F400559

General Info

Members Datasets Scaffolds Average Seq Length
310 151 620 126

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100627352|Ga0070671_1006273522
Length 141
Sequence MSSHNYYDRIFFVMSEKNGFDPELFFAALADKTRLRLLNLLRDGEVCTCFFADTLETNDPKISRHLAYLKRAGLVKGRRDGKWVHYSLVEPKDPAAREVFNSTLKLLGSDKSMQIDRKRLVDVCCAPAAPIAIQPRKGSAK

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
147 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
148 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
149 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
150 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
151 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.03
Stem 0
Stem Tuber 0
Unclassified 32.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100627352 3300005355 Unclassified 930
2 MBSR1b_contig_13152705 2162886012 Unclassified 985
3 Ga0065715_10265922 3300005293 Unclassified 1124
4 Ga0070658_10005969 3300005327 Bacteria 9875
5 Ga0070683_101923826 3300005329 Unclassified 568
6 Ga0070690_100003565 3300005330 Bacteria 8541
7 Ga0070670_100153454 3300005331 Bacteria 1994
8 Ga0070677_10423657 3300005333 Bacteria 706
9 Ga0068869_100189222 3300005334 Bacteria 1618
10 Ga0068869_100489006 3300005334 Unclassified 1026
11 Ga0068869_101947225 3300005334 Bacteria 527
12 Ga0070666_10048622 3300005335 Bacteria 2850
13 Ga0070680_100409228 3300005336 Unclassified 1157
14 Ga0070682_100089376 3300005337 Bacteria 2012
15 Ga0070682_100913457 3300005337 Unclassified 722
16 Ga0068868_100423367 3300005338 Bacteria 1153
17 Ga0068868_102253906 3300005338 Unclassified 519
18 Ga0070689_100069598 3300005340 Bacteria 2746
19 Ga0070687_100939530 3300005343 Bacteria 623
20 Ga0070687_101485815 3300005343 Unclassified 509
21 Ga0070661_100051771 3300005344 Bacteria 3006
22 Ga0070661_100225364 3300005344 Unclassified 1439
23 Ga0070668_100337864 3300005347 Bacteria 1272
24 Ga0070668_100917520 3300005347 Bacteria 784
25 Ga0070669_100552563 3300005353 Unclassified 960
26 Ga0070675_100045709 3300005354 Plasmid 3583
27 Ga0070675_101311557 3300005354 Bacteria 667
28 Ga0070671_100002445 3300005355 Bacteria 14361
29 Ga0070671_100387865 3300005355 Bacteria 1194
30 Ga0070674_100697660 3300005356 Unclassified 867
31 Ga0070674_101597754 3300005356 Unclassified 588
32 Ga0070688_100957676 3300005365 Unclassified 678
33 Ga0070659_100954764 3300005366 Unclassified 751
34 Ga0070667_100016842 3300005367 Bacteria 6047
35 Ga0070667_100192257 3300005367 Bacteria 1808
36 Ga0070667_100296102 3300005367 Bacteria 1456
37 Ga0070705_100610883 3300005440 Bacteria 845
38 Ga0070700_100284668 3300005441 Unclassified 1200
39 Ga0070700_100934836 3300005441 Unclassified 708
40 Ga0070678_100090394 3300005456 Bacteria 2346
41 Ga0070678_102057675 3300005456 Unclassified 541
42 Ga0070662_100038921 3300005457 Bacteria 3380
43 Ga0070681_10006858 3300005458 Bacteria 11083
44 Ga0070681_10059636 3300005458 Bacteria 3796
45 Ga0070681_10845293 3300005458 Bacteria 833
46 Ga0068867_100084644 3300005459 Bacteria 2396
47 Ga0068867_100227185 3300005459 Unclassified 1507
