F400562

General Info

Members Datasets Scaffolds Average Seq Length
310 236 292 107

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100588751|Ga0070688_1005887513
Length 123
Sequence VRSSDLPGPRTTPQGAPAIARGEIWLAALDPTVGSEIQKTRPCVIISPPEMHDFLRTVTVAPMTTGSRPAPYRIPFRFAGKQGLILLDQMRTLDKQRLARPLGAVTANTLWRALAALREMFEE

Samples

Sample ID Description Type Environment
1 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
4 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
5 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
6 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
7 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
8 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
9 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
10 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
11 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
12 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
13 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
233 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
234 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
235 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
236 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.94
Metatranscriptomes 2.26
Isolates 5.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.97
Nodule 1.29
Rhizoplane 1.29
Rhizosphere 77.42
Stem 0
Stem Tuber 0
Unclassified 9.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10161685 3300001979 Bacteria 555
2 JGI24739J22299_10127011 3300001989 Bacteria 760
3 JGI24737J22298_10183935 3300001990 Bacteria 617
4 JGI24738J21930_10023486 3300002075 Bacteria 1270
5 JGI25156J39149_1001179 3300002705 Bacteria 11622
6 JGI25156J39149_1002755 3300002705 Bacteria 6109
7 rootH1_10017679 3300003316 Bacteria 2096
8 rootH2_10023369 3300003320 Bacteria 12999
9 rootL2_10006463 3300003322 Bacteria 9895
10 rootH1_10365108 3300003323 Bacteria 1908
11 JGI25160J50197_1000111 3300003354 Bacteria 77225
12 Ga0055538_1000013 3300003751 Bacteria 348596
13 Ga0055539_1000018 3300003752 Bacteria 348596
14 Ga0055533_1000022 3300003756 Bacteria 348596
15 Ga0055532_1000082 3300003758 Bacteria 118619
16 Ga0055525_1000024 3300003759 Bacteria 348596
17 Ga0055527_1000039 3300003760 Bacteria 118619
18 Ga0055535_1000012 3300003761 Bacteria 330206
19 Ga0055529_1000112 3300003763 Bacteria 118619
20 Ga0055526_1000635 3300003771 Bacteria 27287
21 Ga0055537_1000158 3300003773 Bacteria 50485
22 Ga0055524_1008762 3300003775 Bacteria 4176
23 Ga0055534_1000319 3300003784 Bacteria 31908
24 Ga0055528_1000143 3300003790 Bacteria 58169
25 Ga0055541_1000013 3300003841 Bacteria 348596
26 Ga0065165_1000453 3300005262 Bacteria 64295
27 Ga0070658_10330058 3300005327 Bacteria 1303
28 Ga0070683_100374815 3300005329 Bacteria 1356
29 Ga0070670_100102903 3300005331 Bacteria 2460
30 Ga0070666_10080107 3300005335 Bacteria 2231
31 Ga0068868_100341280 3300005338 Unclassified 1281
32 Ga0070660_100000239 3300005339 Bacteria 36635
33 Ga0070668_100001440 3300005347 Bacteria 17174
34 Ga0070688_100588751 3300005365 Bacteria 850
35 Ga0070659_100000324 3300005366 Bacteria 36635
36 Ga0070659_100601477 3300005366 Bacteria 945
37 Ga0070667_100000130 3300005367 Bacteria 95182
38 Ga0070709_10393891 3300005434 Bacteria 1033
39 Ga0070714_100345964 3300005435 Unclassified 1395
40 Ga0070714_100387134 3300005435 Bacteria 1319
41 Ga0070713_100085704 3300005436 Bacteria 2699
42 Ga0070713_100402866 3300005436 Bacteria 1278
43 Ga0070710_10122601 3300005437 Unclassified 1575
44 Ga0070663_100029545 3300005455 Bacteria 3747
45 Ga0070706_100189238 3300005467 Bacteria 1923
46 Ga0070699_100379796 3300005518 Bacteria 1276
47 Ga0070665_100438194 3300005548 Bacteria 1316
48 Ga0070665_101087965 3300005548 Bacteria 811
49 Ga0068855_100000645 3300005563 Bacteria 42677
50 Ga0068855_100020370 3300005563 Bacteria 7956
51 Ga0068855_100451545 3300005563 Bacteria 1403
52 Ga0068855_101229621 3300005563 Bacteria 778
53 Ga0068855_101568417 3300005563 Unclassified 674
54 Ga0068855_101672541 3300005563 Bacteria 650
55 Ga0070664_101312122 3300005564 Unclassified 683
56 Ga0068854_100368862 3300005578 Bacteria 1180
57 Ga0068856_100453238 3300005614 Bacteria 1304
58 Ga0068852_100563640 3300005616 Unclassified 1140
59 Ga0068859_101593529 3300005617 Unclassified 721
60 Ga0068851_10560230 3300005834 Bacteria 691
61 Ga0068863_100000029 3300005841 Bacteria 177191
62 Ga0068863_100026173 3300005841 Bacteria 5567
