | 3424 |
| 75 | Ga0105240_11662298 | 3300009093 | Bacteria | 667 |
| 76 | Ga0111539_10756246 | 3300009094 | Bacteria | 1131 |
| 77 | Ga0105247_11430004 | 3300009101 | Bacteria | 561 |
| 78 | Ga0105241_10330461 | 3300009174 | Bacteria | 1317 |
| 79 | Ga0105241_11943051 | 3300009174 | Unclassified | 578 |
| 80 | Ga0105248_11276680 | 3300009177 | Bacteria | 830 |
| 81 | Ga0105248_12058250 | 3300009177 | Bacteria | 649 |
| 82 | Ga0105237_10024655 | 3300009545 | Bacteria | 6152 |
| 83 | Ga0105237_10369045 | 3300009545 | Bacteria | 1440 |
| 84 | Ga0105238_10007147 | 3300009551 | Bacteria | 11166 |
| 85 | Ga0105238_10701652 | 3300009551 | Bacteria | 1024 |
| 86 | Ga0105148_112721 | 3300009978 | Bacteria | 653 |
| 87 | Ga0105239_10114276 | 3300010375 | Bacteria | 2995 |
| 88 | Ga0105239_10773836 | 3300010375 | Unclassified | 1099 |
| 89 | Ga0157373_10008695 | 3300013100 | Bacteria | 7535 |
| 90 | Ga0157371_10751187 | 3300013102 | Unclassified | 732 |
| 91 | Ga0157370_10137520 | 3300013104 | Bacteria | 2276 |
| 92 | Ga0157370_10260034 | 3300013104 | Unclassified | 1604 |
| 93 | Ga0157370_10506731 | 3300013104 | Bacteria | 1108 |
| 94 | Ga0157369_10073154 | 3300013105 | Bacteria | 3678 |
| 95 | Ga0157369_10090342 | 3300013105 | Bacteria | 3270 |
| 96 | Ga0157369_11602263 | 3300013105 | Bacteria | 662 |
| 97 | Ga0157369_11791142 | 3300013105 | Bacteria | 624 |
| 98 | Ga0157372_10098015 | 3300013307 | Bacteria | 3344 |
| 99 | Ga0157375_10852044 | 3300013308 | Bacteria | 1058 |
| 100 | Ga0157380_12971875 | 3300014326 | Bacteria | 540 |
| 101 | Ga0157376_12119582 | 3300014969 | Bacteria | 601 |
| 102 | Ga0182005_1005765 | 3300015265 | Bacteria | 3843 |
| 103 | Ga0206351_10758351 | 3300020077 | Bacteria | 599 |
| 104 | Ga0206352_11261789 | 3300020078 | Bacteria | 703 |
| 105 | Ga0206350_11368649 | 3300020080 | Unclassified | 942 |
| 106 | Ga0213873_10007849 | 3300021358 | Bacteria | 2155 |
| 107 | Ga0213872_10078642 | 3300021361 | Unclassified | 1482 |
| 108 | Ga0213872_10089005 | 3300021361 | Bacteria | 1383 |
| 109 | Ga0213872_10117023 | 3300021361 | Unclassified | 1180 |
| 110 | Ga0213875_10039446 | 3300021388 | Unclassified | 2225 |
| 111 | Ga0213871_10021063 | 3300021441 | Unclassified | 1622 |
| 112 | Ga0213871_10099406 | 3300021441 | Bacteria | 850 |
| 113 | Ga0224712_10116816 | 3300022467 | Unclassified | 1151 |
| 114 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 115 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 116 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 117 | Ga0209674_102621 | 3300025226 | Bacteria | 3744 |
| 118 | Ga0209672_100092 | 3300025228 | Bacteria | 118671 |
| 119 | Ga0209147_100133 | 3300025229 | Bacteria | 118671 |
| 120 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 121 | Ga0209258_100208 | 3300025242 | Bacteria | 118671 |
| 122 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 123 | Ga0209148_1002710 | 3300025254 | Bacteria | 5650 |
| 124 | Ga0209759_1000433 | 3300025256 | Bacteria | 50171 |
| 125 | Ga0209759_1006297 | 3300025256 | Bacteria | 4011 |
| 126 | Ga0209759_1013463 | 3300025256 | Bacteria | 2211 |
| 127 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 128 | Ga0209455_1000159 | 3300025272 | Bacteria | 118671 |
| 129 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 130 | Ga0209675_1000123 | 3300025291 | Bacteria | 106157 |
| 131 | Ga0209564_1000420 | 3300025295 | Bacteria | 74634 |
| 132 | Ga0209256_1000219 | 3300025299 | Bacteria | 106112 |
| 133 | Ga0207426_1000110 | 3300025302 | Bacteria | 235630 |
| 134 | Ga0207696_1018115 | 3300025711 | Bacteria | 2318 |
| 135 | Ga0207692_10201944 | 3300025898 | Unclassified | 1169 |
| 136 | Ga0207710_10549729 | 3300025900 | Bacteria | 601 |
| 137 | Ga0207680_10059851 | 3300025903 | Bacteria | 2316 |
| 138 | Ga0207647_10058183 | 3300025904 | Bacteria | 2368 |
| 139 | Ga0207647_10276663 | 3300025904 | Bacteria | 959 |
| 140 | Ga0207685_10061299 | 3300025905 | Unclassified | 1491 |
| 141 | Ga0207699_10570403 | 3300025906 | Bacteria | 822 |
| 142 | Ga0207705_10005976 | 3300025909 | Bacteria | 9055 |
| 143 | Ga0207705_10142865 | 3300025909 | Bacteria | 1788 |
| 144 | Ga0207705_11213412 | 3300025909 | Unclassified | 578 |
| 145 | Ga0207684_10084430 | 3300025910 | Bacteria | 2704 |
| 146 | Ga0207654_11209131 | 3300025911 | Bacteria | 551 |
| 147 | Ga0207695_10064490 | 3300025913 | Bacteria | 3771 |
| 148 | Ga0207693_10013083 | 3300025915 | Bacteria | 6695 |
| 149 | Ga0207693_10583975 | 3300025915 | Unclassified | 870 |
| 150 | Ga0207663_10757788 | 3300025916 | Unclassified | 771 |