48 Ga0068867_100247545 3300005459 Bacteria 1448
49 Ga0068867_100343237 3300005459 Bacteria 1244
50 Ga0068867_101545921 3300005459 Unclassified 619
51 Ga0070685_10025818 3300005466 Bacteria 3235
52 Ga0070698_100824061 3300005471 Unclassified 872
53 Ga0070684_100294591 3300005535 Unclassified 1488
54 Ga0070684_100638050 3300005535 Unclassified 991
55 Ga0070684_101686056 3300005535 Unclassified 598
56 Ga0068853_100013712 3300005539 Bacteria 6620
57 Ga0068853_100062556 3300005539 Bacteria 3221
58 Ga0068853_100063237 3300005539 Bacteria 3205
59 Ga0068853_100165872 3300005539 Unclassified 1996
60 Ga0068853_101099863 3300005539 Unclassified 766
61 Ga0070672_100218734 3300005543 Unclassified 1597
62 Ga0070672_100930000 3300005543 Unclassified 769
63 Ga0070672_101421076 3300005543 Bacteria 621
64 Ga0070686_101087776 3300005544 Bacteria 660
65 Ga0070695_100160092 3300005545 Bacteria 1579
66 Ga0070696_101114916 3300005546 Unclassified 664
67 Ga0070693_100269784 3300005547 Bacteria 1135
68 Ga0068855_100368969 3300005563 Bacteria 1578
69 Ga0068855_100516801 3300005563 Bacteria 1296
70 Ga0070664_100004551 3300005564 Bacteria 11123
71 Ga0070664_100008920 3300005564 Bacteria 8128
72 Ga0070664_100245927 3300005564 Bacteria 1607
73 Ga0070664_100497481 3300005564 Unclassified 1123
74 Ga0070664_101439480 3300005564 Unclassified 652
75 Ga0068857_100011592 3300005577 Bacteria 7669
76 Ga0068857_100125178 3300005577 Bacteria 2316
77 Ga0068857_100190701 3300005577 Bacteria 1867
78 Ga0068857_100309001 3300005577 Unclassified 1458
79 Ga0068854_100019201 3300005578 Bacteria 4602
80 Ga0068854_100451190 3300005578 Bacteria 1074
81 Ga0070702_100199635 3300005615 Bacteria 1323
82 Ga0068852_100002541 3300005616 Bacteria 12564
83 Ga0068852_100032445 3300005616 Bacteria 4325
84 Ga0068852_100100567 3300005616 Bacteria 2609
85 Ga0068852_100869413 3300005616 Unclassified 918
86 Ga0068852_101501288 3300005616 Bacteria 696
87 Ga0068859_100043500 3300005617 Bacteria 4513
88 Ga0068859_100054227 3300005617 Unclassified 4031
89 Ga0068859_100119551 3300005617 Bacteria 2701
90 Ga0068864_100052762 3300005618 Unclassified 3505
91 Ga0068864_100053284 3300005618 Bacteria 3489
92 Ga0068864_100089019 3300005618 Bacteria 2720
93 Ga0068864_100212617 3300005618 Bacteria 1781
94 Ga0068864_101376500 3300005618 Unclassified 707
95 Ga0068864_101614732 3300005618 Unclassified 652
96 Ga0068861_100321202 3300005719 Bacteria 1348
97 Ga0068851_10121480 3300005834 Bacteria 1404
98 Ga0068851_10148492 3300005834 Bacteria 1280
99 Ga0068870_10110781 3300005840 Bacteria 1567
100 Ga0068870_10341248 3300005840 Unclassified 958
101 Ga0068863_100122467 3300005841 Bacteria 2481
102 Ga0068863_100259090 3300005841 Bacteria 1681
103 Ga0068858_100106877 3300005842 Bacteria 2612
104 Ga0068858_100310184 3300005842 Bacteria 1506
105 Ga0068858_100737191 3300005842 Unclassified 959
106 Ga0068860_100099094 3300005843 Bacteria 2779
107 Ga0068860_100229386 3300005843 Bacteria 1804
108 Ga0068860_101984133 3300005843 Bacteria 603
109 Ga0068862_100124912 3300005844 Bacteria 2271