63 Ga0068858_101241116 3300005842 Unclassified 733
64 Ga0068862_101924487 3300005844 Unclassified 601
65 Ga0070717_11717286 3300006028 Unclassified 568
66 Ga0070712_100217272 3300006175 Unclassified 1511
67 Ga0070712_100315650 3300006175 Bacteria 1269
68 Ga0070712_101314074 3300006175 Unclassified 630
69 Ga0097621_100902447 3300006237 Bacteria 823
70 Ga0097620_101593823 3300006931 Unclassified 721
71 Ga0099794_10202786 3300007265 Bacteria 1016
72 Ga0099794_10355761 3300007265 Bacteria 762
73 Ga0105250_10027102 3300009092 Bacteria 2309
74 Ga0105240_10105333 3300009093 Bacteria 3424
75 Ga0105240_11662298 3300009093 Bacteria 667
76 Ga0111539_10756246 3300009094 Bacteria 1131
77 Ga0105247_11430004 3300009101 Bacteria 561
78 Ga0105241_10330461 3300009174 Bacteria 1317
79 Ga0105241_11943051 3300009174 Unclassified 578
80 Ga0105248_11276680 3300009177 Bacteria 830
81 Ga0105248_12058250 3300009177 Bacteria 649
82 Ga0105237_10024655 3300009545 Bacteria 6152
83 Ga0105237_10369045 3300009545 Bacteria 1440
84 Ga0105238_10007147 3300009551 Bacteria 11166
85 Ga0105238_10701652 3300009551 Bacteria 1024
86 Ga0105148_112721 3300009978 Bacteria 653
87 Ga0105239_10114276 3300010375 Bacteria 2995
88 Ga0105239_10773836 3300010375 Unclassified 1099
89 Ga0157373_10008695 3300013100 Bacteria 7535
90 Ga0157371_10751187 3300013102 Unclassified 732
91 Ga0157370_10137520 3300013104 Bacteria 2276
92 Ga0157370_10260034 3300013104 Unclassified 1604
93 Ga0157370_10506731 3300013104 Bacteria 1108
94 Ga0157369_10073154 3300013105 Bacteria 3678
95 Ga0157369_10090342 3300013105 Bacteria 3270
96 Ga0157369_11602263 3300013105 Bacteria 662
97 Ga0157369_11791142 3300013105 Bacteria 624
98 Ga0157372_10098015 3300013307 Bacteria 3344
99 Ga0157375_10852044 3300013308 Bacteria 1058
100 Ga0157380_12971875 3300014326 Bacteria 540
101 Ga0157376_12119582 3300014969 Bacteria 601
102 Ga0182005_1005765 3300015265 Bacteria 3843
103 Ga0206351_10758351 3300020077 Bacteria 599
104 Ga0206352_11261789 3300020078 Bacteria 703
105 Ga0206350_11368649 3300020080 Unclassified 942
106 Ga0213873_10007849 3300021358 Bacteria 2155
107 Ga0213872_10078642 3300021361 Unclassified 1482
108 Ga0213872_10089005 3300021361 Bacteria 1383
109 Ga0213872_10117023 3300021361 Unclassified 1180
110 Ga0213875_10039446 3300021388 Unclassified 2225
111 Ga0213871_10021063 3300021441 Unclassified 1622
112 Ga0213871_10099406 3300021441 Bacteria 850
113 Ga0224712_10116816 3300022467 Unclassified 1151
114 Ga0209784_100005 3300025224 Bacteria 1040422
115 Ga0209566_100005 3300025225 Bacteria 1040422
116 Ga0209674_100009 3300025226 Bacteria 1040422
117 Ga0209674_102621 3300025226 Bacteria 3744
118 Ga0209672_100092 3300025228 Bacteria 118671
119 Ga0209147_100133 3300025229 Bacteria 118671
120 Ga0209563_100012 3300025230 Bacteria 1040422
121 Ga0209258_100208 3300025242 Bacteria 118671
122 Ga0209677_100006 3300025253 Bacteria 1040422
123 Ga0209148_1002710 3300025254 Bacteria 5650
124 Ga0209759_1000433 3300025256 Bacteria 50171
125 Ga0209759_1006297 3300025256 Bacteria 4011
126 Ga0209759_1013463 3300025256 Bacteria 2211
127 Ga0209565_1000006 3300025263 Bacteria 897294
128 Ga0209455_1000159 3300025272 Bacteria 118671
129 Ga0209673_1000004 3300025273 Bacteria 896155
130 Ga0209675_1000123 3300025291 Bacteria 106157
131 Ga0209564_1000420 3300025295 Bacteria 74634
132 Ga0209256_1000219 3300025299 Bacteria 106112
133 Ga0207426_1000110 3300025302 Bacteria 235630
134 Ga0207696_1018115 3300025711 Bacteria 2318
135 Ga0207692_10201944 3300025898 Unclassified 1169
136 Ga0207710_10549729 3300025900 Bacteria 601
137 Ga0207680_10059851 3300025903 Bacteria 2316
138 Ga0207647_10058183 3300025904 Bacteria 2368
139 Ga0207647_10276663 3300025904 Bacteria 959
140 Ga0207685_10061299 3300025905 Unclassified 1491
141 Ga0207699_10570403 3300025906 Bacteria 822
142 Ga0207705_10005976 3300025909 Bacteria 9055
143 Ga0207705_10142865 3300025909 Bacteria 1788
144 Ga0207705_11213412 3300025909 Unclassified 578
145 Ga0207684_10084430 3300025910 Bacteria 2704
146 Ga0207654_11209131 3300025911 Bacteria 551
147 Ga0207695_10064490 3300025913 Bacteria 3771
148 Ga0207693_10013083 3300025915 Bacteria 6695
149 Ga0207693_10583975 3300025915 Unclassified 870
150 Ga0207663_10757788 3300025916 Unclassified 771
151 Ga0207657_10000663 3300025919 Bacteria 36593
152 Ga0207681_11017897 3300025923 Unclassified 695
153 Ga0207694_10004191 3300025924 Bacteria 11303