| 151 | Ga0207657_10000663 | 3300025919 | Bacteria | 36593 |
| 152 | Ga0207681_11017897 | 3300025923 | Unclassified | 695 |
| 153 | Ga0207694_10004191 | 3300025924 | Bacteria | 11303 |
| 154 | Ga0207650_10116381 | 3300025925 | Bacteria | 2076 |
| 155 | Ga0207700_10211592 | 3300025928 | Bacteria | 1639 |
| 156 | Ga0207700_10562852 | 3300025928 | Bacteria | 1012 |
| 157 | Ga0207664_10087845 | 3300025929 | Bacteria | 2542 |
| 158 | Ga0207690_10000082 | 3300025932 | Bacteria | 80786 |
| 159 | Ga0207690_10542592 | 3300025932 | Bacteria | 945 |
| 160 | Ga0207665_11350750 | 3300025939 | Unclassified | 568 |
| 161 | Ga0207679_11317210 | 3300025945 | Unclassified | 663 |
| 162 | Ga0207679_11318118 | 3300025945 | Bacteria | 662 |
| 163 | Ga0207667_10000191 | 3300025949 | Bacteria | 89641 |
| 164 | Ga0207667_10001176 | 3300025949 | Bacteria | 32896 |
| 165 | Ga0207667_10839412 | 3300025949 | Unclassified | 913 |
| 166 | Ga0207667_10858391 | 3300025949 | Bacteria | 902 |
| 167 | Ga0207668_10010583 | 3300025972 | Bacteria | 5578 |
| 168 | Ga0207658_10000100 | 3300025986 | Bacteria | 95179 |
| 169 | Ga0207658_10001044 | 3300025986 | Bacteria | 22500 |
| 170 | Ga0207677_12138021 | 3300026023 | Unclassified | 521 |
| 171 | Ga0207678_10094181 | 3300026067 | Bacteria | 2559 |
| 172 | Ga0207702_12049025 | 3300026078 | Bacteria | 562 |
| 173 | Ga0207641_10000049 | 3300026088 | Bacteria | 177222 |
| 174 | Ga0207641_10019212 | 3300026088 | Bacteria | 5607 |
| 175 | Ga0207698_11796685 | 3300026142 | Unclassified | 628 |
| 176 | Ga0265354_1000713 | 3300028016 | Bacteria | 5487 |
| 177 | Ga0268264_10326413 | 3300028381 | Bacteria | 1453 |
| 178 | Ga0265338_10088755 | 3300028800 | Bacteria | 2564 |
| 179 | Ga0265762_1065726 | 3300030760 | Bacteria | 753 |
| 180 | Ga0265770_1001147 | 3300030878 | Unclassified | 3663 |
| 181 | Ga0265760_10001148 | 3300031090 | Bacteria | 7708 |
| 182 | Ga0265329_10053165 | 3300031242 | Bacteria | 1288 |
| 183 | Ga0265327_10000437 | 3300031251 | Bacteria | 75716 |
| 184 | Ga0265327_10009849 | 3300031251 | Bacteria | 6823 |
| 185 | Ga0265316_10000213 | 3300031344 | Bacteria | 67886 |
| 186 | Ga0265316_10985855 | 3300031344 | Bacteria | 587 |
| 187 | Ga0307408_100049865 | 3300031548 | Bacteria | 3008 |
| 188 | Ga0307405_10014229 | 3300031731 | Bacteria | 4272 |
| 189 | Ga0307405_10049759 | 3300031731 | Bacteria | 2592 |
| 190 | Ga0307406_10109847 | 3300031901 | Bacteria | 1896 |
| 191 | Ga0307406_11023424 | 3300031901 | Bacteria | 710 |
| 192 | Ga0307412_10000015 | 3300031911 | Bacteria | 333589 |
| 193 | Ga0307412_10000633 | 3300031911 | Bacteria | 20489 |
| 194 | Ga0373946_0126940 | 3300035171 | Unclassified | 1170 |
| 195 | Ga0373935_0253547 | 3300035692 | Unclassified | 1232 |
| 196 | Ga0373925_0449601 | 3300037068 | Bacteria | 1055 |
| 197 | Ga0395899_0011107 | 3300037312 | Bacteria | 6898 |
| 198 | Ga0395900_0000074 | 3300037418 | Bacteria | 184491 |
| 199 | Ga0395900_0128335 | 3300037418 | Bacteria | 2600 |
| 200 | Ga0395898_0465973 | 3300037466 | Bacteria | 1203 |
| 201 | Ga0395905_0358209 | 3300037471 | Bacteria | 1351 |
| 202 | Ga0395905_0562898 | 3300037471 | Bacteria | 1041 |
| 203 | Ga0436364_1053450 | 3300037853 | Unclassified | 2023 |
| 204 | Ga0436365_1298073 | 3300039437 | Bacteria | 1225 |
| 205 | Ga0436360_0335658 | 3300039438 | Plasmid | 3016 |
| 206 | Ga0436360_0579778 | 3300039438 | Bacteria | 2955 |
| 207 | Ga0436360_1339278 | 3300039438 | Bacteria | 5886 |
| 208 | Ga0436361_0047224 | 3300039447 | Unclassified | 1258 |
| 209 | Ga0436361_0408108 | 3300039447 | Bacteria | 723 |
| 210 | Ga0436361_0678368 | 3300039447 | Bacteria | 2089 |
| 211 | Ga0436361_0743401 | 3300039447 | Unclassified | 1578 |
| 212 | Ga0436361_1205114 | 3300039447 | Bacteria | 3050 |
| 213 | Ga0436363_0939546 | 3300039450 | Bacteria | 1293 |
| 214 | Ga0436363_1499293 | 3300039450 | Unclassified | 605 |
| 215 | Ga0436362_0578983 | 3300039453 | Bacteria | 2423 |
| 216 | Ga0436362_0642631 | 3300039453 | Bacteria | 1875 |
| 217 | Ga0436362_1141231 | 3300039453 | Bacteria | 1693 |
| 218 | Ga0436362_1302218 | 3300039453 | Unclassified | 609 |
| 219 | Ga0451853_1875834 | 3300041512 | Bacteria | 1451 |
| 220 | Ga0466966_0016605 | 3300044684 | Bacteria | 4862 |
| 221 | Ga0466961_0008947 | 3300044693 | Bacteria | 6389 |
| 222 | Ga0466961_0177746 | 3300044693 | Bacteria | 1322 |
| 223 | Ga0466963_0531589 | 3300044694 | Unclassified | 830 |
| 224 | Ga0466970_0001404 | 3300044765 | Bacteria | 11642 |
| 225 | Ga0466960_0043203 | 3300044901 | Bacteria | 2143 |
| 226 | Ga0466959_0019257 | 3300045049 | Bacteria | 5018 |
