F400337

General Info

Members Datasets Scaffolds Average Seq Length
309 192 618 362

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0061063|Ga0466963_0061063_184_1407
Length 407
Sequence VITWRNGTVSGVRRAWAGAVELDVSVEGTQVRALAYPALSGRPEPGDRVLLNTTALDLGLGTGGYALVIAIPDRLPPDPVLPGHLVKARYSPLQATVLGADEQGSPHHDVLRDADDIGGMPVVVADLHSALPAVLAGVFSAERASVSRPPAGSPPRVVYVMQDGGALPAWFSRTCAALREAGWLAATVTTGQSFGGDLETVTVHTGLLAARHVLGADVAVVAQGPGNLGTGTRWGFSGVAAGEAVNAAAALGGRPVASLRISDADPRTRHRGVSHHSLTAYGRVALARADVVVPDLDGDFGKLVAEAAAGLAGRHDVVTVPVGGLEAALRAAPVRLSTMGRGLDADLAYFLAAAAAGRHAGRLLRRQDPVVQLPALAHLAGSASRMSTTNTRVSLPVMPAWDAPALP

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
98 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
188 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
189 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
190 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
191 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
192 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 0.65
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 3.88
Rhizosphere 91.59
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0061063 3300044694 Bacteria 2519
2 Ga0070658_10001310 3300005327 Bacteria 21241
3 Ga0070658_10205725 3300005327 Bacteria 1662
4 Ga0070683_100152694 3300005329 Bacteria 2189
5 Ga0068869_100141911 3300005334 Bacteria 1855
6 Ga0070680_100001186 3300005336 Bacteria 18760
7 Ga0070680_100049754 3300005336 Bacteria 3417
8 Ga0070680_100055171 3300005336 Bacteria 3247
9 Ga0070682_100086076 3300005337 Bacteria 2046
10 Ga0068868_100005705 3300005338 Bacteria 8762
11 Ga0068868_100075293 3300005338 Bacteria 2697
12 Ga0070660_100008796 3300005339 Bacteria 7073
13 Ga0070660_100062697 3300005339 Bacteria 2889
14 Ga0070691_10014447 3300005341 Bacteria 3623
15 Ga0070659_100000782 3300005366 Bacteria 23118
16 Ga0070659_100027634 3300005366 Bacteria 4374
17 Ga0070709_10022979 3300005434 Bacteria 3655
18 Ga0070709_10236990 3300005434 Bacteria 1308
19 Ga0070714_100003788 3300005435 Bacteria 11350
20 Ga0070714_100070070 3300005435 Bacteria 3030
21 Ga0070714_100145336 3300005435 Bacteria 2132
22 Ga0070714_100274817 3300005435 Bacteria 1563
23 Ga0070713_100048265 3300005436 Bacteria 3504
24 Ga0070713_100092677 3300005436 Bacteria 2602
25 Ga0070713_100320933 3300005436 Bacteria 1430
26 Ga0070710_10020315 3300005437 Bacteria 3444
27 Ga0070710_10031706 3300005437 Bacteria 2857
28 Ga0070711_100125815 3300005439 Bacteria 1902
29 Ga0070708_100024096 3300005445 Bacteria 5184
30 Ga0070708_100032849 3300005445 Bacteria 4504
31 Ga0070663_100100788 3300005455 Bacteria 2154
32 Ga0070662_100105450 3300005457 Bacteria 2140
33 Ga0070681_10003726 3300005458 Bacteria 14308
34 Ga0070681_10006007 3300005458 Bacteria 11770
35 Ga0070681_10202774 3300005458 Bacteria 1901
36 Ga0070685_10034604 3300005466 Bacteria 2846
37 Ga0070706_100004992 3300005467 Bacteria 12699
38 Ga0070706_100009700 3300005467 Bacteria 8948
39 Ga0070706_100106559 3300005467 Bacteria 2607
40 Ga0070707_100008767 3300005468 Bacteria 9380
