F400219

General Info

Members Datasets Scaffolds Average Seq Length
309 146 618 331

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10022697|Ga0157372_100226974
Length 368
Sequence MDSTLILVGGIILVALIFDFVNGFHDAANSQAVLWAAAFNFIAAFSVGTGVAKTVGAGMIDLQYVTPLVILAGLVGAITWDLITWWLGLPTSSSHALIGGYGGAAMARVAHLRGLDRSFDALIGGAWIKTLVFIVIAPLMGMALAYAMMIAVYWIFRNAHPEKMDRYFRRLQLVSSAALSFSHGANDAQKTAGIITGVLVTSGMLAKFEVPTWVIFAAYGAIALGTMSGGWRVVHTMGARLTKLKPRSGFCAETAAAISIMFATEYLKLPVSTTHVTAGAIAGVGSIQRMKAVRWGVATNILWAWILTIPAAAIVGWLTMEGIQIFTKATNAAELLGSLDRQNLRADSIRRLPSPLRIAPRPVATAAQ

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.97
Rhizosphere 90.61
Stem 0
Stem Tuber 0
Unclassified 12.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10022697 3300013307 Bacteria 6792
2 Ga0070683_100000030 3300005329 Bacteria 152931
3 Ga0070683_100025004 3300005329 Bacteria 5356
4 Ga0070683_100027720 3300005329 Bacteria 5111
5 Ga0070683_100040152 3300005329 Bacteria 4300
6 Ga0070683_100055530 3300005329 Bacteria 3675
7 Ga0070690_100161142 3300005330 Bacteria 1537
8 Ga0068869_100016963 3300005334 Bacteria 4924
9 Ga0070666_10016958 3300005335 Bacteria 4664
10 Ga0070680_100012786 3300005336 Bacteria 6529
11 Ga0070680_100123269 3300005336 Bacteria 2164
12 Ga0068868_100024660 3300005338 Bacteria 4566
13 Ga0070660_100215652 3300005339 Bacteria 1559
14 Ga0070660_100245735 3300005339 Unclassified 1458
15 Ga0070671_100125318 3300005355 Bacteria 2162
16 Ga0070659_100069588 3300005366 Unclassified 2794
17 Ga0070659_100234547 3300005366 Bacteria 1517
18 Ga0070709_10087557 3300005434 Bacteria 2047
19 Ga0070714_100022235 3300005435 Bacteria 5197
20 Ga0070713_100002343 3300005436 Bacteria 12365
21 Ga0070713_100003309 3300005436 Bacteria 10629
22 Ga0070711_100134320 3300005439 Unclassified 1847
23 Ga0070662_100030988 3300005457 Bacteria 3749
24 Ga0070681_10111965 3300005458 Bacteria 2669
25 Ga0070681_10265751 3300005458 Bacteria 1627
26 Ga0070681_10340811 3300005458 Bacteria 1409
27 Ga0070681_10485594 3300005458 Bacteria 1148
28 Ga0068867_100052057 3300005459 Unclassified 3021
29 Ga0068867_100068232 3300005459 Unclassified 2653
30 Ga0070679_100047489 3300005530 Bacteria 4279
31 Ga0070679_100107519 3300005530 Bacteria 2775
32 Ga0070684_100000041 3300005535 Bacteria 92959
33 Ga0070684_100006727 3300005535 Bacteria 8915
34 Ga0070684_100035811 3300005535 Bacteria 4250
35 Ga0070684_100042363 3300005535 Bacteria 3929
36 Ga0070684_100144910 3300005535 Bacteria 2149
37 Ga0070684_100242849 3300005535 Bacteria 1646
38 Ga0068853_100013694 3300005539 Bacteria 6625
39 Ga0068853_100081189 3300005539 Unclassified 2838
40 Ga0070693_100033152 3300005547 Bacteria 2848
41 Ga0068855_100055955 3300005563 Bacteria 4630
42 Ga0068855_100143816 3300005563 Bacteria 2716
43 Ga0068855_100433384 3300005563 Bacteria 1437
44 Ga0068855_100501344 3300005563 Bacteria 1319
45 Ga0070664_100146584 3300005564 Unclassified 2082
46 Ga0068857_100011496 3300005577 Bacteria 7701
47 Ga0068856_100052291 3300005614 Unclassified 4028
48 Ga0068856_100124691 3300005614 Bacteria 2579