| 227 | Ga0466959_0068669 | 3300045049 | Bacteria | 2568 |
| 228 | Ga0466959_0186329 | 3300045049 | Bacteria | 1450 |
| 229 | Ga0495603_0034438 | 3300046455 | Bacteria | 3044 |
| 230 | Ga0495651_0446678 | 3300046462 | Bacteria | 836 |
| 231 | Ga0495653_0196135 | 3300046463 | Bacteria | 1374 |
| 232 | Ga0495650_0001375 | 3300046471 | Bacteria | 24009 |
| 233 | Ga0495580_0038944 | 3300046472 | Bacteria | 3401 |
| 234 | Ga0495580_0309689 | 3300046472 | Bacteria | 1074 |
| 235 | Ga0495580_0325571 | 3300046472 | Bacteria | 1044 |
| 236 | Ga0495605_0025281 | 3300046474 | Bacteria | 3096 |
| 237 | Ga0495584_0000573 | 3300046491 | Bacteria | 24792 |
| 238 | Ga0495584_0318830 | 3300046491 | Bacteria | 789 |
| 239 | Ga0495585_0592207 | 3300046492 | Bacteria | 522 |
| 240 | Ga0495596_0013531 | 3300046500 | Bacteria | 3457 |
| 241 | Ga0495583_0020942 | 3300046506 | Bacteria | 3371 |
| 242 | Ga0495606_0357879 | 3300046507 | Bacteria | 772 |
| 243 | Ga0495606_0441413 | 3300046507 | Unclassified | 669 |
| 244 | Ga0495610_0000447 | 3300046512 | Bacteria | 42590 |
| 245 | Ga0495628_0388241 | 3300046516 | Bacteria | 1021 |
| 246 | Ga0495642_0223761 | 3300046528 | Bacteria | 822 |
| 247 | Ga0495586_0519655 | 3300046535 | Bacteria | 687 |
| 248 | Ga0495622_0115912 | 3300046557 | Bacteria | 1225 |
| 249 | Ga0495611_0093540 | 3300046648 | Bacteria | 1390 |
| 250 | Ga0495657_0596819 | 3300046675 | Unclassified | 639 |
| 251 | Ga0495646_0296134 | 3300046680 | Bacteria | 857 |
| 252 | Ga0495658_1017941 | 3300046683 | Unclassified | 529 |
| 253 | Ga0495670_0461719 | 3300046691 | Bacteria | 688 |
| 254 | Ga0495671_0105106 | 3300046692 | Bacteria | 1379 |
| 255 | Ga0495649_0453462 | 3300046694 | Bacteria | 640 |
| 256 | Ga0495636_0003008 | 3300047318 | Bacteria | 6530 |
| 257 | Ga0495674_0097583 | 3300047319 | Bacteria | 2503 |
| 258 | Ga0495674_0744139 | 3300047319 | Bacteria | 766 |
| 259 | Ga0495672_0043237 | 3300047320 | Bacteria | 2710 |
| 260 | Ga0495672_0126661 | 3300047320 | Bacteria | 1349 |
| 261 | Ga0495683_0087387 | 3300047323 | Bacteria | 1514 |
| 262 | Ga0495687_013185 | 3300047443 | Bacteria | 4327 |
| 263 | Ga0495687_188270 | 3300047443 | Bacteria | 667 |
| 264 | Ga0495593_0186535 | 3300047673 | Bacteria | 1044 |
| 265 | Ga0495593_0720869 | 3300047673 | Unclassified | 501 |
| 266 | Ga0495602_0051928 | 3300048088 | Bacteria | 3646 |
| 267 | Ga0495626_0065039 | 3300048091 | Bacteria | 1651 |
| 268 | Ga0496105_0318705 | 3300048908 | Bacteria | 1247 |
| 269 | Ga0496110_0930473 | 3300048913 | Bacteria | 776 |
| 270 | Ga0496113_1362795 | 3300048916 | Unclassified | 550 |
| 271 | Ga0496116_0003203 | 3300048919 | Bacteria | 16362 |
| 272 | Ga0496117_0294762 | 3300048920 | Bacteria | 862 |
| 273 | Ga0496122_0080773 | 3300048925 | Bacteria | 2266 |
| 274 | Ga0496123_0026796 | 3300048926 | Bacteria | 4309 |
| 275 | Ga0496124_0107189 | 3300048927 | Bacteria | 2255 |
| 276 | Ga0496125_0072819 | 3300048928 | Bacteria | 2675 |
| 277 | Ga0495682_0103710 | 3300049460 | Bacteria | 1020 |
| 278 | Ga0495682_0142006 | 3300049460 | Bacteria | 857 |
| 279 | Ga0501033_0026482 | 3300049570 | Bacteria | 4364 |
| 280 | Ga0501034_0078093 | 3300049571 | Bacteria | 3315 |
| 281 | Ga0501036_0083153 | 3300049572 | Bacteria | 2706 |
| 282 | Ga0501038_0258363 | 3300049574 | Bacteria | 1377 |
| 283 | Ga0501047_0442585 | 3300049581 | Bacteria | 1129 |
| 284 | Ga0501070_0056560 | 3300049586 | Bacteria | 3251 |
| 285 | Ga0501073_0058435 | 3300049589 | Bacteria | 2695 |
| 286 | Ga0501074_0007914 | 3300049590 | Bacteria | 7699 |
| 287 | Ga0501080_0048097 | 3300049742 | Bacteria | 3970 |
| 288 | Ga0501035_0125236 | 3300049822 | Bacteria | 2243 |
| 289 | Ga0501044_0075419 | 3300049823 | Bacteria | 3424 |
| 290 | Ga0501044_0329571 | 3300049823 | Bacteria | 1450 |
| 291 | nmdc:mga08y16_1058916_c1 | 3300050511 | Bacteria | 788 |
| 292 | Ga0500643_001188 | 3300053087 | Bacteria | 15524 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_1298073 | Ga0436365_1298073_145_447 | 100 |
| 2 | 3300039450 | Ga0436363_0939546 | Ga0436363_0939546_567_869 | 100 |
| 3 | 3300046535 | Ga0495586_0519655 | Ga0495586_0519655_67_369 | 100 |
| 4 | iso_pu_bacteria | 2513237165 | 2514041280 | 102 |
| 5 | iso_pu_bacteria | 2513237166 | 2514055872 | 102 |
| 6 | iso_pu_bacteria | 2515154123 | 2515689708 | 102 |
| 7 | iso_pu_bacteria | 2738541296 | 2738822782 | 102 |
| 8 | iso_pu_bacteria | 2738541298 | 2738834989 | 102 |
| 9 | iso_pu_bacteria | 2738541306 | 2738876468 | 102 |
| 10 | iso_pu_bacteria | 2738543002 | 2739188412 | 102 |
| 11 | iso_pu_bacteria | 2738543008 | 2739223064 | 102 |