41 Ga0070707_100010101 3300005468 Bacteria 8785
42 Ga0070707_100107492 3300005468 Bacteria 2706
43 Ga0070698_100013213 3300005471 Bacteria 8736
44 Ga0070698_100041062 3300005471 Bacteria 4751
45 Ga0070698_100048354 3300005471 Bacteria 4346
46 Ga0070698_100098511 3300005471 Bacteria 2897
47 Ga0070699_100003744 3300005518 Bacteria 13432
48 Ga0070679_100007261 3300005530 Bacteria 10345
49 Ga0070679_100007858 3300005530 Bacteria 10001
50 Ga0070679_100026418 3300005530 Bacteria 5704
51 Ga0070679_100041644 3300005530 Bacteria 4571
52 Ga0070679_100225995 3300005530 Bacteria 1832
53 Ga0070679_100281072 3300005530 Bacteria 1617
54 Ga0070697_100000741 3300005536 Bacteria 24369
55 Ga0068853_100038614 3300005539 Bacteria 4067
56 Ga0070686_100005161 3300005544 Bacteria 7207
57 Ga0070696_100264947 3300005546 Bacteria 1304
58 Ga0068855_100073340 3300005563 Bacteria 3977
59 Ga0070664_100080449 3300005564 Bacteria 2806
60 Ga0068854_100061296 3300005578 Bacteria 2724
61 Ga0068856_100179545 3300005614 Bacteria 2130
62 Ga0068856_100385848 3300005614 Bacteria 1420
63 Ga0068852_100003280 3300005616 Bacteria 11294
64 Ga0068852_100052179 3300005616 Bacteria 3514
65 Ga0068861_100017192 3300005719 Bacteria 5128
66 Ga0068858_100107144 3300005842 Bacteria 2608
67 Ga0081540_1000082 3300005983 Bacteria 101309
68 Ga0070717_10004308 3300006028 Bacteria 10264
69 Ga0070717_10007493 3300006028 Bacteria 8107
70 Ga0070717_10027234 3300006028 Bacteria 4568
71 Ga0070717_10115218 3300006028 Bacteria 2297
72 Ga0070717_10370382 3300006028 Bacteria 1283
73 Ga0070716_100043809 3300006173 Bacteria 2504
74 Ga0070712_100011565 3300006175 Bacteria 5602
75 Ga0070712_100184650 3300006175 Bacteria 1627
76 Ga0070712_100278010 3300006175 Bacteria 1347
77 Ga0068871_100035944 3300006358 Bacteria 3940
78 Ga0068871_100234120 3300006358 Bacteria 1595
79 Ga0075428_100037514 3300006844 Bacteria 5335
80 Ga0075433_10050590 3300006852 Bacteria 3617
81 Ga0075434_100058310 3300006871 Bacteria 3837
82 Ga0068865_100027345 3300006881 Bacteria 3767
83 Ga0075435_100003610 3300007076 Bacteria 10524
84 Ga0105244_10034974 3300009036 Bacteria 2641
85 Ga0105247_10105651 3300009101 Bacteria 1806
86 Ga0105241_10012977 3300009174 Bacteria 6111
87 Ga0105248_10081772 3300009177 Bacteria 3631
88 Ga0105237_10195700 3300009545 Bacteria 2021
89 Ga0157373_10055993 3300013100 Bacteria 2801
90 Ga0157371_10015058 3300013102 Bacteria 5814
91 Ga0157371_10017946 3300013102 Bacteria 5244
92 Ga0157369_10010531 3300013105 Bacteria 10525
93 Ga0157369_10047066 3300013105 Bacteria 4685
94 Ga0157374_10114213 3300013296 Bacteria 2599
95 Ga0157378_10197328 3300013297 Bacteria 1902
96 Ga0157375_10129444 3300013308 Bacteria 2642
97 Ga0163163_10290472 3300014325 Bacteria 1687
98 Ga0163161_10033792 3300017792 Bacteria 3655
99 Ga0206354_10438842 3300020081 Bacteria 2639
100 Ga0206354_11498432 3300020081 Unclassified 1390
101 Ga0213875_10000133 3300021388 Bacteria 82555
102 Ga0213875_10000906 3300021388 Bacteria 21496
103 Ga0224572_1006729 3300024225 Bacteria 2085
104 Ga0207653_10002061 3300025885 Bacteria 6404