154 Ga0207650_10116381 3300025925 Bacteria 2076
155 Ga0207700_10211592 3300025928 Bacteria 1639
156 Ga0207700_10562852 3300025928 Bacteria 1012
157 Ga0207664_10087845 3300025929 Bacteria 2542
158 Ga0207690_10000082 3300025932 Bacteria 80786
159 Ga0207690_10542592 3300025932 Bacteria 945
160 Ga0207665_11350750 3300025939 Unclassified 568
161 Ga0207679_11317210 3300025945 Unclassified 663
162 Ga0207679_11318118 3300025945 Bacteria 662
163 Ga0207667_10000191 3300025949 Bacteria 89641
164 Ga0207667_10001176 3300025949 Bacteria 32896
165 Ga0207667_10839412 3300025949 Unclassified 913
166 Ga0207667_10858391 3300025949 Bacteria 902
167 Ga0207668_10010583 3300025972 Bacteria 5578
168 Ga0207658_10000100 3300025986 Bacteria 95179
169 Ga0207658_10001044 3300025986 Bacteria 22500
170 Ga0207677_12138021 3300026023 Unclassified 521
171 Ga0207678_10094181 3300026067 Bacteria 2559
172 Ga0207702_12049025 3300026078 Bacteria 562
173 Ga0207641_10000049 3300026088 Bacteria 177222
174 Ga0207641_10019212 3300026088 Bacteria 5607
175 Ga0207698_11796685 3300026142 Unclassified 628
176 Ga0265354_1000713 3300028016 Bacteria 5487
177 Ga0268264_10326413 3300028381 Bacteria 1453
178 Ga0265338_10088755 3300028800 Bacteria 2564
179 Ga0265762_1065726 3300030760 Bacteria 753
180 Ga0265770_1001147 3300030878 Unclassified 3663
181 Ga0265760_10001148 3300031090 Bacteria 7708
182 Ga0265329_10053165 3300031242 Bacteria 1288
183 Ga0265327_10000437 3300031251 Bacteria 75716
184 Ga0265327_10009849 3300031251 Bacteria 6823
185 Ga0265316_10000213 3300031344 Bacteria 67886
186 Ga0265316_10985855 3300031344 Bacteria 587
187 Ga0307408_100049865 3300031548 Bacteria 3008
188 Ga0307405_10014229 3300031731 Bacteria 4272
189 Ga0307405_10049759 3300031731 Bacteria 2592
190 Ga0307406_10109847 3300031901 Bacteria 1896
191 Ga0307406_11023424 3300031901 Bacteria 710
192 Ga0307412_10000015 3300031911 Bacteria 333589
193 Ga0307412_10000633 3300031911 Bacteria 20489
194 Ga0373946_0126940 3300035171 Unclassified 1170
195 Ga0373935_0253547 3300035692 Unclassified 1232
196 Ga0373925_0449601 3300037068 Bacteria 1055
197 Ga0395899_0011107 3300037312 Bacteria 6898
198 Ga0395900_0000074 3300037418 Bacteria 184491
199 Ga0395900_0128335 3300037418 Bacteria 2600
200 Ga0395898_0465973 3300037466 Bacteria 1203
201 Ga0395905_0358209 3300037471 Bacteria 1351
202 Ga0395905_0562898 3300037471 Bacteria 1041
203 Ga0436364_1053450 3300037853 Unclassified 2023
204 Ga0436365_1298073 3300039437 Bacteria 1225
205 Ga0436360_0335658 3300039438 Plasmid 3016
206 Ga0436360_0579778 3300039438 Bacteria 2955
207 Ga0436360_1339278 3300039438 Bacteria 5886
208 Ga0436361_0047224 3300039447 Unclassified 1258
209 Ga0436361_0408108 3300039447 Bacteria 723
210 Ga0436361_0678368 3300039447 Bacteria 2089
211 Ga0436361_0743401 3300039447 Unclassified 1578
212 Ga0436361_1205114 3300039447 Bacteria 3050
213 Ga0436363_0939546 3300039450 Bacteria 1293
214 Ga0436363_1499293 3300039450 Unclassified 605
215 Ga0436362_0578983 3300039453 Bacteria 2423
216 Ga0436362_0642631 3300039453 Bacteria 1875
217 Ga0436362_1141231 3300039453 Bacteria 1693
218 Ga0436362_1302218 3300039453 Unclassified 609
219 Ga0451853_1875834 3300041512 Bacteria 1451
220 Ga0466966_0016605 3300044684 Bacteria 4862
221 Ga0466961_0008947 3300044693 Bacteria 6389
222 Ga0466961_0177746 3300044693 Bacteria 1322
223 Ga0466963_0531589 3300044694 Unclassified 830
224 Ga0466970_0001404 3300044765 Bacteria 11642
225 Ga0466960_0043203 3300044901 Bacteria 2143
226 Ga0466959_0019257 3300045049 Bacteria 5018
227 Ga0466959_0068669 3300045049 Bacteria 2568
228 Ga0466959_0186329 3300045049 Bacteria 1450
229 Ga0495603_0034438 3300046455 Bacteria 3044
230 Ga0495651_0446678 3300046462 Bacteria 836
231 Ga0495653_0196135 3300046463 Bacteria 1374
232 Ga0495650_0001375 3300046471 Bacteria 24009
233 Ga0495580_0038944 3300046472 Bacteria 3401
234 Ga0495580_0309689 3300046472 Bacteria 1074
235 Ga0495580_0325571 3300046472 Bacteria 1044
236 Ga0495605_0025281 3300046474 Bacteria 3096
237 Ga0495584_0000573 3300046491 Bacteria 24792
238 Ga0495584_0318830 3300046491 Bacteria 789
239 Ga0495585_0592207 3300046492 Bacteria 522
240 Ga0495596_0013531 3300046500 Bacteria 3457
241 Ga0495583_0020942 3300046506 Bacteria 3371
242 Ga0495606_0357879 3300046507 Bacteria 772
243 Ga0495606_0441413 3300046507 Unclassified 669
244 Ga0495610_0000447 3300046512 Bacteria 42590