| 12 | iso_pu_bacteria | 2816332253 | 2817263215 | 102 |
| 13 | iso_pu_bacteria | 2816332286 | 2817455034 | 102 |
| 14 | iso_pu_bacteria | 2816332286 | 2817455704 | 102 |
| 15 | iso_pu_bacteria | 2885270888 | 2885277459 | 102 |
| 16 | iso_pu_bacteria | 2945934425 | 2945939231 | 102 |
| 17 | iso_pu_bacteria | 2990703756 | 2990706568 | 102 |
| 18 | iso_pu_bacteria | 641736151 | 642427500 | 102 |
| 19 | iso_pu_bacteria | 644736347 | 644748052 | 102 |
| 20 | iso_pu_bacteria | 8020807995 | 8020808292 | 102 |
| 21 | iso_pu_bacteria | 8040173305 | 8040179217 | 102 |
| 22 | 3300007265 | Ga0099794_10355761 | Ga0099794_103557612 | 104 |
| 23 | 3300025226 | Ga0209674_102621 | Ga0209674_1026216 | 104 |
| 24 | 3300037312 | Ga0395899_0011107 | Ga0395899_0011107_3515_3829 | 104 |
| 25 | 3300037418 | Ga0395900_0128335 | Ga0395900_0128335_213_527 | 104 |
| 26 | 3300039453 | Ga0436362_1302218 | Ga0436362_1302218_44_358 | 104 |
| 27 | 3300047319 | Ga0495674_0744139 | Ga0495674_0744139_16_330 | 104 |
| 28 | 3300005331 | Ga0070670_100102903 | Ga0070670_1001029032 | 105 |
| 29 | 3300005335 | Ga0070666_10080107 | Ga0070666_100801074 | 105 |
| 30 | 3300005338 | Ga0068868_100341280 | Ga0068868_1003412801 | 105 |
| 31 | 3300005347 | Ga0070668_100001440 | Ga0070668_10000144013 | 105 |
| 32 | 3300005367 | Ga0070667_100000130 | Ga0070667_10000013045 | 105 |
| 33 | 3300005436 | Ga0070713_100402866 | Ga0070713_1004028662 | 105 |
| 34 | 3300005437 | Ga0070710_10122601 | Ga0070710_101226015 | 105 |
| 35 | 3300005563 | Ga0068855_100451545 | Ga0068855_1004515452 | 105 |
| 36 | 3300005841 | Ga0068863_100000029 | Ga0068863_100000029114 | 105 |
| 37 | 3300009094 | Ga0111539_10756246 | Ga0111539_107562462 | 105 |
| 38 | 3300013104 | Ga0157370_10260034 | Ga0157370_102600342 | 105 |
| 39 | 3300013105 | Ga0157369_11791142 | Ga0157369_117911421 | 105 |
| 40 | 3300013307 | Ga0157372_10098015 | Ga0157372_100980152 | 105 |
| 41 | 3300014326 | Ga0157380_12971875 | Ga0157380_129718752 | 105 |
| 42 | 3300025903 | Ga0207680_10059851 | Ga0207680_100598512 | 105 |
| 43 | 3300025905 | Ga0207685_10061299 | Ga0207685_100612994 | 105 |
| 44 | 3300025909 | Ga0207705_10142865 | Ga0207705_101428654 | 105 |
| 45 | 3300025923 | Ga0207681_11017897 | Ga0207681_110178973 | 105 |
| 46 | 3300025925 | Ga0207650_10116381 | Ga0207650_101163814 | 105 |
| 47 | 3300025928 | Ga0207700_10562852 | Ga0207700_105628522 | 105 |
| 48 | 3300025949 | Ga0207667_10839412 | Ga0207667_108394122 | 105 |
| 49 | 3300025972 | Ga0207668_10010583 | Ga0207668_100105835 | 105 |
| 50 | 3300025986 | Ga0207658_10000100 | Ga0207658_1000010050 | 105 |
| 51 | 3300026023 | Ga0207677_12138021 | Ga0207677_121380212 | 105 |
| 52 | 3300026088 | Ga0207641_10000049 | Ga0207641_10000049114 | 105 |
| 53 | 3300028381 | Ga0268264_10326413 | Ga0268264_103264133 | 105 |
| 54 | 3300031901 | Ga0307406_11023424 | Ga0307406_110234242 | 105 |
| 55 | 3300039447 | Ga0436361_0678368 | Ga0436361_0678368_969_1286 | 105 |
| 56 | 3300046462 | Ga0495651_0446678 | Ga0495651_0446678_311_628 | 105 |
| 57 | 3300046675 | Ga0495657_0596819 | Ga0495657_0596819_239_556 | 105 |
| 58 | 3300046683 | Ga0495658_1017941 | Ga0495658_1017941_75_392 | 105 |
| 59 | 3300047673 | Ga0495593_0720869 | Ga0495593_0720869_135_452 | 105 |
| 60 | 3300050511 | nmdc:mga08y16_1058916_c1 | nmdc:mga08y16_1058916_c1_166_504 | 105 |
| 61 | 3300001979 | JGI24740J21852_10161685 | JGI24740J21852_101616851 | 106 |
| 62 | 3300001989 | JGI24739J22299_10127011 | JGI24739J22299_101270112 | 106 |
| 63 | 3300001990 | JGI24737J22298_10183935 | JGI24737J22298_101839352 | 106 |
| 64 | 3300002075 | JGI24738J21930_10023486 | JGI24738J21930_100234863 | 106 |
| 65 | 3300002705 | JGI25156J39149_1001179 | JGI25156J39149_10011793 | 106 |
| 66 | 3300002705 | JGI25156J39149_1002755 | JGI25156J39149_10027554 | 106 |
| 67 | 3300003316 | rootH1_10017679 | rootH1_100176792 | 106 |
| 68 | 3300003320 | rootH2_10023369 | rootH2_1002336918 | 106 |
| 69 | 3300003322 | rootL2_10006463 | rootL2_1000646314 | 106 |
| 70 | 3300003323 | rootH1_10365108 | rootH1_103651085 | 106 |
| 71 | 3300003354 | JGI25160J50197_1000111 | JGI25160J50197_100011143 | 106 |
| 72 | 3300003751 | Ga0055538_1000013 | Ga0055538_1000013132 | 106 |
| 73 | 3300003752 | Ga0055539_1000018 | Ga0055539_1000018132 | 106 |
| 74 | 3300003756 | Ga0055533_1000022 | Ga0055533_1000022132 | 106 |
| 75 | 3300003758 | Ga0055532_1000082 | Ga0055532_1000082154 | 106 |
| 76 | 3300003759 | Ga0055525_1000024 | Ga0055525_1000024132 | 106 |
| 77 | 3300003760 | Ga0055527_1000039 | Ga0055527_1000039154 | 106 |
| 78 | 3300003761 | Ga0055535_1000012 | Ga0055535_1000012404 | 106 |