105 Ga0207688_10002192 3300025901 Bacteria 10521
106 Ga0207647_10039629 3300025904 Bacteria 2971
107 Ga0207647_10045970 3300025904 Bacteria 2722
108 Ga0207699_10016219 3300025906 Bacteria 3891
109 Ga0207699_10110200 3300025906 Bacteria 1763
110 Ga0207643_10006177 3300025908 Bacteria 6411
111 Ga0207705_10002655 3300025909 Bacteria 13698
112 Ga0207705_10080383 3300025909 Unclassified 2375
113 Ga0207705_10176394 3300025909 Bacteria 1611
114 Ga0207684_10003524 3300025910 Bacteria 15253
115 Ga0207684_10020507 3300025910 Bacteria 5648
116 Ga0207684_10044033 3300025910 Bacteria 3785
117 Ga0207684_10059279 3300025910 Bacteria 3250
118 Ga0207654_10005333 3300025911 Bacteria 6493
119 Ga0207654_10108032 3300025911 Bacteria 1726
120 Ga0207707_10002673 3300025912 Bacteria 15923
121 Ga0207707_10002818 3300025912 Bacteria 15497
122 Ga0207707_10127159 3300025912 Bacteria 2228
123 Ga0207695_10001432 3300025913 Bacteria 40103
124 Ga0207695_10206339 3300025913 Bacteria 1878
125 Ga0207671_10000492 3300025914 Bacteria 53745
126 Ga0207693_10014696 3300025915 Bacteria 6289
127 Ga0207693_10016169 3300025915 Bacteria 5967
128 Ga0207693_10170767 3300025915 Bacteria 1712
129 Ga0207663_10030943 3300025916 Bacteria 3162
130 Ga0207660_10003779 3300025917 Bacteria 9861
131 Ga0207660_10055895 3300025917 Bacteria 2822
132 Ga0207660_10165592 3300025917 Bacteria 1708
133 Ga0207662_10012227 3300025918 Bacteria 4778
134 Ga0207657_10001632 3300025919 Bacteria 24157
135 Ga0207657_10059959 3300025919 Bacteria 3267
136 Ga0207652_10001019 3300025921 Bacteria 25795
137 Ga0207652_10010677 3300025921 Bacteria 7395
138 Ga0207652_10013468 3300025921 Bacteria 6617
139 Ga0207652_10163901 3300025921 Bacteria 1993
140 Ga0207652_10305579 3300025921 Bacteria 1436
141 Ga0207646_10005876 3300025922 Bacteria 12818
142 Ga0207646_10013664 3300025922 Bacteria 7754
143 Ga0207646_10017233 3300025922 Bacteria 6766
144 Ga0207700_10012531 3300025928 Bacteria 5474
145 Ga0207700_10036938 3300025928 Bacteria 3533
146 Ga0207700_10038915 3300025928 Bacteria 3456
147 Ga0207700_10190459 3300025928 Bacteria 1723
148 Ga0207700_10230156 3300025928 Bacteria 1575
149 Ga0207664_10003202 3300025929 Bacteria 10880
150 Ga0207664_10016068 3300025929 Bacteria 5451
151 Ga0207664_10044629 3300025929 Bacteria 3472
152 Ga0207664_10331993 3300025929 Bacteria 1343
153 Ga0207664_10341776 3300025929 Bacteria 1323
154 Ga0207690_10000357 3300025932 Bacteria 30373
155 Ga0207706_10084866 3300025933 Bacteria 2784
156 Ga0207669_10134194 3300025937 Bacteria 1707
157 Ga0207665_10016802 3300025939 Bacteria 4806
158 Ga0207665_10026923 3300025939 Bacteria 3798
159 Ga0207665_10061313 3300025939 Bacteria 2549
160 Ga0207691_10181574 3300025940 Bacteria 1838
161 Ga0207677_10003612 3300026023 Bacteria 8200
162 Ga0207678_10002704 3300026067 Bacteria 16078
163 Ga0207702_10051235 3300026078 Bacteria 3488
164 Ga0207702_10060345 3300026078 Bacteria 3233
165 Ga0207648_10048900 3300026089 Bacteria 3702
166 Ga0207674_10012629 3300026116 Bacteria 9440
167 Ga0207674_10023863 3300026116 Bacteria 6543