245 Ga0495628_0388241 3300046516 Bacteria 1021
246 Ga0495642_0223761 3300046528 Bacteria 822
247 Ga0495586_0519655 3300046535 Bacteria 687
248 Ga0495622_0115912 3300046557 Bacteria 1225
249 Ga0495611_0093540 3300046648 Bacteria 1390
250 Ga0495657_0596819 3300046675 Unclassified 639
251 Ga0495646_0296134 3300046680 Bacteria 857
252 Ga0495658_1017941 3300046683 Unclassified 529
253 Ga0495670_0461719 3300046691 Bacteria 688
254 Ga0495671_0105106 3300046692 Bacteria 1379
255 Ga0495649_0453462 3300046694 Bacteria 640
256 Ga0495636_0003008 3300047318 Bacteria 6530
257 Ga0495674_0097583 3300047319 Bacteria 2503
258 Ga0495674_0744139 3300047319 Bacteria 766
259 Ga0495672_0043237 3300047320 Bacteria 2710
260 Ga0495672_0126661 3300047320 Bacteria 1349
261 Ga0495683_0087387 3300047323 Bacteria 1514
262 Ga0495687_013185 3300047443 Bacteria 4327
263 Ga0495687_188270 3300047443 Bacteria 667
264 Ga0495593_0186535 3300047673 Bacteria 1044
265 Ga0495593_0720869 3300047673 Unclassified 501
266 Ga0495602_0051928 3300048088 Bacteria 3646
267 Ga0495626_0065039 3300048091 Bacteria 1651
268 Ga0496105_0318705 3300048908 Bacteria 1247
269 Ga0496110_0930473 3300048913 Bacteria 776
270 Ga0496113_1362795 3300048916 Unclassified 550
271 Ga0496116_0003203 3300048919 Bacteria 16362
272 Ga0496117_0294762 3300048920 Bacteria 862
273 Ga0496122_0080773 3300048925 Bacteria 2266
274 Ga0496123_0026796 3300048926 Bacteria 4309
275 Ga0496124_0107189 3300048927 Bacteria 2255
276 Ga0496125_0072819 3300048928 Bacteria 2675
277 Ga0495682_0103710 3300049460 Bacteria 1020
278 Ga0495682_0142006 3300049460 Bacteria 857
279 Ga0501033_0026482 3300049570 Bacteria 4364
280 Ga0501034_0078093 3300049571 Bacteria 3315
281 Ga0501036_0083153 3300049572 Bacteria 2706
282 Ga0501038_0258363 3300049574 Bacteria 1377
283 Ga0501047_0442585 3300049581 Bacteria 1129
284 Ga0501070_0056560 3300049586 Bacteria 3251
285 Ga0501073_0058435 3300049589 Bacteria 2695
286 Ga0501074_0007914 3300049590 Bacteria 7699
287 Ga0501080_0048097 3300049742 Bacteria 3970
288 Ga0501035_0125236 3300049822 Bacteria 2243
289 Ga0501044_0075419 3300049823 Bacteria 3424
290 Ga0501044_0329571 3300049823 Bacteria 1450
291 nmdc:mga08y16_1058916_c1 3300050511 Bacteria 788
292 Ga0500643_001188 3300053087 Bacteria 15524

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1298073 Ga0436365_1298073_145_447 100
2 3300039450 Ga0436363_0939546 Ga0436363_0939546_567_869 100
3 3300046535 Ga0495586_0519655 Ga0495586_0519655_67_369 100
4 iso_pu_bacteria 2513237165 2514041280 102
5 iso_pu_bacteria 2513237166 2514055872 102
6 iso_pu_bacteria 2515154123 2515689708 102
7 iso_pu_bacteria 2738541296 2738822782 102
8 iso_pu_bacteria 2738541298 2738834989 102
9 iso_pu_bacteria 2738541306 2738876468 102
10 iso_pu_bacteria 2738543002 2739188412 102
11 iso_pu_bacteria 2738543008 2739223064 102
12 iso_pu_bacteria 2816332253 2817263215 102
13 iso_pu_bacteria 2816332286 2817455034 102
14 iso_pu_bacteria 2816332286 2817455704 102
15 iso_pu_bacteria 2885270888 2885277459 102
16 iso_pu_bacteria 2945934425 2945939231 102
17 iso_pu_bacteria 2990703756 2990706568 102
18 iso_pu_bacteria 641736151 642427500 102
19 iso_pu_bacteria 644736347 644748052 102
20 iso_pu_bacteria 8020807995 8020808292 102
21 iso_pu_bacteria 8040173305 8040179217 102
22 3300007265 Ga0099794_10355761 Ga0099794_103557612 104
23 3300025226 Ga0209674_102621 Ga0209674_1026216 104
24 3300037312 Ga0395899_0011107 Ga0395899_0011107_3515_3829 104
25 3300037418 Ga0395900_0128335 Ga0395900_0128335_213_527 104
26 3300039453 Ga0436362_1302218 Ga0436362_1302218_44_358 104
27 3300047319 Ga0495674_0744139 Ga0495674_0744139_16_330 104
28 3300005331 Ga0070670_100102903 Ga0070670_1001029032 105
29 3300005335 Ga0070666_10080107 Ga0070666_100801074 105
30 3300005338 Ga0068868_100341280 Ga0068868_1003412801 105
31 3300005347 Ga0070668_100001440 Ga0070668_10000144013 105
32 3300005367 Ga0070667_100000130 Ga0070667_10000013045 105
33 3300005436 Ga0070713_100402866 Ga0070713_1004028662 105
34 3300005437 Ga0070710_10122601 Ga0070710_101226015 105
35 3300005563 Ga0068855_100451545 Ga0068855_1004515452 105
36 3300005841 Ga0068863_100000029 Ga0068863_100000029114 105
37 3300009094 Ga0111539_10756246 Ga0111539_107562462 105
38 3300013104 Ga0157370_10260034 Ga0157370_102600342 105
39 3300013105 Ga0157369_11791142 Ga0157369_117911421 105
40 3300013307 Ga0157372_10098015 Ga0157372_100980152 105
41 3300014326 Ga0157380_12971875 Ga0157380_129718752 105