49 Ga0068856_100438910 3300005614 Bacteria 1326
50 Ga0068852_100062406 3300005616 Bacteria 3242
51 Ga0068852_100260807 3300005616 Bacteria 1664
52 Ga0068852_100292504 3300005616 Bacteria 1574
53 Ga0068859_100136149 3300005617 Bacteria 2529
54 Ga0068859_100323688 3300005617 Bacteria 1636
55 Ga0068864_100145429 3300005618 Bacteria 2143
56 Ga0068861_100081341 3300005719 Bacteria 2536
57 Ga0068863_100016425 3300005841 Bacteria 7101
58 Ga0068863_100413223 3300005841 Bacteria 1321
59 Ga0068858_100082353 3300005842 Bacteria 2991
60 Ga0068858_100117130 3300005842 Unclassified 2490
61 Ga0068858_100126017 3300005842 Bacteria 2398
62 Ga0068860_100014305 3300005843 Bacteria 7781
63 Ga0068860_100292144 3300005843 Unclassified 1595
64 Ga0070717_10043993 3300006028 Bacteria 3646
65 Ga0070717_10049906 3300006028 Bacteria 3437
66 Ga0070717_10253363 3300006028 Bacteria 1556
67 Ga0097621_100021422 3300006237 Bacteria 5000
68 Ga0068871_100010279 3300006358 Bacteria 6821
69 Ga0068871_100039823 3300006358 Unclassified 3763
70 Ga0068871_100065920 3300006358 Bacteria 2967
71 Ga0068871_100137144 3300006358 Bacteria 2078
72 Ga0068871_100277174 3300006358 Bacteria 1466
73 Ga0075431_100043603 3300006847 Bacteria 4627
74 Ga0075434_100132037 3300006871 Bacteria 2517
75 Ga0075429_100142395 3300006880 Bacteria 2099
76 Ga0097620_100136149 3300006931 Bacteria 2529
77 Ga0097620_100323679 3300006931 Bacteria 1636
78 Ga0105240_10010071 3300009093 Bacteria 13309
79 Ga0105240_10035569 3300009093 Bacteria 6417
80 Ga0105240_10078854 3300009093 Bacteria 4054
81 Ga0105240_10114425 3300009093 Bacteria 3259
82 Ga0105245_10003297 3300009098 Bacteria 14493
83 Ga0105245_10022922 3300009098 Bacteria 5478
84 Ga0105245_10040945 3300009098 Bacteria 4129
85 Ga0105245_10046397 3300009098 Bacteria 3883
86 Ga0105245_10118378 3300009098 Bacteria 2472
87 Ga0105243_10046384 3300009148 Unclassified 3418
88 Ga0105241_10018425 3300009174 Bacteria 5136
89 Ga0105241_10024439 3300009174 Bacteria 4486
90 Ga0105241_10063001 3300009174 Bacteria 2860
91 Ga0105241_10127651 3300009174 Bacteria 2055
92 Ga0105241_10146429 3300009174 Bacteria 1928
93 Ga0105242_10035457 3300009176 Bacteria 4001
94 Ga0105242_10038231 3300009176 Bacteria 3859
95 Ga0105242_10042880 3300009176 Bacteria 3657
96 Ga0105242_10066382 3300009176 Bacteria 2979
97 Ga0105242_10080213 3300009176 Bacteria 2727
98 Ga0105248_10018054 3300009177 Bacteria 7787
99 Ga0105248_10097243 3300009177 Unclassified 3317
100 Ga0105248_10150031 3300009177 Bacteria 2630
101 Ga0105248_10160092 3300009177 Bacteria 2540
102 Ga0105248_10251613 3300009177 Bacteria 1989
103 Ga0105237_10006421 3300009545 Bacteria 13045
104 Ga0105237_10068385 3300009545 Bacteria 3545
105 Ga0105238_10015696 3300009551 Bacteria 7668
106 Ga0105238_10035694 3300009551 Bacteria 5053
107 Ga0105238_10047363 3300009551 Bacteria 4335
108 Ga0105238_10382577 3300009551 Unclassified 1399
109 Ga0105249_10052704 3300009553 Bacteria 3716
110 Ga0105239_10007933 3300010375 Bacteria 12136
111 Ga0105239_10074930 3300010375 Bacteria 3721
112 Ga0157370_10022441 3300013104 Bacteria 6279