168 Ga0207675_100008445 3300026118 Bacteria 9704
169 Ga0207683_10010576 3300026121 Bacteria 7871
170 Ga0265338_10026197 3300028800 Bacteria 5890
171 Ga0307415_100163579 3300032126 Bacteria 1728
172 Ga0373948_0002333 3300034817 Bacteria 2791
173 Ga0373926_0008365 3300035083 Bacteria 3441
174 Ga0373934_0036575 3300035086 Bacteria 1934
175 Ga0373923_0016986 3300035111 Bacteria 2776
176 Ga0373923_0017156 3300035111 Bacteria 2764
177 Ga0373936_0000113 3300035113 Bacteria 28216
178 Ga0373936_0003721 3300035113 Bacteria 5731
179 Ga0373945_0002439 3300035116 Bacteria 5834
180 Ga0373953_0008265 3300035117 Bacteria 3526
181 Ga0373943_0002778 3300035170 Bacteria 7965
182 Ga0373943_0003433 3300035170 Bacteria 7210
183 Ga0373946_0000745 3300035171 Bacteria 11073
184 Ga0373946_0004252 3300035171 Bacteria 5114
185 Ga0373961_0002560 3300035241 Bacteria 4685
186 Ga0373924_0027534 3300035410 Bacteria 2260
187 Ga0373931_0006022 3300035691 Bacteria 5643
188 Ga0373927_0011693 3300035695 Bacteria 5841
189 Ga0373927_0033459 3300035695 Bacteria 3347
190 Ga0373947_0003220 3300035725 Bacteria 9691
191 Ga0373947_0009945 3300035725 Bacteria 5463
192 Ga0373937_0137357 3300036401 Bacteria 2286
193 Ga0373925_0004877 3300037068 Bacteria 10094
194 Ga0373925_0101677 3300037068 Bacteria 2210
195 Ga0395898_0075587 3300037466 Bacteria 3254
196 Ga0436364_0342947 3300037853 Bacteria 4436
197 Ga0436364_0458170 3300037853 Bacteria 1394
198 Ga0436364_0699238 3300037853 Bacteria 158550
199 Ga0436364_0827413 3300037853 Bacteria 3266
200 Ga0436364_1232097 3300037853 Bacteria 76315
201 Ga0436364_1451553 3300037853 Bacteria 1841
202 Ga0436365_0843324 3300039437 Bacteria 1572
203 Ga0436363_0522161 3300039450 Bacteria 1955
204 Ga0436362_0412011 3300039453 Bacteria 1111
205 Ga0466961_0006693 3300044693 Bacteria 7332
206 Ga0466961_0047264 3300044693 Bacteria 2752
207 Ga0466963_0174967 3300044694 Bacteria 1497
208 Ga0466971_0012569 3300044719 Bacteria 3713
209 Ga0466970_0003880 3300044765 Bacteria 7320
210 Ga0466957_0001250 3300044842 Bacteria 13254
211 Ga0466960_0029171 3300044901 Bacteria 2530
212 Ga0466959_0035454 3300045049 Bacteria 3689
213 Ga0466959_0094083 3300045049 Bacteria 2150
214 Ga0466959_0365722 3300045049 Bacteria 982
215 Ga0466958_0005408 3300045836 Bacteria 6868
216 Ga0466958_0005908 3300045836 Bacteria 6617
217 Ga0466967_0060068 3300045976 Bacteria 3367
218 Ga0466967_0188778 3300045976 Bacteria 1947
219 Ga0495592_0003977 3300046454 Bacteria 10715
220 Ga0495629_0001959 3300046459 Bacteria 16050
221 Ga0495641_0001394 3300046461 Bacteria 20600
222 Ga0495651_0069810 3300046462 Bacteria 2674
223 Ga0495653_0000870 3300046463 Bacteria 23309
224 Ga0495653_0003638 3300046463 Bacteria 12432
225 Ga0495653_0118100 3300046463 Bacteria 1894
226 Ga0495582_0009131 3300046473 Bacteria 5470
227 Ga0495582_0021157 3300046473 Bacteria 3562
228 Ga0495639_0001686 3300046475 Bacteria 9807
229 Ga0495662_0000371 3300046476 Bacteria 19811
230 Ga0495664_0016216 3300046477 Bacteria 4243
231 Ga0495664_0092773 3300046477 Bacteria 1816
232 Ga0495608_0018046 3300046511 Bacteria 4875