42 3300025903 Ga0207680_10059851 Ga0207680_100598512 105
43 3300025905 Ga0207685_10061299 Ga0207685_100612994 105
44 3300025909 Ga0207705_10142865 Ga0207705_101428654 105
45 3300025923 Ga0207681_11017897 Ga0207681_110178973 105
46 3300025925 Ga0207650_10116381 Ga0207650_101163814 105
47 3300025928 Ga0207700_10562852 Ga0207700_105628522 105
48 3300025949 Ga0207667_10839412 Ga0207667_108394122 105
49 3300025972 Ga0207668_10010583 Ga0207668_100105835 105
50 3300025986 Ga0207658_10000100 Ga0207658_1000010050 105
51 3300026023 Ga0207677_12138021 Ga0207677_121380212 105
52 3300026088 Ga0207641_10000049 Ga0207641_10000049114 105
53 3300028381 Ga0268264_10326413 Ga0268264_103264133 105
54 3300031901 Ga0307406_11023424 Ga0307406_110234242 105
55 3300039447 Ga0436361_0678368 Ga0436361_0678368_969_1286 105
56 3300046462 Ga0495651_0446678 Ga0495651_0446678_311_628 105
57 3300046675 Ga0495657_0596819 Ga0495657_0596819_239_556 105
58 3300046683 Ga0495658_1017941 Ga0495658_1017941_75_392 105
59 3300047673 Ga0495593_0720869 Ga0495593_0720869_135_452 105
60 3300050511 nmdc:mga08y16_1058916_c1 nmdc:mga08y16_1058916_c1_166_504 105
61 3300001979 JGI24740J21852_10161685 JGI24740J21852_101616851 106
62 3300001989 JGI24739J22299_10127011 JGI24739J22299_101270112 106
63 3300001990 JGI24737J22298_10183935 JGI24737J22298_101839352 106
64 3300002075 JGI24738J21930_10023486 JGI24738J21930_100234863 106
65 3300002705 JGI25156J39149_1001179 JGI25156J39149_10011793 106
66 3300002705 JGI25156J39149_1002755 JGI25156J39149_10027554 106
67 3300003316 rootH1_10017679 rootH1_100176792 106
68 3300003320 rootH2_10023369 rootH2_1002336918 106
69 3300003322 rootL2_10006463 rootL2_1000646314 106
70 3300003323 rootH1_10365108 rootH1_103651085 106
71 3300003354 JGI25160J50197_1000111 JGI25160J50197_100011143 106
72 3300003751 Ga0055538_1000013 Ga0055538_1000013132 106
73 3300003752 Ga0055539_1000018 Ga0055539_1000018132 106
74 3300003756 Ga0055533_1000022 Ga0055533_1000022132 106
75 3300003758 Ga0055532_1000082 Ga0055532_1000082154 106
76 3300003759 Ga0055525_1000024 Ga0055525_1000024132 106
77 3300003760 Ga0055527_1000039 Ga0055527_1000039154 106
78 3300003761 Ga0055535_1000012 Ga0055535_1000012404 106
79 3300003763 Ga0055529_1000112 Ga0055529_100011218 106
80 3300003771 Ga0055526_1000635 Ga0055526_100063521 106
81 3300003773 Ga0055537_1000158 Ga0055537_100015823 106
82 3300003775 Ga0055524_1008762 Ga0055524_10087623 106
83 3300003784 Ga0055534_1000319 Ga0055534_10003196 106
84 3300003790 Ga0055528_1000143 Ga0055528_100014329 106
85 3300003841 Ga0055541_1000013 Ga0055541_1000013132 106
86 3300005262 Ga0065165_1000453 Ga0065165_100045317 106
87 3300005327 Ga0070658_10330058 Ga0070658_103300583 106
88 3300005329 Ga0070683_100374815 Ga0070683_1003748154 106
89 3300005339 Ga0070660_100000239 Ga0070660_1000002392 106
90 3300005365 Ga0070688_100588751 Ga0070688_1005887513 106
91 3300005366 Ga0070659_100000324 Ga0070659_1000003242 106
92 3300005366 Ga0070659_100601477 Ga0070659_1006014773 106
93 3300005434 Ga0070709_10393891 Ga0070709_103938911 106
94 3300005435 Ga0070714_100345964 Ga0070714_1003459643 106
95 3300005435 Ga0070714_100387134 Ga0070714_1003871342 106
96 3300005436 Ga0070713_100085704 Ga0070713_1000857042 106
97 3300005455 Ga0070663_100029545 Ga0070663_1000295454 106
98 3300005467 Ga0070706_100189238 Ga0070706_1001892382 106
99 3300005518 Ga0070699_100379796 Ga0070699_1003797962 106
100 3300005548 Ga0070665_100438194 Ga0070665_1004381942 106
101 3300005548 Ga0070665_101087965 Ga0070665_1010879652 106
102 3300005563 Ga0068855_100000645 Ga0068855_1000006459 106
103 3300005563 Ga0068855_100020370 Ga0068855_1000203704 106
104 3300005563 Ga0068855_101229621 Ga0068855_1012296212 106
105 3300005563 Ga0068855_101568417 Ga0068855_1015684171 106
106 3300005563 Ga0068855_101672541 Ga0068855_1016725411 106
107 3300005564 Ga0070664_101312122 Ga0070664_1013121221 106
108 3300005578 Ga0068854_100368862 Ga0068854_1003688623 106
109 3300005614 Ga0068856_100453238 Ga0068856_1004532381 106
110 3300005616 Ga0068852_100563640 Ga0068852_1005636404 106
111 3300005617 Ga0068859_101593529 Ga0068859_1015935292 106
112 3300005834 Ga0068851_10560230 Ga0068851_105602302 106
113 3300005841 Ga0068863_100026173 Ga0068863_1000261735 106
114 3300005842 Ga0068858_101241116 Ga0068858_1012411162 106
115 3300005844 Ga0068862_101924487 Ga0068862_1019244871 106