113 Ga0157369_10013964 3300013105 Bacteria 9075
114 Ga0157369_10020322 3300013105 Bacteria 7422
115 Ga0157369_10182915 3300013105 Bacteria 2205
116 Ga0157369_10274033 3300013105 Bacteria 1758
117 Ga0157374_10033668 3300013296 Bacteria 4677
118 Ga0157374_10042546 3300013296 Unclassified 4190
119 Ga0157374_10058787 3300013296 Bacteria 3593
120 Ga0157378_10033803 3300013297 Bacteria 4522
121 Ga0157378_10080995 3300013297 Bacteria 2934
122 Ga0157372_10057239 3300013307 Bacteria 4357
123 Ga0157372_10101975 3300013307 Bacteria 3277
124 Ga0157372_10276644 3300013307 Unclassified 1951
125 Ga0157372_10363163 3300013307 Bacteria 1687
126 Ga0157375_10010076 3300013308 Bacteria 8312
127 Ga0157375_10221311 3300013308 Bacteria 2051
128 Ga0163163_10023891 3300014325 Bacteria 5811
129 Ga0163163_10143886 3300014325 Unclassified 2427
130 Ga0163163_10160211 3300014325 Bacteria 2295
131 Ga0163163_10212829 3300014325 Unclassified 1982
132 Ga0163163_10287837 3300014325 Bacteria 1695
133 Ga0157379_10142044 3300014968 Unclassified 2164
134 Ga0157379_10345967 3300014968 Bacteria 1360
135 Ga0157376_10030547 3300014969 Unclassified 4303
136 Ga0157376_10043571 3300014969 Bacteria 3683
137 Ga0157376_10416355 3300014969 Bacteria 1303
138 Ga0157376_10521299 3300014969 Bacteria 1171
139 Ga0213876_10006950 3300021384 Bacteria 6167
140 Ga0213876_10009739 3300021384 Bacteria 5171
141 Ga0213875_10000041 3300021388 Bacteria 155792
142 Ga0213875_10001501 3300021388 Bacteria 15006
143 Ga0213875_10031236 3300021388 Bacteria 2520
144 Ga0213875_10042386 3300021388 Bacteria 2138
145 Ga0213875_10049501 3300021388 Bacteria 1970
146 Ga0213875_10074670 3300021388 Bacteria 1582
147 Ga0213875_10081887 3300021388 Bacteria 1506
148 Ga0213875_10112484 3300021388 Bacteria 1272
149 Ga0207680_10013824 3300025903 Bacteria 4158
150 Ga0207680_10159554 3300025903 Bacteria 1511
151 Ga0207699_10027260 3300025906 Unclassified 3161
152 Ga0207699_10140635 3300025906 Bacteria 1586
153 Ga0207654_10022243 3300025911 Bacteria 3381
154 Ga0207707_10127680 3300025912 Bacteria 2224
155 Ga0207707_10413623 3300025912 Bacteria 1157
156 Ga0207695_10009760 3300025913 Bacteria 11811
157 Ga0207695_10015226 3300025913 Bacteria 9068
158 Ga0207695_10052955 3300025913 Unclassified 4248
159 Ga0207695_10257971 3300025913 Bacteria 1641
160 Ga0207695_10323363 3300025913 Bacteria 1432
161 Ga0207671_10075008 3300025914 Bacteria 2529
162 Ga0207663_10027299 3300025916 Bacteria 3325
163 Ga0207660_10032511 3300025917 Bacteria 3601
164 Ga0207657_10213849 3300025919 Bacteria 1546
165 Ga0207657_10319033 3300025919 Unclassified 1229
166 Ga0207652_10089793 3300025921 Bacteria 2699
167 Ga0207652_10147238 3300025921 Bacteria 2108
168 Ga0207694_10029274 3300025924 Bacteria 4202
169 Ga0207694_10036275 3300025924 Bacteria 3784
170 Ga0207694_10050575 3300025924 Bacteria 3219
171 Ga0207694_10142475 3300025924 Bacteria 1928
172 Ga0207687_10035294 3300025927 Bacteria 3401
173 Ga0207687_10044847 3300025927 Unclassified 3054
174 Ga0207687_10097317 3300025927 Bacteria 2158