110 Ga0068862_100136185 3300005844 Bacteria 2176
111 Ga0068862_100236817 3300005844 Bacteria 1658
112 Ga0068862_100465295 3300005844 Bacteria 1194
113 Ga0070715_10498393 3300006163 Bacteria 697
114 Ga0097621_100016387 3300006237 Bacteria 5602
115 Ga0097621_100247580 3300006237 Bacteria 1560
116 Ga0068871_100176262 3300006358 Unclassified 1835
117 Ga0068865_100143793 3300006881 Bacteria 1801
118 Ga0097620_100043505 3300006931 Bacteria 4513
119 Ga0097620_100054225 3300006931 Unclassified 4031
120 Ga0097620_100119556 3300006931 Bacteria 2701
121 Ga0105250_10260549 3300009092 Bacteria 742
122 Ga0105240_10030376 3300009093 Bacteria 7023
123 Ga0105240_11337085 3300009093 Bacteria 755
124 Ga0111539_11129661 3300009094 Unclassified 910
125 Ga0105245_10892494 3300009098 Bacteria 930
126 Ga0105247_10006813 3300009101 Bacteria 7043
127 Ga0105247_10015896 3300009101 Unclassified 4506
128 Ga0105247_10128894 3300009101 Bacteria 1647
129 Ga0114129_10998213 3300009147 Unclassified 1054
130 Ga0105243_10411907 3300009148 Bacteria 1258
131 Ga0105241_10147817 3300009174 Bacteria 1919
132 Ga0105241_10787690 3300009174 Bacteria 875
133 Ga0105242_10116507 3300009176 Unclassified 2286
134 Ga0105242_10145318 3300009176 Bacteria 2063
135 Ga0105248_10203460 3300009177 Bacteria 2231
136 Ga0105248_10553436 3300009177 Bacteria 1298
137 Ga0105237_10122756 3300009545 Bacteria 2591
138 Ga0105249_10021300 3300009553 Bacteria 5803
139 Ga0105249_10022706 3300009553 Bacteria 5622
140 Ga0105249_10036033 3300009553 Unclassified 4488
141 Ga0105249_10240980 3300009553 Bacteria 1788
142 Ga0105249_10502042 3300009553 Bacteria 1258
143 Ga0105249_10541367 3300009553 Unclassified 1214
144 Ga0105249_12194604 3300009553 Bacteria 625
145 Ga0105239_10951912 3300010375 Bacteria 986
146 Ga0105239_11057609 3300010375 Unclassified 934
147 Ga0157373_10040911 3300013100 Bacteria 3316
148 Ga0157373_10304267 3300013100 Unclassified 1132
149 Ga0157371_10451781 3300013102 Bacteria 945
150 Ga0157370_10147331 3300013104 Bacteria 2191
151 Ga0157370_10155921 3300013104 Bacteria 2124
152 Ga0157369_10035976 3300013105 Bacteria 5427
153 Ga0157369_10049632 3300013105 Bacteria 4549
154 Ga0157369_10050846 3300013105 Bacteria 4486
155 Ga0157374_10003106 3300013296 Bacteria 13936
156 Ga0157374_11554469 3300013296 Unclassified 685
157 Ga0157378_11063457 3300013297 Bacteria 845
158 Ga0157378_12815398 3300013297 Unclassified 539
159 Ga0163162_10065741 3300013306 Bacteria 3674
160 Ga0163162_10107144 3300013306 Bacteria 2890
161 Ga0157372_10021123 3300013307 Bacteria 7031
162 Ga0157372_10087131 3300013307 Bacteria 3542
163 Ga0157372_10129212 3300013307 Bacteria 2906
164 Ga0157372_10924701 3300013307 Bacteria 1011
165 Ga0157375_10341974 3300013308 Bacteria 1662
166 Ga0157375_10403717 3300013308 Unclassified 1533
167 Ga0157375_10888275 3300013308 Unclassified 1036
168 Ga0157375_13779293 3300013308 Unclassified 503
169 Ga0163163_10002939 3300014325 Bacteria 14425
170 Ga0163163_10089261 3300014325 Bacteria 3095
171 Ga0163163_10163293 3300014325 Unclassified 2273
172 Ga0163163_10261242 3300014325 Bacteria 1782