| 79 | 3300003763 | Ga0055529_1000112 | Ga0055529_100011218 | 106 |
| 80 | 3300003771 | Ga0055526_1000635 | Ga0055526_100063521 | 106 |
| 81 | 3300003773 | Ga0055537_1000158 | Ga0055537_100015823 | 106 |
| 82 | 3300003775 | Ga0055524_1008762 | Ga0055524_10087623 | 106 |
| 83 | 3300003784 | Ga0055534_1000319 | Ga0055534_10003196 | 106 |
| 84 | 3300003790 | Ga0055528_1000143 | Ga0055528_100014329 | 106 |
| 85 | 3300003841 | Ga0055541_1000013 | Ga0055541_1000013132 | 106 |
| 86 | 3300005262 | Ga0065165_1000453 | Ga0065165_100045317 | 106 |
| 87 | 3300005327 | Ga0070658_10330058 | Ga0070658_103300583 | 106 |
| 88 | 3300005329 | Ga0070683_100374815 | Ga0070683_1003748154 | 106 |
| 89 | 3300005339 | Ga0070660_100000239 | Ga0070660_1000002392 | 106 |
| 90 | 3300005365 | Ga0070688_100588751 | Ga0070688_1005887513 | 106 |
| 91 | 3300005366 | Ga0070659_100000324 | Ga0070659_1000003242 | 106 |
| 92 | 3300005366 | Ga0070659_100601477 | Ga0070659_1006014773 | 106 |
| 93 | 3300005434 | Ga0070709_10393891 | Ga0070709_103938911 | 106 |
| 94 | 3300005435 | Ga0070714_100345964 | Ga0070714_1003459643 | 106 |
| 95 | 3300005435 | Ga0070714_100387134 | Ga0070714_1003871342 | 106 |
| 96 | 3300005436 | Ga0070713_100085704 | Ga0070713_1000857042 | 106 |
| 97 | 3300005455 | Ga0070663_100029545 | Ga0070663_1000295454 | 106 |
| 98 | 3300005467 | Ga0070706_100189238 | Ga0070706_1001892382 | 106 |
| 99 | 3300005518 | Ga0070699_100379796 | Ga0070699_1003797962 | 106 |
| 100 | 3300005548 | Ga0070665_100438194 | Ga0070665_1004381942 | 106 |
| 101 | 3300005548 | Ga0070665_101087965 | Ga0070665_1010879652 | 106 |
| 102 | 3300005563 | Ga0068855_100000645 | Ga0068855_1000006459 | 106 |
| 103 | 3300005563 | Ga0068855_100020370 | Ga0068855_1000203704 | 106 |
| 104 | 3300005563 | Ga0068855_101229621 | Ga0068855_1012296212 | 106 |
| 105 | 3300005563 | Ga0068855_101568417 | Ga0068855_1015684171 | 106 |
| 106 | 3300005563 | Ga0068855_101672541 | Ga0068855_1016725411 | 106 |
| 107 | 3300005564 | Ga0070664_101312122 | Ga0070664_1013121221 | 106 |
| 108 | 3300005578 | Ga0068854_100368862 | Ga0068854_1003688623 | 106 |
| 109 | 3300005614 | Ga0068856_100453238 | Ga0068856_1004532381 | 106 |
| 110 | 3300005616 | Ga0068852_100563640 | Ga0068852_1005636404 | 106 |
| 111 | 3300005617 | Ga0068859_101593529 | Ga0068859_1015935292 | 106 |
| 112 | 3300005834 | Ga0068851_10560230 | Ga0068851_105602302 | 106 |
| 113 | 3300005841 | Ga0068863_100026173 | Ga0068863_1000261735 | 106 |
| 114 | 3300005842 | Ga0068858_101241116 | Ga0068858_1012411162 | 106 |
| 115 | 3300005844 | Ga0068862_101924487 | Ga0068862_1019244871 | 106 |
| 116 | 3300006028 | Ga0070717_11717286 | Ga0070717_117172861 | 106 |
| 117 | 3300006175 | Ga0070712_100217272 | Ga0070712_1002172722 | 106 |
| 118 | 3300006175 | Ga0070712_100315650 | Ga0070712_1003156501 | 106 |
| 119 | 3300006175 | Ga0070712_101314074 | Ga0070712_1013140742 | 106 |
| 120 | 3300006237 | Ga0097621_100902447 | Ga0097621_1009024473 | 106 |
| 121 | 3300006931 | Ga0097620_101593823 | Ga0097620_1015938232 | 106 |
| 122 | 3300007265 | Ga0099794_10202786 | Ga0099794_102027862 | 106 |
| 123 | 3300009092 | Ga0105250_10027102 | Ga0105250_100271023 | 106 |
| 124 | 3300009093 | Ga0105240_10105333 | Ga0105240_101053332 | 106 |
| 125 | 3300009093 | Ga0105240_11662298 | Ga0105240_116622982 | 106 |
| 126 | 3300009101 | Ga0105247_11430004 | Ga0105247_114300042 | 106 |
| 127 | 3300009174 | Ga0105241_10330461 | Ga0105241_103304612 | 106 |
| 128 | 3300009174 | Ga0105241_11943051 | Ga0105241_119430512 | 106 |
| 129 | 3300009177 | Ga0105248_11276680 | Ga0105248_112766802 | 106 |
| 130 | 3300009177 | Ga0105248_12058250 | Ga0105248_120582502 | 106 |
| 131 | 3300009545 | Ga0105237_10024655 | Ga0105237_100246557 | 106 |
| 132 | 3300009545 | Ga0105237_10369045 | Ga0105237_103690452 | 106 |
| 133 | 3300009551 | Ga0105238_10007147 | Ga0105238_100071473 | 106 |
| 134 | 3300009551 | Ga0105238_10701652 | Ga0105238_107016522 | 106 |
| 135 | 3300009978 | Ga0105148_112721 | Ga0105148_1127211 | 106 |
| 136 | 3300010375 | Ga0105239_10114276 | Ga0105239_101142766 | 106 |
| 137 | 3300010375 | Ga0105239_10773836 | Ga0105239_107738363 | 106 |
| 138 | 3300013100 | Ga0157373_10008695 | Ga0157373_100086955 | 106 |
| 139 | 3300013102 | Ga0157371_10751187 | Ga0157371_107511871 | 106 |
| 140 | 3300013104 | Ga0157370_10137520 | Ga0157370_101375205 | 106 |
| 141 | 3300013104 | Ga0157370_10506731 | Ga0157370_105067313 | 106 |
| 142 | 3300013105 | Ga0157369_10073154 | Ga0157369_100731542 | 106 |
| 143 | 3300013105 | Ga0157369_10090342 | Ga0157369_100903423 | 106 |