116 3300006028 Ga0070717_11717286 Ga0070717_117172861 106
117 3300006175 Ga0070712_100217272 Ga0070712_1002172722 106
118 3300006175 Ga0070712_100315650 Ga0070712_1003156501 106
119 3300006175 Ga0070712_101314074 Ga0070712_1013140742 106
120 3300006237 Ga0097621_100902447 Ga0097621_1009024473 106
121 3300006931 Ga0097620_101593823 Ga0097620_1015938232 106
122 3300007265 Ga0099794_10202786 Ga0099794_102027862 106
123 3300009092 Ga0105250_10027102 Ga0105250_100271023 106
124 3300009093 Ga0105240_10105333 Ga0105240_101053332 106
125 3300009093 Ga0105240_11662298 Ga0105240_116622982 106
126 3300009101 Ga0105247_11430004 Ga0105247_114300042 106
127 3300009174 Ga0105241_10330461 Ga0105241_103304612 106
128 3300009174 Ga0105241_11943051 Ga0105241_119430512 106
129 3300009177 Ga0105248_11276680 Ga0105248_112766802 106
130 3300009177 Ga0105248_12058250 Ga0105248_120582502 106
131 3300009545 Ga0105237_10024655 Ga0105237_100246557 106
132 3300009545 Ga0105237_10369045 Ga0105237_103690452 106
133 3300009551 Ga0105238_10007147 Ga0105238_100071473 106
134 3300009551 Ga0105238_10701652 Ga0105238_107016522 106
135 3300009978 Ga0105148_112721 Ga0105148_1127211 106
136 3300010375 Ga0105239_10114276 Ga0105239_101142766 106
137 3300010375 Ga0105239_10773836 Ga0105239_107738363 106
138 3300013100 Ga0157373_10008695 Ga0157373_100086955 106
139 3300013102 Ga0157371_10751187 Ga0157371_107511871 106
140 3300013104 Ga0157370_10137520 Ga0157370_101375205 106
141 3300013104 Ga0157370_10506731 Ga0157370_105067313 106
142 3300013105 Ga0157369_10073154 Ga0157369_100731542 106
143 3300013105 Ga0157369_10090342 Ga0157369_100903423 106
144 3300013105 Ga0157369_11602263 Ga0157369_116022632 106
145 3300013308 Ga0157375_10852044 Ga0157375_108520441 106
146 3300014969 Ga0157376_12119582 Ga0157376_121195821 106
147 3300015265 Ga0182005_1005765 Ga0182005_10057654 106
148 3300020077 Ga0206351_10758351 Ga0206351_107583511 106
149 3300020078 Ga0206352_11261789 Ga0206352_112617892 106
150 3300020080 Ga0206350_11368649 Ga0206350_113686493 106
151 3300021358 Ga0213873_10007849 Ga0213873_100078492 106
152 3300021361 Ga0213872_10078642 Ga0213872_100786422 106
153 3300021361 Ga0213872_10089005 Ga0213872_100890052 106
154 3300021361 Ga0213872_10117023 Ga0213872_101170231 106
155 3300021388 Ga0213875_10039446 Ga0213875_100394462 106
156 3300021441 Ga0213871_10021063 Ga0213871_100210632 106
157 3300021441 Ga0213871_10099406 Ga0213871_100994061 106
158 3300022467 Ga0224712_10116816 Ga0224712_101168162 106
159 3300025224 Ga0209784_100005 Ga0209784_100005592 106
160 3300025225 Ga0209566_100005 Ga0209566_100005592 106
161 3300025226 Ga0209674_100009 Ga0209674_100009592 106
162 3300025228 Ga0209672_100092 Ga0209672_100092154 106
163 3300025229 Ga0209147_100133 Ga0209147_100133154 106
164 3300025230 Ga0209563_100012 Ga0209563_100012592 106
165 3300025242 Ga0209258_100208 Ga0209258_100208154 106
166 3300025253 Ga0209677_100006 Ga0209677_100006592 106
167 3300025254 Ga0209148_1002710 Ga0209148_100271013 106
168 3300025256 Ga0209759_1000433 Ga0209759_100043325 106
169 3300025256 Ga0209759_1006297 Ga0209759_10062972 106
170 3300025256 Ga0209759_1013463 Ga0209759_10134632 106
171 3300025263 Ga0209565_1000006 Ga0209565_1000006800 106
172 3300025272 Ga0209455_1000159 Ga0209455_1000159154 106
173 3300025273 Ga0209673_1000004 Ga0209673_100000429 106
174 3300025291 Ga0209675_1000123 Ga0209675_100012329 106
175 3300025295 Ga0209564_1000420 Ga0209564_100042029 106
176 3300025299 Ga0209256_1000219 Ga0209256_100021929 106
177 3300025302 Ga0207426_1000110 Ga0207426_1000110172 106
178 3300025711 Ga0207696_1018115 Ga0207696_10181153 106
179 3300025898 Ga0207692_10201944 Ga0207692_102019442 106
180 3300025900 Ga0207710_10549729 Ga0207710_105497292 106
181 3300025904 Ga0207647_10058183 Ga0207647_100581833 106
182 3300025904 Ga0207647_10276663 Ga0207647_102766632 106
183 3300025906 Ga0207699_10570403 Ga0207699_105704031 106
184 3300025909 Ga0207705_10005976 Ga0207705_100059765 106
185 3300025909 Ga0207705_11213412 Ga0207705_112134122 106
186 3300025910 Ga0207684_10084430 Ga0207684_100844302 106
187 3300025911 Ga0207654_11209131 Ga0207654_112091312 106
188 3300025913 Ga0207695_10064490 Ga0207695_100644903 106
189 3300025915 Ga0207693_10013083 Ga0207693_100130834 106
190 3300025915 Ga0207693_10583975 Ga0207693_105839752 106
191 3300025916 Ga0207663_10757788 Ga0207663_107577882 106
192 3300025919 Ga0207657_10000663 Ga0207657_100006632 106