173 Ga0163163_11288530 3300014325 Unclassified 793
174 Ga0157380_10013727 3300014326 Bacteria 5914
175 Ga0157380_10090226 3300014326 Unclassified 2527
176 Ga0157380_10493812 3300014326 Bacteria 1187
177 Ga0157380_11869719 3300014326 Unclassified 660
178 Ga0182008_10649849 3300014497 Unclassified 597
179 Ga0157379_10306020 3300014968 Bacteria 1449
180 Ga0157379_11772787 3300014968 Unclassified 606
181 Ga0157376_10331986 3300014969 Bacteria 1449
182 Ga0157376_11804354 3300014969 Unclassified 648
183 Ga0163161_10000929 3300017792 Bacteria 22627
184 Ga0207656_10107155 3300025321 Bacteria 1287
185 Ga0207710_10002018 3300025900 Bacteria 9672
186 Ga0207643_10133830 3300025908 Bacteria 1477
187 Ga0207705_10052092 3300025909 Bacteria 2946
188 Ga0207707_10019123 3300025912 Bacteria 5978
189 Ga0207707_10417930 3300025912 Bacteria 1150
190 Ga0207707_11099727 3300025912 Unclassified 648
191 Ga0207695_10068752 3300025913 Bacteria 3628
192 Ga0207671_10096806 3300025914 Bacteria 2231
193 Ga0207660_10114782 3300025917 Bacteria 2032
194 Ga0207660_10118823 3300025917 Bacteria 2000
195 Ga0207649_10021689 3300025920 Bacteria 3702
196 Ga0207652_10028418 3300025921 Bacteria 4666
197 Ga0207650_10079628 3300025925 Bacteria 2482
198 Ga0207659_11368367 3300025926 Bacteria 607
199 Ga0207644_10458270 3300025931 Bacteria 1048
200 Ga0207644_10990480 3300025931 Bacteria 705
201 Ga0207690_10072050 3300025932 Bacteria 2385
202 Ga0207706_10009514 3300025933 Bacteria 8923
203 Ga0207706_10447561 3300025933 Unclassified 1117
204 Ga0207709_10266557 3300025935 Bacteria 1258
205 Ga0207669_10213485 3300025937 Unclassified 1411
206 Ga0207691_10134581 3300025940 Archaea 2181
207 Ga0207691_10266592 3300025940 Unclassified 1475
208 Ga0207691_10444684 3300025940 Bacteria 1103
209 Ga0207691_11329858 3300025940 Bacteria 593
210 Ga0207711_10509686 3300025941 Unclassified 1121
211 Ga0207689_10075714 3300025942 Bacteria 2766
212 Ga0207661_11305403 3300025944 Unclassified 667
213 Ga0207679_10010738 3300025945 Bacteria 5907
214 Ga0207679_10183438 3300025945 Bacteria 1733
215 Ga0207679_10222806 3300025945 Bacteria 1588
216 Ga0207679_10909718 3300025945 Unclassified 805
217 Ga0207679_11048906 3300025945 Bacteria 748
218 Ga0207667_10270310 3300025949 Bacteria 1738
219 Ga0207667_10680536 3300025949 Bacteria 1032
220 Ga0207712_10017736 3300025961 Bacteria 4628
221 Ga0207712_10093547 3300025961 Bacteria 2219
222 Ga0207712_10187697 3300025961 Unclassified 1629
223 Ga0207712_11409381 3300025961 Unclassified 624
224 Ga0207668_10655729 3300025972 Bacteria 919
225 Ga0207640_10049693 3300025981 Bacteria 2717
226 Ga0207640_10440021 3300025981 Unclassified 1072
227 Ga0207640_11931889 3300025981 Bacteria 534
228 Ga0207658_11626733 3300025986 Unclassified 590
229 Ga0207703_10175021 3300026035 Bacteria 1890
230 Ga0207703_11057827 3300026035 Unclassified 779
231 Ga0207639_10001729 3300026041 Bacteria 14704
232 Ga0207639_10018412 3300026041 Bacteria 4962
233 Ga0207639_10116784 3300026041 Bacteria 2185
234 Ga0207708_11650016 3300026075 Unclassified 563