| 144 | 3300013105 | Ga0157369_11602263 | Ga0157369_116022632 | 106 |
| 145 | 3300013308 | Ga0157375_10852044 | Ga0157375_108520441 | 106 |
| 146 | 3300014969 | Ga0157376_12119582 | Ga0157376_121195821 | 106 |
| 147 | 3300015265 | Ga0182005_1005765 | Ga0182005_10057654 | 106 |
| 148 | 3300020077 | Ga0206351_10758351 | Ga0206351_107583511 | 106 |
| 149 | 3300020078 | Ga0206352_11261789 | Ga0206352_112617892 | 106 |
| 150 | 3300020080 | Ga0206350_11368649 | Ga0206350_113686493 | 106 |
| 151 | 3300021358 | Ga0213873_10007849 | Ga0213873_100078492 | 106 |
| 152 | 3300021361 | Ga0213872_10078642 | Ga0213872_100786422 | 106 |
| 153 | 3300021361 | Ga0213872_10089005 | Ga0213872_100890052 | 106 |
| 154 | 3300021361 | Ga0213872_10117023 | Ga0213872_101170231 | 106 |
| 155 | 3300021388 | Ga0213875_10039446 | Ga0213875_100394462 | 106 |
| 156 | 3300021441 | Ga0213871_10021063 | Ga0213871_100210632 | 106 |
| 157 | 3300021441 | Ga0213871_10099406 | Ga0213871_100994061 | 106 |
| 158 | 3300022467 | Ga0224712_10116816 | Ga0224712_101168162 | 106 |
| 159 | 3300025224 | Ga0209784_100005 | Ga0209784_100005592 | 106 |
| 160 | 3300025225 | Ga0209566_100005 | Ga0209566_100005592 | 106 |
| 161 | 3300025226 | Ga0209674_100009 | Ga0209674_100009592 | 106 |
| 162 | 3300025228 | Ga0209672_100092 | Ga0209672_100092154 | 106 |
| 163 | 3300025229 | Ga0209147_100133 | Ga0209147_100133154 | 106 |
| 164 | 3300025230 | Ga0209563_100012 | Ga0209563_100012592 | 106 |
| 165 | 3300025242 | Ga0209258_100208 | Ga0209258_100208154 | 106 |
| 166 | 3300025253 | Ga0209677_100006 | Ga0209677_100006592 | 106 |
| 167 | 3300025254 | Ga0209148_1002710 | Ga0209148_100271013 | 106 |
| 168 | 3300025256 | Ga0209759_1000433 | Ga0209759_100043325 | 106 |
| 169 | 3300025256 | Ga0209759_1006297 | Ga0209759_10062972 | 106 |
| 170 | 3300025256 | Ga0209759_1013463 | Ga0209759_10134632 | 106 |
| 171 | 3300025263 | Ga0209565_1000006 | Ga0209565_1000006800 | 106 |
| 172 | 3300025272 | Ga0209455_1000159 | Ga0209455_1000159154 | 106 |
| 173 | 3300025273 | Ga0209673_1000004 | Ga0209673_100000429 | 106 |
| 174 | 3300025291 | Ga0209675_1000123 | Ga0209675_100012329 | 106 |
| 175 | 3300025295 | Ga0209564_1000420 | Ga0209564_100042029 | 106 |
| 176 | 3300025299 | Ga0209256_1000219 | Ga0209256_100021929 | 106 |
| 177 | 3300025302 | Ga0207426_1000110 | Ga0207426_1000110172 | 106 |
| 178 | 3300025711 | Ga0207696_1018115 | Ga0207696_10181153 | 106 |
| 179 | 3300025898 | Ga0207692_10201944 | Ga0207692_102019442 | 106 |
| 180 | 3300025900 | Ga0207710_10549729 | Ga0207710_105497292 | 106 |
| 181 | 3300025904 | Ga0207647_10058183 | Ga0207647_100581833 | 106 |
| 182 | 3300025904 | Ga0207647_10276663 | Ga0207647_102766632 | 106 |
| 183 | 3300025906 | Ga0207699_10570403 | Ga0207699_105704031 | 106 |
| 184 | 3300025909 | Ga0207705_10005976 | Ga0207705_100059765 | 106 |
| 185 | 3300025909 | Ga0207705_11213412 | Ga0207705_112134122 | 106 |
| 186 | 3300025910 | Ga0207684_10084430 | Ga0207684_100844302 | 106 |
| 187 | 3300025911 | Ga0207654_11209131 | Ga0207654_112091312 | 106 |
| 188 | 3300025913 | Ga0207695_10064490 | Ga0207695_100644903 | 106 |
| 189 | 3300025915 | Ga0207693_10013083 | Ga0207693_100130834 | 106 |
| 190 | 3300025915 | Ga0207693_10583975 | Ga0207693_105839752 | 106 |
| 191 | 3300025916 | Ga0207663_10757788 | Ga0207663_107577882 | 106 |
| 192 | 3300025919 | Ga0207657_10000663 | Ga0207657_100006632 | 106 |
| 193 | 3300025924 | Ga0207694_10004191 | Ga0207694_1000419114 | 106 |
| 194 | 3300025928 | Ga0207700_10211592 | Ga0207700_102115921 | 106 |
| 195 | 3300025929 | Ga0207664_10087845 | Ga0207664_100878453 | 106 |
| 196 | 3300025932 | Ga0207690_10000082 | Ga0207690_1000008271 | 106 |
| 197 | 3300025932 | Ga0207690_10542592 | Ga0207690_105425922 | 106 |
| 198 | 3300025939 | Ga0207665_11350750 | Ga0207665_113507501 | 106 |
| 199 | 3300025945 | Ga0207679_11317210 | Ga0207679_113172102 | 106 |
| 200 | 3300025945 | Ga0207679_11318118 | Ga0207679_113181181 | 106 |
| 201 | 3300025949 | Ga0207667_10000191 | Ga0207667_1000019172 | 106 |
| 202 | 3300025949 | Ga0207667_10001176 | Ga0207667_1000117633 | 106 |
| 203 | 3300025949 | Ga0207667_10858391 | Ga0207667_108583912 | 106 |
| 204 | 3300025986 | Ga0207658_10001044 | Ga0207658_100010442 | 106 |
| 205 | 3300026067 | Ga0207678_10094181 | Ga0207678_100941814 | 106 |
| 206 | 3300026078 | Ga0207702_12049025 | Ga0207702_120490251 | 106 |
| 207 | 3300026088 | Ga0207641_10019212 | Ga0207641_100192125 | 106 |
| 208 | 3300026142 | Ga0207698_11796685 | Ga0207698_117966852 | 106 |
| 209 | 3300028016 | Ga0265354_1000713 | Ga0265354_10007136 | 106 |