175 Ga0207687_10224239 3300025927 Bacteria 1481
176 Ga0207700_10001507 3300025928 Bacteria 13185
177 Ga0207700_10020189 3300025928 Bacteria 4518
178 Ga0207700_10085657 3300025928 Bacteria 2474
179 Ga0207664_10020803 3300025929 Bacteria 4869
180 Ga0207690_10246898 3300025932 Bacteria 1377
181 Ga0207706_10092770 3300025933 Unclassified 2655
182 Ga0207686_10026992 3300025934 Bacteria 3357
183 Ga0207686_10035894 3300025934 Bacteria 2979
184 Ga0207686_10143927 3300025934 Bacteria 1651
185 Ga0207709_10018489 3300025935 Bacteria 3904
186 Ga0207709_10051390 3300025935 Bacteria 2527
187 Ga0207711_10058943 3300025941 Unclassified 3305
188 Ga0207711_10088899 3300025941 Bacteria 2713
189 Ga0207711_10147552 3300025941 Bacteria 2120
190 Ga0207711_10193283 3300025941 Unclassified 1855
191 Ga0207711_10244477 3300025941 Bacteria 1646
192 Ga0207689_10008538 3300025942 Bacteria 8930
193 Ga0207689_10080874 3300025942 Bacteria 2671
194 Ga0207661_10000035 3300025944 Bacteria 152976
195 Ga0207661_10016140 3300025944 Bacteria 5503
196 Ga0207661_10024556 3300025944 Bacteria 4569
197 Ga0207661_10222118 3300025944 Bacteria 1670
198 Ga0207661_10239796 3300025944 Bacteria 1608
199 Ga0207679_10115768 3300025945 Unclassified 2124
200 Ga0207667_10038985 3300025949 Bacteria 5066
201 Ga0207667_10095102 3300025949 Unclassified 3076
202 Ga0207667_10108352 3300025949 Bacteria 2866
203 Ga0207667_10368553 3300025949 Bacteria 1464
204 Ga0207712_10037640 3300025961 Unclassified 3302
205 Ga0207658_10298495 3300025986 Bacteria 1387
206 Ga0207677_10156467 3300026023 Bacteria 1765
207 Ga0207703_10069170 3300026035 Unclassified 2911
208 Ga0207703_10181235 3300026035 Bacteria 1859
209 Ga0207703_10354337 3300026035 Bacteria 1352
210 Ga0207639_10071080 3300026041 Bacteria 2721
211 Ga0207678_10014653 3300026067 Bacteria 6900
212 Ga0207702_10075120 3300026078 Unclassified 2919
213 Ga0207702_10559377 3300026078 Bacteria 1119
214 Ga0207641_10258252 3300026088 Bacteria 1630
215 Ga0207641_10418616 3300026088 Bacteria 1289
216 Ga0207676_10142153 3300026095 Bacteria 2056
217 Ga0207676_10147196 3300026095 Bacteria 2024
218 Ga0207674_10003224 3300026116 Bacteria 20087
219 Ga0207675_100038884 3300026118 Bacteria 4439
220 Ga0207683_10155766 3300026121 Bacteria 2063
221 Ga0207698_10259052 3300026142 Bacteria 1597
222 Ga0268266_10010329 3300028379 Bacteria 8168
223 Ga0268265_10000496 3300028380 Bacteria 40862
224 Ga0268264_10021754 3300028381 Bacteria 5235
225 Ga0268264_10205300 3300028381 Bacteria 1805
226 Ga0268264_10375608 3300028381 Bacteria 1360
227 Ga0265323_10000691 3300028653 Bacteria 18354
228 Ga0265330_10000034 3300031235 Bacteria 123933
229 Ga0265330_10038005 3300031235 Bacteria 2141
230 Ga0265332_10000390 3300031238 Bacteria 32027
231 Ga0265325_10002858 3300031241 Bacteria 11516
232 Ga0265329_10004469 3300031242 Bacteria 5804
233 Ga0265331_10013907 3300031250 Bacteria 4305
234 Ga0265316_10000057 3300031344 Bacteria 119213
235 Ga0265316_10007009 3300031344 Bacteria 10677
236 Ga0265316_10037580 3300031344 Bacteria 3907
237 Ga0265316_10057613 3300031344 Bacteria 3029