235 Ga0207641_10068704 3300026088 Bacteria 3039
236 Ga0207641_10114543 3300026088 Bacteria 2396
237 Ga0207641_12498667 3300026088 Unclassified 515
238 Ga0207648_10194595 3300026089 Bacteria 1798
239 Ga0207676_10042799 3300026095 Bacteria 3483
240 Ga0207676_11005001 3300026095 Bacteria 822
241 Ga0207674_10021849 3300026116 Bacteria 6885
242 Ga0207674_10168764 3300026116 Bacteria 2142
243 Ga0207674_10899423 3300026116 Unclassified 853
244 Ga0207675_100338133 3300026118 Bacteria 1473
245 Ga0207683_10177452 3300026121 Bacteria 1931
246 Ga0207683_11358881 3300026121 Unclassified 657
247 Ga0207698_10074723 3300026142 Bacteria 2705
248 Ga0207698_10075281 3300026142 Bacteria 2697
249 Ga0207698_10610832 3300026142 Bacteria 1076
250 Ga0268265_10139523 3300028380 Bacteria 2027
251 Ga0268265_10263627 3300028380 Bacteria 1533
252 Ga0268265_10338652 3300028380 Bacteria 1369
253 Ga0268264_10007273 3300028381 Bacteria 9267
254 Ga0268264_11735141 3300028381 Bacteria 635
255 Ga0307408_100066245 3300031548 Bacteria 2652
256 Ga0307516_10395463 3300031730 Unclassified 1042
257 Ga0307405_10255815 3300031731 Bacteria 1305
258 Ga0307405_10411037 3300031731 Bacteria 1062
259 Ga0307405_10683951 3300031731 Bacteria 848
260 Ga0307405_10751011 3300031731 Bacteria 813
261 Ga0307405_10972398 3300031731 Unclassified 723
262 Ga0307413_10222671 3300031824 Bacteria 1379
263 Ga0307413_10470787 3300031824 Bacteria 1002
264 Ga0307413_10917983 3300031824 Unclassified 745
265 Ga0307410_10256630 3300031852 Bacteria 1362
266 Ga0307410_10267415 3300031852 Bacteria 1336
267 Ga0307410_10605180 3300031852 Bacteria 914
268 Ga0307406_10021849 3300031901 Unclassified 3791
269 Ga0307406_10312458 3300031901 Unclassified 1212
270 Ga0307406_10426541 3300031901 Bacteria 1058
271 Ga0307406_10748376 3300031901 Bacteria 820
272 Ga0307406_11081893 3300031901 Bacteria 691
273 Ga0307407_10226508 3300031903 Bacteria 1267
274 Ga0307407_10622242 3300031903 Bacteria 806
275 Ga0307412_10012852 3300031911 Bacteria 4889
276 Ga0307412_10571245 3300031911 Unclassified 953
277 Ga0307412_11100765 3300031911 Unclassified 707
278 Ga0307409_100148368 3300031995 Bacteria 2032
279 Ga0307409_100313954 3300031995 Unclassified 1464
280 Ga0307409_100340835 3300031995 Bacteria 1410
281 Ga0307409_100373537 3300031995 Unclassified 1353
282 Ga0307409_100837304 3300031995 Bacteria 930
283 Ga0307409_101292141 3300031995 Bacteria 754
284 Ga0307416_100180481 3300032002 Unclassified 1978
285 Ga0307416_100457414 3300032002 Bacteria 1330
286 Ga0307416_100703307 3300032002 Unclassified 1100
287 Ga0307416_101659315 3300032002 Unclassified 744
288 Ga0307416_101960168 3300032002 Unclassified 689
289 Ga0307416_102114021 3300032002 Bacteria 665
290 Ga0307414_10387584 3300032004 Bacteria 1210
291 Ga0307414_10452744 3300032004 Unclassified 1126
292 Ga0307414_10524344 3300032004 Archaea 1052
293 Ga0307414_11952794 3300032004 Unclassified 548
294 Ga0307411_10569136 3300032005 Unclassified 970
295 Ga0307411_10605211 3300032005 Unclassified 943
296 Ga0307415_100182492 3300032126 Bacteria 1648
297 Ga0307415_100938022 3300032126 Bacteria 800