193 3300025924 Ga0207694_10004191 Ga0207694_1000419114 106
194 3300025928 Ga0207700_10211592 Ga0207700_102115921 106
195 3300025929 Ga0207664_10087845 Ga0207664_100878453 106
196 3300025932 Ga0207690_10000082 Ga0207690_1000008271 106
197 3300025932 Ga0207690_10542592 Ga0207690_105425922 106
198 3300025939 Ga0207665_11350750 Ga0207665_113507501 106
199 3300025945 Ga0207679_11317210 Ga0207679_113172102 106
200 3300025945 Ga0207679_11318118 Ga0207679_113181181 106
201 3300025949 Ga0207667_10000191 Ga0207667_1000019172 106
202 3300025949 Ga0207667_10001176 Ga0207667_1000117633 106
203 3300025949 Ga0207667_10858391 Ga0207667_108583912 106
204 3300025986 Ga0207658_10001044 Ga0207658_100010442 106
205 3300026067 Ga0207678_10094181 Ga0207678_100941814 106
206 3300026078 Ga0207702_12049025 Ga0207702_120490251 106
207 3300026088 Ga0207641_10019212 Ga0207641_100192125 106
208 3300026142 Ga0207698_11796685 Ga0207698_117966852 106
209 3300028016 Ga0265354_1000713 Ga0265354_10007136 106
210 3300028800 Ga0265338_10088755 Ga0265338_100887552 106
211 3300030760 Ga0265762_1065726 Ga0265762_10657262 106
212 3300030878 Ga0265770_1001147 Ga0265770_10011475 106
213 3300031090 Ga0265760_10001148 Ga0265760_100011488 106
214 3300031242 Ga0265329_10053165 Ga0265329_100531653 106
215 3300031251 Ga0265327_10000437 Ga0265327_1000043723 106
216 3300031251 Ga0265327_10009849 Ga0265327_100098491 106
217 3300031344 Ga0265316_10000213 Ga0265316_1000021332 106
218 3300031344 Ga0265316_10985855 Ga0265316_109858552 106
219 3300031548 Ga0307408_100049865 Ga0307408_1000498655 106
220 3300031731 Ga0307405_10014229 Ga0307405_100142295 106
221 3300031731 Ga0307405_10049759 Ga0307405_100497594 106
222 3300031901 Ga0307406_10109847 Ga0307406_101098471 106
223 3300031911 Ga0307412_10000015 Ga0307412_10000015280 106
224 3300031911 Ga0307412_10000633 Ga0307412_100006338 106
225 3300035171 Ga0373946_0126940 Ga0373946_0126940_603_926 106
226 3300035692 Ga0373935_0253547 Ga0373935_0253547_723_1046 106
227 3300037068 Ga0373925_0449601 Ga0373925_0449601_418_741 106
228 3300037418 Ga0395900_0000074 Ga0395900_0000074_9929_10249 106
229 3300037466 Ga0395898_0465973 Ga0395898_0465973_74_394 106
230 3300037471 Ga0395905_0358209 Ga0395905_0358209_588_908 106
231 3300037471 Ga0395905_0562898 Ga0395905_0562898_473_793 106
232 3300037853 Ga0436364_1053450 Ga0436364_1053450_502_828 106
233 3300039438 Ga0436360_0335658 Ga0436360_0335658_2226_2546 106
234 3300039438 Ga0436360_0579778 Ga0436360_0579778_1564_1884 106
235 3300039438 Ga0436360_1339278 Ga0436360_1339278_5102_5422 106
236 3300039447 Ga0436361_0047224 Ga0436361_0047224_827_1147 106
237 3300039447 Ga0436361_0408108 Ga0436361_0408108_392_712 106
238 3300039447 Ga0436361_0743401 Ga0436361_0743401_468_788 106
239 3300039447 Ga0436361_1205114 Ga0436361_1205114_1399_1719 106
240 3300039450 Ga0436363_1499293 Ga0436363_1499293_39_383 106
241 3300039453 Ga0436362_0578983 Ga0436362_0578983_1113_1457 106
242 3300039453 Ga0436362_0642631 Ga0436362_0642631_1017_1337 106
243 3300039453 Ga0436362_1141231 Ga0436362_1141231_998_1348 106
244 3300041512 Ga0451853_1875834 Ga0451853_1875834_132_455 106
245 3300044684 Ga0466966_0016605 Ga0466966_0016605_374_700 106
246 3300044693 Ga0466961_0008947 Ga0466961_0008947_1386_1712 106
247 3300044693 Ga0466961_0177746 Ga0466961_0177746_132_461 106
248 3300044694 Ga0466963_0531589 Ga0466963_0531589_400_720 106
249 3300044765 Ga0466970_0001404 Ga0466970_0001404_2106_2432 106
250 3300044901 Ga0466960_0043203 Ga0466960_0043203_52_378 106
251 3300045049 Ga0466959_0019257 Ga0466959_0019257_16_342 106
252 3300045049 Ga0466959_0068669 Ga0466959_0068669_1879_2208 106
253 3300045049 Ga0466959_0186329 Ga0466959_0186329_845_1171 106
254 3300046455 Ga0495603_0034438 Ga0495603_0034438_1670_1990 106
255 3300046463 Ga0495653_0196135 Ga0495653_0196135_430_750 106
256 3300046471 Ga0495650_0001375 Ga0495650_0001375_22045_22365 106
257 3300046472 Ga0495580_0038944 Ga0495580_0038944_1977_2297 106
258 3300046472 Ga0495580_0309689 Ga0495580_0309689_277_597 106
259 3300046472 Ga0495580_0325571 Ga0495580_0325571_390_710 106
260 3300046474 Ga0495605_0025281 Ga0495605_0025281_1355_1675 106
261 3300046491 Ga0495584_0000573 Ga0495584_0000573_2195_2515 106
262 3300046491 Ga0495584_0318830 Ga0495584_0318830_123_443 106
263 3300046492 Ga0495585_0592207 Ga0495585_0592207_45_365 106