238 Ga0265316_10177381 3300031344 Unclassified 1587
239 Ga0265314_10000039 3300031711 Bacteria 220957
240 Ga0265314_10021389 3300031711 Bacteria 4974
241 Ga0265342_10000266 3300031712 Bacteria 58678
242 Ga0265342_10020179 3300031712 Bacteria 4282
243 Ga0316574_0035172 3300035398 Bacteria 3060
244 Ga0373935_0070914 3300035692 Bacteria 2247
245 Ga0373935_0177418 3300035692 Bacteria 1461
246 Ga0373927_0003128 3300035695 Bacteria 11964
247 Ga0373933_0029640 3300035724 Bacteria 3166
248 Ga0373937_0018064 3300036401 Bacteria 6290
249 Ga0373925_0026478 3300037068 Bacteria 4243
250 Ga0373925_0097147 3300037068 Bacteria 2259
251 Ga0436364_0094278 3300037853 Bacteria 8378
252 Ga0436364_0467758 3300037853 Bacteria 119174
253 Ga0436364_0514628 3300037853 Bacteria 4293
254 Ga0436364_0593544 3300037853 Bacteria 1880
255 Ga0436364_0671634 3300037853 Bacteria 2299
256 Ga0436364_0673348 3300037853 Bacteria 11604
257 Ga0436364_0687626 3300037853 Bacteria 3174
258 Ga0436364_0754760 3300037853 Bacteria 20544
259 Ga0436364_0789766 3300037853 Bacteria 4848
260 Ga0436364_0967681 3300037853 Unclassified 4735
261 Ga0436365_0533170 3300039437 Bacteria 5775
262 Ga0436365_0602508 3300039437 Bacteria 1846
263 Ga0436365_0924538 3300039437 Bacteria 4289
264 Ga0436365_1339401 3300039437 Bacteria 8884
265 Ga0436365_1440783 3300039437 Bacteria 18953
266 Ga0436363_0921108 3300039450 Unclassified 4168
267 Ga0436362_1034052 3300039453 Bacteria 6293
268 Ga0451577_0011776 3300042876 Bacteria 8255
269 Ga0453683_0000210 3300044673 Bacteria 78708
270 Ga0453684_0000036 3300044712 Bacteria 711481
271 Ga0453684_0007625 3300044712 Bacteria 19821
272 Ga0453684_0023153 3300044712 Bacteria 9167
273 Ga0451576_0011737 3300045051 Bacteria 9923
274 Ga0451576_0131322 3300045051 Bacteria 2611
275 Ga0451576_0265241 3300045051 Bacteria 1795
276 Ga0495580_0030143 3300046472 Bacteria 3930
277 Ga0495580_0150327 3300046472 Unclassified 1613
278 Ga0495580_0181138 3300046472 Bacteria 1455
279 Ga0495594_0098356 3300046499 Bacteria 1645
280 Ga0495665_0043653 3300046531 Bacteria 2384
281 Ga0495645_0096312 3300046543 Bacteria 2109
282 Ga0495645_0133130 3300046543 Bacteria 1740
283 Ga0495645_0198207 3300046543 Bacteria 1364
284 Ga0495667_0072604 3300046559 Unclassified 2243
285 Ga0495581_0076767 3300047315 Bacteria 1933
286 Ga0495674_0062555 3300047319 Bacteria 3240
287 Ga0495674_0132681 3300047319 Bacteria 2098
288 Ga0495675_0138953 3300047444 Bacteria 1507
289 Ga0495684_0011904 3300047471 Bacteria 6710
290 Ga0496102_0386923 3300048905 Bacteria 1316
291 Ga0496104_0144587 3300048907 Bacteria 2284
292 Ga0496112_0063162 3300048915 Bacteria 3653
293 Ga0501034_0148151 3300049571 Bacteria 2323
294 Ga0501038_0137442 3300049574 Bacteria 2001
295 Ga0501043_0080456 3300049579 Bacteria 2560
296 Ga0501046_0077876 3300049580 Unclassified 2566
297 Ga0501047_0028423 3300049581 Bacteria 5391
298 Ga0501047_0037435 3300049581 Bacteria 4691
299 Ga0501047_0125104 3300049581 Viruses 2452
300 Ga0501070_0010063 3300049586 Bacteria 8000