298 Ga0395900_0870086 3300037418 Bacteria 826
299 Ga0436363_0296703 3300039450 Unclassified 755
300 Ga0436362_0074779 3300039453 Bacteria 663
301 Ga0451849_1420532 3300041505 Bacteria 596
302 Ga0439449_0236580 3300042007 Unclassified 686
303 Ga0495628_0446513 3300046516 Unclassified 940
304 Ga0495598_0009117 3300046537 Bacteria 2334
305 Ga0501207_040031 3300049654 Unclassified 813
306 Ga0501209_032349 3300049656 Unclassified 1335
307 Ga0501217_220351 3300049661 Bacteria 599
308 Ga0501235_112598 3300049669 Unclassified 674
309 Ga0501270_140161 3300049767 Unclassified 543
310 Ga0501276_012146 3300049773 Bacteria 742
311 Ga0070671_100627352
312 MBSR1b_contig_13152705
313 Ga0065715_10265922
314 Ga0070658_10005969
315 Ga0070683_101923826
316 Ga0070690_100003565
317 Ga0070670_100153454
318 Ga0070677_10423657
319 Ga0068869_100189222
320 Ga0068869_100489006
321 Ga0068869_101947225
322 Ga0070666_10048622
323 Ga0070680_100409228
324 Ga0070682_100089376
325 Ga0070682_100913457
326 Ga0068868_100423367
327 Ga0068868_102253906
328 Ga0070689_100069598
329 Ga0070687_100939530
330 Ga0070687_101485815
331 Ga0070661_100051771
332 Ga0070661_100225364
333 Ga0070668_100337864
334 Ga0070668_100917520
335 Ga0070669_100552563
336 Ga0070675_100045709
337 Ga0070675_101311557
338 Ga0070671_100002445
339 Ga0070671_100387865
340 Ga0070674_100697660
341 Ga0070674_101597754
342 Ga0070688_100957676
343 Ga0070659_100954764
344 Ga0070667_100016842
345 Ga0070667_100192257
346 Ga0070667_100296102
347 Ga0070705_100610883
348 Ga0070700_100284668
349 Ga0070700_100934836
350 Ga0070678_100090394
351 Ga0070678_102057675
352 Ga0070662_100038921
353 Ga0070681_10006858
354 Ga0070681_10059636
355 Ga0070681_10845293
356 Ga0068867_100084644
357 Ga0068867_100227185
358 Ga0068867_100247545
359 Ga0068867_100343237
360 Ga0068867_101545921
361 Ga0070685_10025818
362 Ga0070698_100824061
363 Ga0070684_100294591
364 Ga0070684_100638050
365 Ga0070684_101686056
366 Ga0068853_100013712
367 Ga0068853_100062556
368 Ga0068853_100063237
369 Ga0068853_100165872
370 Ga0068853_101099863
371 Ga0070672_100218734
372 Ga0070672_100930000
373 Ga0070672_101421076
374 Ga0070686_101087776
375 Ga0070695_100160092
376 Ga0070696_101114916
377 Ga0070693_100269784
378 Ga0068855_100368969
379 Ga0068855_100516801
380 Ga0070664_100004551
381 Ga0070664_100008920
382 Ga0070664_100245927
383 Ga0070664_100497481
384 Ga0070664_101439480
385 Ga0068857_100011592
386 Ga0068857_100125178
387 Ga0068857_100190701
388 Ga0068857_100309001
389 Ga0068854_100019201
390 Ga0068854_100451190
391 Ga0070702_100199635
392 Ga0068852_100002541
393 Ga0068852_100032445
394 Ga0068852_100100567
395 Ga0068852_100869413
396 Ga0068852_101501288
397 Ga0068859_100043500
398 Ga0068859_100054227
399 Ga0068859_100119551
400 Ga0068864_100052762
401 Ga0068864_100053284
402 Ga0068864_100089019
403 Ga0068864_100212617
404 Ga0068864_101376500
405 Ga0068864_101614732
406 Ga0068861_100321202
407 Ga0068851_10121480
408 Ga0068851_10148492
409 Ga0068870_10110781
410 Ga0068870_10341248
411 Ga0068863_100122467
412 Ga0068863_100259090