264 3300046500 Ga0495596_0013531 Ga0495596_0013531_2017_2337 106
265 3300046506 Ga0495583_0020942 Ga0495583_0020942_1949_2269 106
266 3300046507 Ga0495606_0357879 Ga0495606_0357879_28_348 106
267 3300046507 Ga0495606_0441413 Ga0495606_0441413_274_594 106
268 3300046512 Ga0495610_0000447 Ga0495610_0000447_1989_2309 106
269 3300046516 Ga0495628_0388241 Ga0495628_0388241_465_785 106
270 3300046528 Ga0495642_0223761 Ga0495642_0223761_114_434 106
271 3300046557 Ga0495622_0115912 Ga0495622_0115912_164_484 106
272 3300046648 Ga0495611_0093540 Ga0495611_0093540_1056_1376 106
273 3300046680 Ga0495646_0296134 Ga0495646_0296134_488_808 106
274 3300046691 Ga0495670_0461719 Ga0495670_0461719_173_493 106
275 3300046692 Ga0495671_0105106 Ga0495671_0105106_454_774 106
276 3300046694 Ga0495649_0453462 Ga0495649_0453462_207_527 106
277 3300047318 Ga0495636_0003008 Ga0495636_0003008_4246_4566 106
278 3300047319 Ga0495674_0097583 Ga0495674_0097583_2154_2474 106
279 3300047320 Ga0495672_0043237 Ga0495672_0043237_1039_1359 106
280 3300047320 Ga0495672_0126661 Ga0495672_0126661_218_538 106
281 3300047323 Ga0495683_0087387 Ga0495683_0087387_92_412 106
282 3300047443 Ga0495687_013185 Ga0495687_013185_597_917 106
283 3300047443 Ga0495687_188270 Ga0495687_188270_313_633 106
284 3300047673 Ga0495593_0186535 Ga0495593_0186535_330_650 106
285 3300048088 Ga0495602_0051928 Ga0495602_0051928_2374_2694 106
286 3300048091 Ga0495626_0065039 Ga0495626_0065039_82_402 106
287 3300048908 Ga0496105_0318705 Ga0496105_0318705_576_896 106
288 3300048913 Ga0496110_0930473 Ga0496110_0930473_352_672 106
289 3300048916 Ga0496113_1362795 Ga0496113_1362795_101_451 106
290 3300048919 Ga0496116_0003203 Ga0496116_0003203_7512_7832 106
291 3300048920 Ga0496117_0294762 Ga0496117_0294762_176_496 106
292 3300048925 Ga0496122_0080773 Ga0496122_0080773_854_1174 106
293 3300048926 Ga0496123_0026796 Ga0496123_0026796_2967_3287 106
294 3300048927 Ga0496124_0107189 Ga0496124_0107189_894_1214 106
295 3300048928 Ga0496125_0072819 Ga0496125_0072819_1235_1555 106
296 3300049460 Ga0495682_0103710 Ga0495682_0103710_344_664 106
297 3300049460 Ga0495682_0142006 Ga0495682_0142006_139_459 106
298 3300049570 Ga0501033_0026482 Ga0501033_0026482_1215_1535 106
299 3300049571 Ga0501034_0078093 Ga0501034_0078093_2862_3182 106
300 3300049572 Ga0501036_0083153 Ga0501036_0083153_1927_2247 106
301 3300049574 Ga0501038_0258363 Ga0501038_0258363_340_660 106
302 3300049581 Ga0501047_0442585 Ga0501047_0442585_633_953 106
303 3300049586 Ga0501070_0056560 Ga0501070_0056560_1680_2000 106
304 3300049589 Ga0501073_0058435 Ga0501073_0058435_155_475 106
305 3300049590 Ga0501074_0007914 Ga0501074_0007914_4695_5015 106
306 3300049742 Ga0501080_0048097 Ga0501080_0048097_2219_2539 106
307 3300049822 Ga0501035_0125236 Ga0501035_0125236_1305_1625 106
308 3300049823 Ga0501044_0075419 Ga0501044_0075419_2606_2926 106
309 3300049823 Ga0501044_0329571 Ga0501044_0329571_10_330 106
310 3300053087 Ga0500643_001188 Ga0500643_001188_14752_15102 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

20

121

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ckh-assembly1.cif.gz_A e. coli mazf e24a form iib 0.8935 2 104
5co7-assembly3.cif.gz_F e. coli mazf form iii 0.8865 2 106
5co7-assembly2.cif.gz_D e. coli mazf form iii 0.884 1 105
5xe2-assembly1.cif.gz_A-2 endoribonuclease from mycobacterial species 0.8801 2 105
5ck9-assembly1.cif.gz_A e. coli mazf form i 0.8742 2 104
ID Description Score Start End Superfamily
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.8772 2 106 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8697 2 105 2.30.30.110
2mf2B00 Mainly Beta;Roll;SH3 type barrels.; 0.8607 2 102 2.30.30.110
af_P0CL62_2_115_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8593 3 105 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8508 4 105 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A259IGU8-F1-model_v4 Growth inhibitor PemK 0.9792 25 104 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A3D4Z0D7-F1-model_v4 Transcriptional regulator 0.9774 42 104 GO:0003677
AF-A0A372DDN4-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9748 40 106 GO:0003677
AF-A0A388RMV5-F1-model_v4 Uncharacterized protein 0.9721 34 106 GO:0003677
AF-A0A2A6RDR6-F1-model_v4 Transcriptional regulator 0.9624 20 106 GO:0003677
GO:0004521
GO:0006402
GO:0016075

Feature Viewer

pLDDT pTM Quality
87.93 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map