| 210 | 3300028800 | Ga0265338_10088755 | Ga0265338_100887552 | 106 |
| 211 | 3300030760 | Ga0265762_1065726 | Ga0265762_10657262 | 106 |
| 212 | 3300030878 | Ga0265770_1001147 | Ga0265770_10011475 | 106 |
| 213 | 3300031090 | Ga0265760_10001148 | Ga0265760_100011488 | 106 |
| 214 | 3300031242 | Ga0265329_10053165 | Ga0265329_100531653 | 106 |
| 215 | 3300031251 | Ga0265327_10000437 | Ga0265327_1000043723 | 106 |
| 216 | 3300031251 | Ga0265327_10009849 | Ga0265327_100098491 | 106 |
| 217 | 3300031344 | Ga0265316_10000213 | Ga0265316_1000021332 | 106 |
| 218 | 3300031344 | Ga0265316_10985855 | Ga0265316_109858552 | 106 |
| 219 | 3300031548 | Ga0307408_100049865 | Ga0307408_1000498655 | 106 |
| 220 | 3300031731 | Ga0307405_10014229 | Ga0307405_100142295 | 106 |
| 221 | 3300031731 | Ga0307405_10049759 | Ga0307405_100497594 | 106 |
| 222 | 3300031901 | Ga0307406_10109847 | Ga0307406_101098471 | 106 |
| 223 | 3300031911 | Ga0307412_10000015 | Ga0307412_10000015280 | 106 |
| 224 | 3300031911 | Ga0307412_10000633 | Ga0307412_100006338 | 106 |
| 225 | 3300035171 | Ga0373946_0126940 | Ga0373946_0126940_603_926 | 106 |
| 226 | 3300035692 | Ga0373935_0253547 | Ga0373935_0253547_723_1046 | 106 |
| 227 | 3300037068 | Ga0373925_0449601 | Ga0373925_0449601_418_741 | 106 |
| 228 | 3300037418 | Ga0395900_0000074 | Ga0395900_0000074_9929_10249 | 106 |
| 229 | 3300037466 | Ga0395898_0465973 | Ga0395898_0465973_74_394 | 106 |
| 230 | 3300037471 | Ga0395905_0358209 | Ga0395905_0358209_588_908 | 106 |
| 231 | 3300037471 | Ga0395905_0562898 | Ga0395905_0562898_473_793 | 106 |
| 232 | 3300037853 | Ga0436364_1053450 | Ga0436364_1053450_502_828 | 106 |
| 233 | 3300039438 | Ga0436360_0335658 | Ga0436360_0335658_2226_2546 | 106 |
| 234 | 3300039438 | Ga0436360_0579778 | Ga0436360_0579778_1564_1884 | 106 |
| 235 | 3300039438 | Ga0436360_1339278 | Ga0436360_1339278_5102_5422 | 106 |
| 236 | 3300039447 | Ga0436361_0047224 | Ga0436361_0047224_827_1147 | 106 |
| 237 | 3300039447 | Ga0436361_0408108 | Ga0436361_0408108_392_712 | 106 |
| 238 | 3300039447 | Ga0436361_0743401 | Ga0436361_0743401_468_788 | 106 |
| 239 | 3300039447 | Ga0436361_1205114 | Ga0436361_1205114_1399_1719 | 106 |
| 240 | 3300039450 | Ga0436363_1499293 | Ga0436363_1499293_39_383 | 106 |
| 241 | 3300039453 | Ga0436362_0578983 | Ga0436362_0578983_1113_1457 | 106 |
| 242 | 3300039453 | Ga0436362_0642631 | Ga0436362_0642631_1017_1337 | 106 |
| 243 | 3300039453 | Ga0436362_1141231 | Ga0436362_1141231_998_1348 | 106 |
| 244 | 3300041512 | Ga0451853_1875834 | Ga0451853_1875834_132_455 | 106 |
| 245 | 3300044684 | Ga0466966_0016605 | Ga0466966_0016605_374_700 | 106 |
| 246 | 3300044693 | Ga0466961_0008947 | Ga0466961_0008947_1386_1712 | 106 |
| 247 | 3300044693 | Ga0466961_0177746 | Ga0466961_0177746_132_461 | 106 |
| 248 | 3300044694 | Ga0466963_0531589 | Ga0466963_0531589_400_720 | 106 |
| 249 | 3300044765 | Ga0466970_0001404 | Ga0466970_0001404_2106_2432 | 106 |
| 250 | 3300044901 | Ga0466960_0043203 | Ga0466960_0043203_52_378 | 106 |
| 251 | 3300045049 | Ga0466959_0019257 | Ga0466959_0019257_16_342 | 106 |
| 252 | 3300045049 | Ga0466959_0068669 | Ga0466959_0068669_1879_2208 | 106 |
| 253 | 3300045049 | Ga0466959_0186329 | Ga0466959_0186329_845_1171 | 106 |
| 254 | 3300046455 | Ga0495603_0034438 | Ga0495603_0034438_1670_1990 | 106 |
| 255 | 3300046463 | Ga0495653_0196135 | Ga0495653_0196135_430_750 | 106 |
| 256 | 3300046471 | Ga0495650_0001375 | Ga0495650_0001375_22045_22365 | 106 |
| 257 | 3300046472 | Ga0495580_0038944 | Ga0495580_0038944_1977_2297 | 106 |
| 258 | 3300046472 | Ga0495580_0309689 | Ga0495580_0309689_277_597 | 106 |
| 259 | 3300046472 | Ga0495580_0325571 | Ga0495580_0325571_390_710 | 106 |
| 260 | 3300046474 | Ga0495605_0025281 | Ga0495605_0025281_1355_1675 | 106 |
| 261 | 3300046491 | Ga0495584_0000573 | Ga0495584_0000573_2195_2515 | 106 |
| 262 | 3300046491 | Ga0495584_0318830 | Ga0495584_0318830_123_443 | 106 |
| 263 | 3300046492 | Ga0495585_0592207 | Ga0495585_0592207_45_365 | 106 |
| 264 | 3300046500 | Ga0495596_0013531 | Ga0495596_0013531_2017_2337 | 106 |
| 265 | 3300046506 | Ga0495583_0020942 | Ga0495583_0020942_1949_2269 | 106 |
| 266 | 3300046507 | Ga0495606_0357879 | Ga0495606_0357879_28_348 | 106 |
| 267 | 3300046507 | Ga0495606_0441413 | Ga0495606_0441413_274_594 | 106 |
| 268 | 3300046512 | Ga0495610_0000447 | Ga0495610_0000447_1989_2309 | 106 |
| 269 | 3300046516 | Ga0495628_0388241 | Ga0495628_0388241_465_785 | 106 |
| 270 | 3300046528 | Ga0495642_0223761 | Ga0495642_0223761_114_434 | 106 |
| 271 | 3300046557 | Ga0495622_0115912 | Ga0495622_0115912_164_484 | 106 |