413 Ga0068858_100106877
414 Ga0068858_100310184
415 Ga0068858_100737191
416 Ga0068860_100099094
417 Ga0068860_100229386
418 Ga0068860_101984133
419 Ga0068862_100124912
420 Ga0068862_100136185
421 Ga0068862_100236817
422 Ga0068862_100465295
423 Ga0070715_10498393
424 Ga0097621_100016387
425 Ga0097621_100247580
426 Ga0068871_100176262
427 Ga0068865_100143793
428 Ga0097620_100043505
429 Ga0097620_100054225
430 Ga0097620_100119556
431 Ga0105250_10260549
432 Ga0105240_10030376
433 Ga0105240_11337085
434 Ga0111539_11129661
435 Ga0105245_10892494
436 Ga0105247_10006813
437 Ga0105247_10015896
438 Ga0105247_10128894
439 Ga0114129_10998213
440 Ga0105243_10411907
441 Ga0105241_10147817
442 Ga0105241_10787690
443 Ga0105242_10116507
444 Ga0105242_10145318
445 Ga0105248_10203460
446 Ga0105248_10553436
447 Ga0105237_10122756
448 Ga0105249_10021300
449 Ga0105249_10022706
450 Ga0105249_10036033
451 Ga0105249_10240980
452 Ga0105249_10502042
453 Ga0105249_10541367
454 Ga0105249_12194604
455 Ga0105239_10951912
456 Ga0105239_11057609
457 Ga0157373_10040911
458 Ga0157373_10304267
459 Ga0157371_10451781
460 Ga0157370_10147331
461 Ga0157370_10155921
462 Ga0157369_10035976
463 Ga0157369_10049632
464 Ga0157369_10050846
465 Ga0157374_10003106
466 Ga0157374_11554469
467 Ga0157378_11063457
468 Ga0157378_12815398
469 Ga0163162_10065741
470 Ga0163162_10107144
471 Ga0157372_10021123
472 Ga0157372_10087131
473 Ga0157372_10129212
474 Ga0157372_10924701
475 Ga0157375_10341974
476 Ga0157375_10403717
477 Ga0157375_10888275
478 Ga0157375_13779293
479 Ga0163163_10002939
480 Ga0163163_10089261
481 Ga0163163_10163293
482 Ga0163163_10261242
483 Ga0163163_11288530
484 Ga0157380_10013727
485 Ga0157380_10090226
486 Ga0157380_10493812
487 Ga0157380_11869719
488 Ga0182008_10649849
489 Ga0157379_10306020
490 Ga0157379_11772787
491 Ga0157376_10331986
492 Ga0157376_11804354
493 Ga0163161_10000929
494 Ga0207656_10107155
495 Ga0207710_10002018
496 Ga0207643_10133830
497 Ga0207705_10052092
498 Ga0207707_10019123
499 Ga0207707_10417930
500 Ga0207707_11099727
501 Ga0207695_10068752
502 Ga0207671_10096806
503 Ga0207660_10114782
504 Ga0207660_10118823
505 Ga0207649_10021689
506 Ga0207652_10028418
507 Ga0207650_10079628
508 Ga0207659_11368367
509 Ga0207644_10458270
510 Ga0207644_10990480
511 Ga0207690_10072050
512 Ga0207706_10009514
513 Ga0207706_10447561
514 Ga0207709_10266557
515 Ga0207669_10213485
516 Ga0207691_10134581
517 Ga0207691_10266592
518 Ga0207691_10444684
519 Ga0207691_11329858
520 Ga0207711_10509686
521 Ga0207689_10075714
522 Ga0207661_11305403
523 Ga0207679_10010738
524 Ga0207679_10183438
525 Ga0207679_10222806
526 Ga0207679_10909718
527 Ga0207679_11048906
528 Ga0207667_10270310
529 Ga0207667_10680536
530 Ga0207712_10017736
531 Ga0207712_10093547
532 Ga0207712_10187697
533 Ga0207712_11409381
534 Ga0207668_10655729
535 Ga0207640_10049693
536 Ga0207640_10440021
537 Ga0207640_11931889
538 Ga0207658_11626733
539 Ga0207703_10175021
540 Ga0207703_11057827
541 Ga0207639_10001729
542 Ga0207639_10018412
543 Ga0207639_10116784
544 Ga0207708_11650016
545 Ga0207641_10068704
546 Ga0207641_10114543
547 Ga0207641_12498667
548 Ga0207648_10194595
549 Ga0207676_10042799
550 Ga0207676_11005001
551 Ga0207674_10021849
552 Ga0207674_10168764
553 Ga0207674_10899423
554 Ga0207675_100338133
555 Ga0207683_10177452
556 Ga0207683_11358881
557 Ga0207698_10074723
558 Ga0207698_10075281
559 Ga0207698_10610832
560 Ga0268265_10139523
561 Ga0268265_10263627
562 Ga0268265_10338652
563 Ga0268264_10007273
564 Ga0268264_11735141
565 Ga0307408_100066245
566 Ga0307516_10395463
567 Ga0307405_10255815
568 Ga0307405_10411037
569 Ga0307405_10683951
570 Ga0307405_10751011
571 Ga0307405_10972398
572 Ga0307413_10222671
573 Ga0307413_10470787
574 Ga0307413_10917983
575 Ga0307410_10256630
576 Ga0307410_10267415
577 Ga0307410_10605180
578 Ga0307406_10021849
579 Ga0307406_10312458
580 Ga0307406_10426541
581 Ga0307406_10748376
582 Ga0307406_11081893
583 Ga0307407_10226508
584 Ga0307407_10622242
585 Ga0307412_10012852
586 Ga0307412_10571245
587 Ga0307412_11100765
588 Ga0307409_100148368
589 Ga0307409_100313954
590 Ga0307409_100340835
591 Ga0307409_100373537
592 Ga0307409_100837304
593 Ga0307409_101292141
594 Ga0307416_100180481
595 Ga0307416_100457414
596 Ga0307416_100703307
597 Ga0307416_101659315
598 Ga0307416_101960168
599 Ga0307416_102114021
600 Ga0307414_10387584
601 Ga0307414_10452744
602 Ga0307414_10524344
603 Ga0307414_11952794
604 Ga0307411_10569136
605 Ga0307411_10605211
606 Ga0307415_100182492
607 Ga0307415_100938022
608 Ga0395900_0870086
609 Ga0436363_0296703
610 Ga0436362_0074779
611 Ga0451849_1420532
612 Ga0439449_0236580
613 Ga0495628_0446513
614 Ga0495598_0009117
615 Ga0501207_040031
616 Ga0501209_032349
617 Ga0501217_220351
618 Ga0501235_112598
619 Ga0501270_140161
620 Ga0501276_012146

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

31

76

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9117 30 84
6ghb-assembly1.cif.gz_B crystal structure of spx in complex with yjbh (oxidized) 0.9105 40 84
6gho-assembly1.cif.gz_B crystal structure of spx in complex with yjbh 0.8987 40 86
3irq-assembly1.cif.gz_D crystal structure of a z-z junction 0.8883 26 84
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.8861 41 83
ID Description Score Start End Superfamily
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9226 24 83 1.10.10.10
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9139 31 83 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9117 30 84 1.10.10.10
2h09A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9089 32 74 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9078 26 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N2JRN2-F1-model_v4 Transcriptional regulator 0.9648 18 120 GO:0003700
AF-A0A7V5ZDP2-F1-model_v4 ArsR family transcriptional regulator 0.9645 18 116 GO:0003700
AF-A0A3A6MVT4-F1-model_v4 ArsR family transcriptional regulator 0.9603 18 116 GO:0003700
AF-A0A4P6HQ89-F1-model_v4 Transcriptional regulator 0.9589 18 116 GO:0003700
AF-A0A7V5CWZ6-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9589 18 116 GO:0003700
GO:0046685

Map