233 Ga0495608_0056970 3300046511 Bacteria 2579
234 Ga0495618_0029796 3300046514 Bacteria 3405
235 Ga0495628_0118189 3300046516 Bacteria 2035
236 Ga0495628_0217155 3300046516 Bacteria 1437
237 Ga0495630_0001389 3300046517 Bacteria 16713
238 Ga0495630_0004059 3300046517 Bacteria 10250
239 Ga0495666_0001878 3300046526 Bacteria 10371
240 Ga0495652_0033033 3300046529 Bacteria 4521
241 Ga0495652_0062954 3300046529 Bacteria 3125
242 Ga0495665_0012762 3300046531 Bacteria 4545
243 Ga0495665_0013396 3300046531 Bacteria 4434
244 Ga0495640_0003592 3300046533 Bacteria 12453
245 Ga0495640_0032985 3300046533 Bacteria 3683
246 Ga0495587_0009074 3300046536 Bacteria 6382
247 Ga0495587_0046216 3300046536 Bacteria 2585
248 Ga0495645_0056360 3300046543 Bacteria 2853
249 Ga0495645_0076809 3300046543 Bacteria 2402
250 Ga0495622_0064927 3300046557 Bacteria 1688
251 Ga0495667_0004468 3300046559 Bacteria 9433
252 Ga0495667_0027738 3300046559 Bacteria 3813
253 Ga0495667_0088310 3300046559 Bacteria 2009
254 Ga0495634_0013962 3300046642 Bacteria 5801
255 Ga0495634_0026674 3300046642 Bacteria 4030
256 Ga0495635_0000385 3300046663 Bacteria 28002
257 Ga0495635_0013318 3300046663 Bacteria 5755
258 Ga0495599_0003576 3300046678 Bacteria 9109
259 Ga0495623_0125455 3300046679 Bacteria 1542
260 Ga0495646_0003502 3300046680 Bacteria 9773
261 Ga0495658_0002045 3300046683 Bacteria 10271
262 Ga0495624_0010012 3300046690 Bacteria 6547
263 Ga0495600_0079055 3300046809 Bacteria 2147
264 Ga0495674_0000484 3300047319 Bacteria 36214
265 Ga0495674_0008060 3300047319 Bacteria 10055
266 Ga0495676_0003803 3300047321 Bacteria 13718
267 Ga0495676_0016271 3300047321 Bacteria 6604
268 Ga0495680_0020087 3300047322 Bacteria 5628
269 Ga0495680_0030869 3300047322 Bacteria 4367
270 Ga0495680_0064116 3300047322 Bacteria 2818
271 Ga0495684_0027869 3300047471 Bacteria 4338
272 Ga0495684_0040632 3300047471 Bacteria 3565
273 Ga0495593_0014507 3300047673 Bacteria 4478
274 Ga0495602_0110355 3300048088 Bacteria 2236
275 Ga0496101_0024141 3300048904 Bacteria 4205
276 Ga0496103_0061968 3300048906 Bacteria 2327
277 Ga0496104_0432036 3300048907 Bacteria 1229
278 Ga0496105_0024904 3300048908 Bacteria 4864
279 Ga0496106_0056719 3300048909 Bacteria 2961
280 Ga0496107_0230355 3300048910 Bacteria 1378
281 Ga0496109_0159607 3300048912 Bacteria 2113
282 Ga0496110_0334768 3300048913 Bacteria 1379
283 Ga0496111_0051727 3300048914 Bacteria 2965
284 Ga0496112_0171035 3300048915 Bacteria 2138
285 Ga0496114_0056411 3300048917 Bacteria 3278
286 Ga0496115_0167905 3300048918 Bacteria 1814
287 Ga0496126_0045347 3300048929 Bacteria 4041
288 Ga0501038_0142405 3300049574 Bacteria 1960
289 Ga0501042_0015810 3300049578 Bacteria 5172
290 Ga0501047_0020393 3300049581 Bacteria 6366
291 Ga0501047_0052357 3300049581 Bacteria 3946
292 Ga0501080_0027176 3300049742 Bacteria 5321
293 Ga0501080_0236544 3300049742 Bacteria 1668
294 Ga0501083_0004710 3300049744 Bacteria 9639
295 Ga0501035_0059025 3300049822 Bacteria 3417
296 nmdc:mga0n895_228753_c1 3300050512 Bacteria 1888
297 nmdc:mga08x19_56705_c1 3300050514 Bacteria 2529
298 Ga0495601_0002077 3300053077 Bacteria 11241
299 Ga0495619_0002039 3300053085 Bacteria 13425
300 Ga0495619_0070926 3300053085 Bacteria 2331
301 Ga0500643_000369 3300053087 Bacteria 35468
302 Ga0500568_0005407 3300053139 Bacteria 6603
303 Ga0466962_0001073 3300061719 Bacteria 12569
304 2515851247 2515154155 Bacteria 7985436
305 2676475752 2675903058 Bacteria 6822861
306 2731909306 2731639228 Bacteria 4187555
307 2799186369 2799112218 Bacteria 4315149
308 2827630312 2827628540 Bacteria 6858585
309 8056064418 8056060235 Bacteria 7259403
310 Ga0466963_0061063
311 Ga0070658_10001310
312 Ga0070658_10205725
313 Ga0070683_100152694
314 Ga0068869_100141911
315 Ga0070680_100001186
316 Ga0070680_100049754
317 Ga0070680_100055171
318 Ga0070682_100086076
319 Ga0068868_100005705
320 Ga0068868_100075293
321 Ga0070660_100008796
322 Ga0070660_100062697
323 Ga0070691_10014447
324 Ga0070659_100000782
325 Ga0070659_100027634
326 Ga0070709_10022979
327 Ga0070709_10236990
328 Ga0070714_100003788
329 Ga0070714_100070070
330 Ga0070714_100145336
331 Ga0070714_100274817
332 Ga0070713_100048265
333 Ga0070713_100092677
334 Ga0070713_100320933
335 Ga0070710_10020315
336 Ga0070710_10031706
337 Ga0070711_100125815
338 Ga0070708_100024096
339 Ga0070708_100032849
340 Ga0070663_100100788
341 Ga0070662_100105450
342 Ga0070681_10003726
343 Ga0070681_10006007
344 Ga0070681_10202774
345 Ga0070685_10034604
346 Ga0070706_100004992
347 Ga0070706_100009700
348 Ga0070706_100106559
349 Ga0070707_100008767
350 Ga0070707_100010101
351 Ga0070707_100107492
352 Ga0070698_100013213
353 Ga0070698_100041062
354 Ga0070698_100048354
355 Ga0070698_100098511
356 Ga0070699_100003744
357 Ga0070679_100007261
358 Ga0070679_100007858
359 Ga0070679_100026418
360 Ga0070679_100041644
361 Ga0070679_100225995
362 Ga0070679_100281072
363 Ga0070697_100000741
364 Ga0068853_100038614
365 Ga0070686_100005161
366 Ga0070696_100264947
367 Ga0068855_100073340
368 Ga0070664_100080449
369 Ga0068854_100061296
370 Ga0068856_100179545
371 Ga0068856_100385848
372 Ga0068852_100003280
373 Ga0068852_100052179
374 Ga0068861_100017192
375 Ga0068858_100107144
376 Ga0081540_1000082
377 Ga0070717_10004308
378 Ga0070717_10007493
379 Ga0070717_10027234
380 Ga0070717_10115218
381 Ga0070717_10370382
382 Ga0070716_100043809
383 Ga0070712_100011565
384 Ga0070712_100184650
385 Ga0070712_100278010
386 Ga0068871_100035944
387 Ga0068871_100234120
388 Ga0075428_100037514
389 Ga0075433_10050590
390 Ga0075434_100058310
391 Ga0068865_100027345
392 Ga0075435_100003610
393 Ga0105244_10034974
394 Ga0105247_10105651
395 Ga0105241_10012977
396 Ga0105248_10081772
397 Ga0105237_10195700
398 Ga0157373_10055993
399 Ga0157371_10015058
400 Ga0157371_10017946
401 Ga0157369_10010531
402 Ga0157369_10047066
403 Ga0157374_10114213
404 Ga0157378_10197328
405 Ga0157375_10129444
406 Ga0163163_10290472
407 Ga0163161_10033792
408 Ga0206354_10438842
409 Ga0206354_11498432
410 Ga0213875_10000133
411 Ga0213875_10000906
412 Ga0224572_1006729
413 Ga0207653_10002061
414 Ga0207688_10002192
415 Ga0207647_10039629
416 Ga0207647_10045970
417 Ga0207699_10016219
418 Ga0207699_10110200
419 Ga0207643_10006177
420 Ga0207705_10002655
421 Ga0207705_10080383
422 Ga0207705_10176394
423 Ga0207684_10003524
424 Ga0207684_10020507
425 Ga0207684_10044033
426 Ga0207684_10059279
427 Ga0207654_10005333
428 Ga0207654_10108032
429 Ga0207707_10002673
430 Ga0207707_10002818
431 Ga0207707_10127159
432 Ga0207695_10001432
433 Ga0207695_10206339
434 Ga0207671_10000492
435 Ga0207693_10014696
436 Ga0207693_10016169
437 Ga0207693_10170767
438 Ga0207663_10030943
439 Ga0207660_10003779
440 Ga0207660_10055895
441 Ga0207660_10165592
442 Ga0207662_10012227
443 Ga0207657_10001632
444 Ga0207657_10059959
445 Ga0207652_10001019
446 Ga0207652_10010677
447 Ga0207652_10013468
448 Ga0207652_10163901
449 Ga0207652_10305579
450 Ga0207646_10005876
451 Ga0207646_10013664
452 Ga0207646_10017233
453 Ga0207700_10012531
454 Ga0207700_10036938
455 Ga0207700_10038915
456 Ga0207700_10190459
457 Ga0207700_10230156
458 Ga0207664_10003202
459 Ga0207664_10016068
460 Ga0207664_10044629
461 Ga0207664_10331993
462 Ga0207664_10341776
463 Ga0207690_10000357
464 Ga0207706_10084866
465 Ga0207669_10134194
466 Ga0207665_10016802
467 Ga0207665_10026923
468 Ga0207665_10061313
469 Ga0207691_10181574
470 Ga0207677_10003612
471 Ga0207678_10002704
472 Ga0207702_10051235
473 Ga0207702_10060345
474 Ga0207648_10048900
475 Ga0207674_10012629
476 Ga0207674_10023863
477 Ga0207675_100008445
478 Ga0207683_10010576
479 Ga0265338_10026197
480 Ga0307415_100163579
481 Ga0373948_0002333
482 Ga0373926_0008365
483 Ga0373934_0036575
484 Ga0373923_0016986
485 Ga0373923_0017156
486 Ga0373936_0000113
487 Ga0373936_0003721
488 Ga0373945_0002439
489 Ga0373953_0008265
490 Ga0373943_0002778
491 Ga0373943_0003433
492 Ga0373946_0000745
493 Ga0373946_0004252
494 Ga0373961_0002560
495 Ga0373924_0027534
496 Ga0373931_0006022
497 Ga0373927_0011693
498 Ga0373927_0033459
499 Ga0373947_0003220
500 Ga0373947_0009945
501 Ga0373937_0137357
502 Ga0373925_0004877
503 Ga0373925_0101677
504 Ga0395898_0075587
505 Ga0436364_0342947
506 Ga0436364_0458170
507 Ga0436364_0699238
508 Ga0436364_0827413
509 Ga0436364_1232097
510 Ga0436364_1451553
511 Ga0436365_0843324
512 Ga0436363_0522161
513 Ga0436362_0412011
514 Ga0466961_0006693
515 Ga0466961_0047264
516 Ga0466963_0174967
517 Ga0466971_0012569
518 Ga0466970_0003880
519 Ga0466957_0001250
520 Ga0466960_0029171
521 Ga0466959_0035454
522 Ga0466959_0094083
523 Ga0466959_0365722
524 Ga0466958_0005408
525 Ga0466958_0005908
526 Ga0466967_0060068
527 Ga0466967_0188778
528 Ga0495592_0003977
529 Ga0495629_0001959
530 Ga0495641_0001394
531 Ga0495651_0069810
532 Ga0495653_0000870
533 Ga0495653_0003638
534 Ga0495653_0118100
535 Ga0495582_0009131
536 Ga0495582_0021157
537 Ga0495639_0001686
538 Ga0495662_0000371
539 Ga0495664_0016216
540 Ga0495664_0092773
541 Ga0495608_0018046
542 Ga0495608_0056970
543 Ga0495618_0029796
544 Ga0495628_0118189
545 Ga0495628_0217155
546 Ga0495630_0001389
547 Ga0495630_0004059
548 Ga0495666_0001878
549 Ga0495652_0033033
550 Ga0495652_0062954
551 Ga0495665_0012762
552 Ga0495665_0013396
553 Ga0495640_0003592
554 Ga0495640_0032985
555 Ga0495587_0009074
556 Ga0495587_0046216
557 Ga0495645_0056360
558 Ga0495645_0076809
559 Ga0495622_0064927
560 Ga0495667_0004468
561 Ga0495667_0027738
562 Ga0495667_0088310
563 Ga0495634_0013962
564 Ga0495634_0026674
565 Ga0495635_0000385
566 Ga0495635_0013318
567 Ga0495599_0003576
568 Ga0495623_0125455
569 Ga0495646_0003502
570 Ga0495658_0002045
571 Ga0495624_0010012
572 Ga0495600_0079055
573 Ga0495674_0000484
574 Ga0495674_0008060
575 Ga0495676_0003803
576 Ga0495676_0016271
577 Ga0495680_0020087
578 Ga0495680_0030869
579 Ga0495680_0064116
580 Ga0495684_0027869
581 Ga0495684_0040632
582 Ga0495593_0014507
583 Ga0495602_0110355
584 Ga0496101_0024141
585 Ga0496103_0061968
586 Ga0496104_0432036
587 Ga0496105_0024904
588 Ga0496106_0056719
589 Ga0496107_0230355
590 Ga0496109_0159607
591 Ga0496110_0334768
592 Ga0496111_0051727
593 Ga0496112_0171035
594 Ga0496114_0056411
595 Ga0496115_0167905
596 Ga0496126_0045347
597 Ga0501038_0142405
598 Ga0501042_0015810
599 Ga0501047_0020393
600 Ga0501047_0052357
601 Ga0501080_0027176
602 Ga0501080_0236544
603 Ga0501083_0004710
604 Ga0501035_0059025
605 nmdc:mga0n895_228753_c1
606 nmdc:mga08x19_56705_c1
607 Ga0495601_0002077
608 Ga0495619_0002039
609 Ga0495619_0070926
610 Ga0500643_000369
611 Ga0500568_0005407
612 Ga0466962_0001073
613 2515851247
614 2676475752
615 2731909306
616 2799186369
617 2827630312
618 8056064418

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12982

DUF3866

Protein of unknown function (DUF3866)

32

357

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qhs-assembly1.cif.gz_G s. cerevisiae cmge nucleating origin dna melting 0.7952 2 28
5ihe-assembly2.cif.gz_B d-family dna polymerase - dp1 subunit (3'-5' proof-reading exonuclease) 0.6992 1 31
4ycw-assembly2.cif.gz_E crystal structure of cladosporin in complex with plasmodium like human lysyl-trna synthetase mutant 0.6551 1 28
6chd-assembly1.cif.gz_B crystal structure of human lysyl-trna synthetase complexed with l-lysylsulfamoyl adenosine 0.6351 1 32
6ilh-assembly1.cif.gz_B crystal structure of human lysyl-trna synthetase l350h mutant 0.6281 1 32
ID Description Score Start End Superfamily
af_Q9VTZ2_33_207_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8141 1 28 2.40.50.140
af_A0A1D6J2B8_537_691_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.7262 10 28 3.30.230.130
4joiB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7203 1 28 2.40.50.140
1wydB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6933 1 28 2.40.50.140
af_A0A0R0GRC2_4_83_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.687 1 44 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A838SLA6-F1-model_v4 DUF3866 family protein 0.9847 224 333
AF-A0A7Y6AJR6-F1-model_v4 DUF3866 family protein 0.9772 241 332
AF-A0A4R4WST8-F1-model_v4 DUF3866 family protein 0.972 231 332
AF-A0A838SLA6-F1-model_v4 DUF3866 family protein 0.9674 224 333
AF-A0A7W0P2N4-F1-model_v4 DUF3866 family protein 0.9622 1 67

Map