301 Ga0501070_0078635 3300049586 Bacteria 2729
302 Ga0501073_0033203 3300049589 Bacteria 3676
303 Ga0501035_0067554 3300049822 Bacteria 3171
304 Ga0501044_0034174 3300049823 Bacteria 5335
305 Ga0501044_0037118 3300049823 Bacteria 5095
306 nmdc:mga05p37_331574_c1 3300050507 Bacteria 1797
307 nmdc:mga06r32_55630_c1 3300050510 Bacteria 3796
308 nmdc:mga0n895_287643_c1 3300050512 Bacteria 1666
309 Ga0501082_0008842 3300060353 Bacteria 8686
310 Ga0157372_10022697
311 Ga0070683_100000030
312 Ga0070683_100025004
313 Ga0070683_100027720
314 Ga0070683_100040152
315 Ga0070683_100055530
316 Ga0070690_100161142
317 Ga0068869_100016963
318 Ga0070666_10016958
319 Ga0070680_100012786
320 Ga0070680_100123269
321 Ga0068868_100024660
322 Ga0070660_100215652
323 Ga0070660_100245735
324 Ga0070671_100125318
325 Ga0070659_100069588
326 Ga0070659_100234547
327 Ga0070709_10087557
328 Ga0070714_100022235
329 Ga0070713_100002343
330 Ga0070713_100003309
331 Ga0070711_100134320
332 Ga0070662_100030988
333 Ga0070681_10111965
334 Ga0070681_10265751
335 Ga0070681_10340811
336 Ga0070681_10485594
337 Ga0068867_100052057
338 Ga0068867_100068232
339 Ga0070679_100047489
340 Ga0070679_100107519
341 Ga0070684_100000041
342 Ga0070684_100006727
343 Ga0070684_100035811
344 Ga0070684_100042363
345 Ga0070684_100144910
346 Ga0070684_100242849
347 Ga0068853_100013694
348 Ga0068853_100081189
349 Ga0070693_100033152
350 Ga0068855_100055955
351 Ga0068855_100143816
352 Ga0068855_100433384
353 Ga0068855_100501344
354 Ga0070664_100146584
355 Ga0068857_100011496
356 Ga0068856_100052291
357 Ga0068856_100124691
358 Ga0068856_100438910
359 Ga0068852_100062406
360 Ga0068852_100260807
361 Ga0068852_100292504
362 Ga0068859_100136149
363 Ga0068859_100323688
364 Ga0068864_100145429
365 Ga0068861_100081341
366 Ga0068863_100016425
367 Ga0068863_100413223
368 Ga0068858_100082353
369 Ga0068858_100117130
370 Ga0068858_100126017
371 Ga0068860_100014305
372 Ga0068860_100292144
373 Ga0070717_10043993
374 Ga0070717_10049906
375 Ga0070717_10253363
376 Ga0097621_100021422
377 Ga0068871_100010279
378 Ga0068871_100039823
379 Ga0068871_100065920
380 Ga0068871_100137144
381 Ga0068871_100277174
382 Ga0075431_100043603
383 Ga0075434_100132037
384 Ga0075429_100142395
385 Ga0097620_100136149
386 Ga0097620_100323679
387 Ga0105240_10010071
388 Ga0105240_10035569
389 Ga0105240_10078854
390 Ga0105240_10114425
391 Ga0105245_10003297
392 Ga0105245_10022922
393 Ga0105245_10040945
394 Ga0105245_10046397
395 Ga0105245_10118378
396 Ga0105243_10046384
397 Ga0105241_10018425
398 Ga0105241_10024439
399 Ga0105241_10063001
400 Ga0105241_10127651
401 Ga0105241_10146429
402 Ga0105242_10035457
403 Ga0105242_10038231
404 Ga0105242_10042880
405 Ga0105242_10066382
406 Ga0105242_10080213
407 Ga0105248_10018054
408 Ga0105248_10097243
409 Ga0105248_10150031
410 Ga0105248_10160092
411 Ga0105248_10251613
412 Ga0105237_10006421
413 Ga0105237_10068385
414 Ga0105238_10015696
415 Ga0105238_10035694
416 Ga0105238_10047363
417 Ga0105238_10382577
418 Ga0105249_10052704
419 Ga0105239_10007933
420 Ga0105239_10074930
421 Ga0157370_10022441
422 Ga0157369_10013964
423 Ga0157369_10020322
424 Ga0157369_10182915
425 Ga0157369_10274033
426 Ga0157374_10033668
427 Ga0157374_10042546
428 Ga0157374_10058787
429 Ga0157378_10033803
430 Ga0157378_10080995
431 Ga0157372_10057239
432 Ga0157372_10101975
433 Ga0157372_10276644
434 Ga0157372_10363163
435 Ga0157375_10010076
436 Ga0157375_10221311
437 Ga0163163_10023891
438 Ga0163163_10143886
439 Ga0163163_10160211
440 Ga0163163_10212829
441 Ga0163163_10287837
442 Ga0157379_10142044
443 Ga0157379_10345967
444 Ga0157376_10030547
445 Ga0157376_10043571
446 Ga0157376_10416355
447 Ga0157376_10521299
448 Ga0213876_10006950
449 Ga0213876_10009739
450 Ga0213875_10000041
451 Ga0213875_10001501
452 Ga0213875_10031236
453 Ga0213875_10042386
454 Ga0213875_10049501
455 Ga0213875_10074670
456 Ga0213875_10081887
457 Ga0213875_10112484
458 Ga0207680_10013824
459 Ga0207680_10159554
460 Ga0207699_10027260
461 Ga0207699_10140635
462 Ga0207654_10022243
463 Ga0207707_10127680
464 Ga0207707_10413623
465 Ga0207695_10009760
466 Ga0207695_10015226
467 Ga0207695_10052955
468 Ga0207695_10257971
469 Ga0207695_10323363
470 Ga0207671_10075008
471 Ga0207663_10027299
472 Ga0207660_10032511
473 Ga0207657_10213849
474 Ga0207657_10319033
475 Ga0207652_10089793
476 Ga0207652_10147238
477 Ga0207694_10029274
478 Ga0207694_10036275
479 Ga0207694_10050575
480 Ga0207694_10142475
481 Ga0207687_10035294
482 Ga0207687_10044847
483 Ga0207687_10097317
484 Ga0207687_10224239
485 Ga0207700_10001507
486 Ga0207700_10020189
487 Ga0207700_10085657
488 Ga0207664_10020803
489 Ga0207690_10246898
490 Ga0207706_10092770
491 Ga0207686_10026992
492 Ga0207686_10035894
493 Ga0207686_10143927
494 Ga0207709_10018489
495 Ga0207709_10051390
496 Ga0207711_10058943
497 Ga0207711_10088899
498 Ga0207711_10147552
499 Ga0207711_10193283
500 Ga0207711_10244477
501 Ga0207689_10008538
502 Ga0207689_10080874
503 Ga0207661_10000035
504 Ga0207661_10016140
505 Ga0207661_10024556
506 Ga0207661_10222118
507 Ga0207661_10239796
508 Ga0207679_10115768
509 Ga0207667_10038985
510 Ga0207667_10095102
511 Ga0207667_10108352
512 Ga0207667_10368553
513 Ga0207712_10037640
514 Ga0207658_10298495
515 Ga0207677_10156467
516 Ga0207703_10069170
517 Ga0207703_10181235
518 Ga0207703_10354337
519 Ga0207639_10071080
520 Ga0207678_10014653
521 Ga0207702_10075120
522 Ga0207702_10559377
523 Ga0207641_10258252
524 Ga0207641_10418616
525 Ga0207676_10142153
526 Ga0207676_10147196
527 Ga0207674_10003224
528 Ga0207675_100038884
529 Ga0207683_10155766
530 Ga0207698_10259052
531 Ga0268266_10010329
532 Ga0268265_10000496
533 Ga0268264_10021754
534 Ga0268264_10205300
535 Ga0268264_10375608
536 Ga0265323_10000691
537 Ga0265330_10000034
538 Ga0265330_10038005
539 Ga0265332_10000390
540 Ga0265325_10002858
541 Ga0265329_10004469
542 Ga0265331_10013907
543 Ga0265316_10000057
544 Ga0265316_10007009
545 Ga0265316_10037580
546 Ga0265316_10057613
547 Ga0265316_10177381
548 Ga0265314_10000039
549 Ga0265314_10021389
550 Ga0265342_10000266
551 Ga0265342_10020179
552 Ga0316574_0035172
553 Ga0373935_0070914
554 Ga0373935_0177418
555 Ga0373927_0003128
556 Ga0373933_0029640
557 Ga0373937_0018064
558 Ga0373925_0026478
559 Ga0373925_0097147
560 Ga0436364_0094278
561 Ga0436364_0467758
562 Ga0436364_0514628
563 Ga0436364_0593544
564 Ga0436364_0671634
565 Ga0436364_0673348
566 Ga0436364_0687626
567 Ga0436364_0754760
568 Ga0436364_0789766
569 Ga0436364_0967681
570 Ga0436365_0533170
571 Ga0436365_0602508
572 Ga0436365_0924538
573 Ga0436365_1339401
574 Ga0436365_1440783
575 Ga0436363_0921108
576 Ga0436362_1034052
577 Ga0451577_0011776
578 Ga0453683_0000210
579 Ga0453684_0000036
580 Ga0453684_0007625
581 Ga0453684_0023153
582 Ga0451576_0011737
583 Ga0451576_0131322
584 Ga0451576_0265241
585 Ga0495580_0030143
586 Ga0495580_0150327
587 Ga0495580_0181138
588 Ga0495594_0098356
589 Ga0495665_0043653
590 Ga0495645_0096312
591 Ga0495645_0133130
592 Ga0495645_0198207
593 Ga0495667_0072604
594 Ga0495581_0076767
595 Ga0495674_0062555
596 Ga0495674_0132681
597 Ga0495675_0138953
598 Ga0495684_0011904
599 Ga0496102_0386923
600 Ga0496104_0144587
601 Ga0496112_0063162
602 Ga0501034_0148151
603 Ga0501038_0137442
604 Ga0501043_0080456
605 Ga0501046_0077876
606 Ga0501047_0028423
607 Ga0501047_0037435
608 Ga0501047_0125104
609 Ga0501070_0010063
610 Ga0501070_0078635
611 Ga0501073_0033203
612 Ga0501035_0067554
613 Ga0501044_0034174
614 Ga0501044_0037118
615 nmdc:mga05p37_331574_c1
616 nmdc:mga06r32_55630_c1
617 nmdc:mga0n895_287643_c1
618 Ga0501082_0008842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01384

PHO4

Phosphate transporter family

22

316

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l85-assembly1.cif.gz_A the sodium-dependent phosphate transporter 0.8988 5 341
6l85-assembly1.cif.gz_A the sodium-dependent phosphate transporter 0.8813 5 341
5t16-assembly2.cif.gz_I crystal structure of yeast rnase iii (rnt1p) complexed with a non-hydrolyzable rna substrate analog 0.2825 150 279
3j9v-assembly1.cif.gz_Z yeast v-atpase state 3 0.2777 80 258
3j9v-assembly1.cif.gz_Z yeast v-atpase state 3 0.2652 80 258
ID Description Score Start End Superfamily
af_P38361_8_554_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8386 10 329 3.40.50.2020
af_P38361_8_554_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7835 10 329 3.40.50.2020
af_A0A0R0G921_199_314_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3531 147 251 1.20.140.150
af_Q54K81_601_727_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3351 143 247 1.20.120.230
af_I1N7G8_11_135_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.3288 141 244 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A538GE76-F1-model_v4 Inorganic phosphate transporter 0.9596 5 338 GO:0005315
GO:0016020
GO:0035435
AF-A0A7V2LXL0-F1-model_v4 Inorganic phosphate transporter 0.9575 7 343 GO:0005315
GO:0016020
GO:0035435
AF-A0A7V2LXL0-F1-model_v4 Inorganic phosphate transporter 0.9518 7 343 GO:0005315
GO:0016020
GO:0035435
AF-A6LUB7-F1-model_v4 Phosphate transporter 0.9516 1 341 GO:0005315
GO:0016020
GO:0035435
AF-A0A420FT43-F1-model_v4 deleted 0.9515 5 339

Map