| 272 | 3300046648 | Ga0495611_0093540 | Ga0495611_0093540_1056_1376 | 106 |
| 273 | 3300046680 | Ga0495646_0296134 | Ga0495646_0296134_488_808 | 106 |
| 274 | 3300046691 | Ga0495670_0461719 | Ga0495670_0461719_173_493 | 106 |
| 275 | 3300046692 | Ga0495671_0105106 | Ga0495671_0105106_454_774 | 106 |
| 276 | 3300046694 | Ga0495649_0453462 | Ga0495649_0453462_207_527 | 106 |
| 277 | 3300047318 | Ga0495636_0003008 | Ga0495636_0003008_4246_4566 | 106 |
| 278 | 3300047319 | Ga0495674_0097583 | Ga0495674_0097583_2154_2474 | 106 |
| 279 | 3300047320 | Ga0495672_0043237 | Ga0495672_0043237_1039_1359 | 106 |
| 280 | 3300047320 | Ga0495672_0126661 | Ga0495672_0126661_218_538 | 106 |
| 281 | 3300047323 | Ga0495683_0087387 | Ga0495683_0087387_92_412 | 106 |
| 282 | 3300047443 | Ga0495687_013185 | Ga0495687_013185_597_917 | 106 |
| 283 | 3300047443 | Ga0495687_188270 | Ga0495687_188270_313_633 | 106 |
| 284 | 3300047673 | Ga0495593_0186535 | Ga0495593_0186535_330_650 | 106 |
| 285 | 3300048088 | Ga0495602_0051928 | Ga0495602_0051928_2374_2694 | 106 |
| 286 | 3300048091 | Ga0495626_0065039 | Ga0495626_0065039_82_402 | 106 |
| 287 | 3300048908 | Ga0496105_0318705 | Ga0496105_0318705_576_896 | 106 |
| 288 | 3300048913 | Ga0496110_0930473 | Ga0496110_0930473_352_672 | 106 |
| 289 | 3300048916 | Ga0496113_1362795 | Ga0496113_1362795_101_451 | 106 |
| 290 | 3300048919 | Ga0496116_0003203 | Ga0496116_0003203_7512_7832 | 106 |
| 291 | 3300048920 | Ga0496117_0294762 | Ga0496117_0294762_176_496 | 106 |
| 292 | 3300048925 | Ga0496122_0080773 | Ga0496122_0080773_854_1174 | 106 |
| 293 | 3300048926 | Ga0496123_0026796 | Ga0496123_0026796_2967_3287 | 106 |
| 294 | 3300048927 | Ga0496124_0107189 | Ga0496124_0107189_894_1214 | 106 |
| 295 | 3300048928 | Ga0496125_0072819 | Ga0496125_0072819_1235_1555 | 106 |
| 296 | 3300049460 | Ga0495682_0103710 | Ga0495682_0103710_344_664 | 106 |
| 297 | 3300049460 | Ga0495682_0142006 | Ga0495682_0142006_139_459 | 106 |
| 298 | 3300049570 | Ga0501033_0026482 | Ga0501033_0026482_1215_1535 | 106 |
| 299 | 3300049571 | Ga0501034_0078093 | Ga0501034_0078093_2862_3182 | 106 |
| 300 | 3300049572 | Ga0501036_0083153 | Ga0501036_0083153_1927_2247 | 106 |
| 301 | 3300049574 | Ga0501038_0258363 | Ga0501038_0258363_340_660 | 106 |
| 302 | 3300049581 | Ga0501047_0442585 | Ga0501047_0442585_633_953 | 106 |
| 303 | 3300049586 | Ga0501070_0056560 | Ga0501070_0056560_1680_2000 | 106 |
| 304 | 3300049589 | Ga0501073_0058435 | Ga0501073_0058435_155_475 | 106 |
| 305 | 3300049590 | Ga0501074_0007914 | Ga0501074_0007914_4695_5015 | 106 |
| 306 | 3300049742 | Ga0501080_0048097 | Ga0501080_0048097_2219_2539 | 106 |
| 307 | 3300049822 | Ga0501035_0125236 | Ga0501035_0125236_1305_1625 | 106 |
| 308 | 3300049823 | Ga0501044_0075419 | Ga0501044_0075419_2606_2926 | 106 |
| 309 | 3300049823 | Ga0501044_0329571 | Ga0501044_0329571_10_330 | 106 |
| 310 | 3300053087 | Ga0500643_001188 | Ga0500643_001188_14752_15102 | 106 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ckh-assembly1.cif.gz_A | e. coli mazf e24a form iib | 0.8935 | 2 | 104 |
| 5co7-assembly3.cif.gz_F | e. coli mazf form iii | 0.8865 | 2 | 106 |
| 5co7-assembly2.cif.gz_D | e. coli mazf form iii | 0.884 | 1 | 105 |
| 5xe2-assembly1.cif.gz_A-2 | endoribonuclease from mycobacterial species | 0.8801 | 2 | 105 |
| 5ck9-assembly1.cif.gz_A | e. coli mazf form i | 0.8742 | 2 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5cqyB00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8772 | 2 | 106 | 2.30.30.110 |
| af_P9WII5_1_103_2.30.30.110 | Mainly Beta;Roll;SH3 type barrels.; | 0.8697 | 2 | 105 | 2.30.30.110 |
| 2mf2B00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8607 | 2 | 102 | 2.30.30.110 |
| af_P0CL62_2_115_2.30.30.110 | Mainly Beta;Roll;SH3 type barrels.; | 0.8593 | 3 | 105 | 2.30.30.110 |
| af_P95272_7_108_2.30.30.110 | Mainly Beta;Roll;SH3 type barrels.; | 0.8508 | 4 | 105 | 2.30.30.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259IGU8-F1-model_v4 | Growth inhibitor PemK | 0.9792 | 25 | 104 |
GO:0003677
GO:0004521 GO:0006402 GO:0016075 |
| AF-A0A3D4Z0D7-F1-model_v4 | Transcriptional regulator | 0.9774 | 42 | 104 |
GO:0003677
|
| AF-A0A372DDN4-F1-model_v4 | Type II toxin-antitoxin system PemK/MazF family toxin | 0.9748 | 40 | 106 |
GO:0003677
|
| AF-A0A388RMV5-F1-model_v4 | Uncharacterized protein | 0.9721 | 34 | 106 |
GO:0003677
|
| AF-A0A2A6RDR6-F1-model_v4 | Transcriptional regulator | 0.9624 | 20 | 106 |
GO:0003677
GO:0004521 GO:0006402 GO:0016075 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar